states of matter Word Searches

annie's word search 2024-05-16

15 Items: atomic mass unithigh temperature gasprotons and neutronsprotons and electronspostively charged atomsneutrally charged atomsnegativelty charged atomsa table of chemical elementsa mass of atom of a moleculeessential to living organismscharging a object without touching ita way of representing atoms or molecules...

High Holy Days 5785! 2024-09-20

15 Items: 'All Vows'Days of ___Day of AtonementGreat with applesHoly, Holy, Holy!Ten Days of ______.Literally 'Good day'Last month of the year'Return' or 'Repentance'Yiddish Holiday GreetingFirst month of the New YearHorn used during High Holy DaysFruit, said to have as many seeds as there are mitzvot.Blessing recited when doing something for the first time...

Common Diseases 2025-12-11

20 Items: The study of the causes of disease is called?This disease is transmitted through flea biteJoint inflammation that can be acute or chronic.Evaluating tissues with a microscope is termed is called?Causative organism family of this disease is Rhabdovirus.Causative organism family of this disease is Giardia Lambia....

jogos 2025-04-15

19 Items: GTAfnfFifaMarioSonicZeldarobloxPac-ManFortniteMega-MenminecraftFree-firebear-alphaGod-of-Warbrawl-starsDonkey-KongCall-of-dutynicos-nextbotsStreet-Fighter

Word Search 2 2024-10-18

16 Items: Pleural membrane attached to the lungs.The only elastic cartilage of the larynx.One of the paired cartilages in the larynxprevents food from getting into the airways.Pleural membrane attached to the thoracic wall.The part of the respiratory system above the larynx.The part of the respiratory system below the larynx....

7th Grade Review 2024-05-07

20 Items: FCCLA's official flowerWhat the F in FCCLA stands for.The acronym for the 4 areas of child development.A kitchen tool used to flip pancakes or turn hamburgers.A kitchen tool used to beat eggs and add air to mixtures.The type of stitch we used for our final sewing projects.The type of project we did where you chose what you would cook....

Development Grade 11 Geography 2025-07-11

23 Items: Goods sold by one country to another.Regulations or policies that restrict trade.Goods bought by a country from another country.Financial summary of all payments made by a country.Refers to the carrying and moving of goods across the globe.Countries which are also referred to as 'countries of the south'....

Hospice Word Search 2025-08-03

28 Items: – The expected outcome or course of a disease.– Accurate recording of patient care and clinical decisions.– The process of evaluating a patient’s needs and condition.– A federal insurance program that often covers hospice care.– The act of directing a patient to hospice or other services....

Dove Holiday Word Search 2023-12-04

10 Items: Jewish New YearHindu festival of lightsHindu festival of colorsCelebrating the birth of Jesus ChristA day honoring Buddha's enlightenmentMexican holiday reuniting the living deadA holy, month-long observance for MuslimsCelebrating the resurrection of Jesus ChristCelebration of African-American culture held in December...

Kim's Word Search 2025-03-12

15 Items: CampYorkBearsGolferGivingHawaiiLovingSpunkySkiingof fourHostessPiedmontShoppingFargo Bankof Southern California

Enjoy Shorty 2025-05-26

15 Items: A citrusCapital of OmanTo be or not to beOne of the Jackson 5Largest Greek islandThe national flower of FranceSomething you no longer get at meetingsWhat is the national animal of Scotland?What is the world's most expensive spice?What color is the skin of an adult polar bear?What is the main ingredient of a Greek tzatziki?...

Famous Word Search 2025-10-26

16 Items: personauthortouringmonumentitineraryoutstandingtravel by cartravel by planeit is 342 m highopposite of arrivedopposite of was bornPast simple of buildopposite of equalitywas born in stratfordtravel by ship or boatfamous landmark in London

Pulmonary Genetics 2025-04-01

15 Items: feature of 50% of PCD casesskin findings of Birt Hogg Dubefeature seen in 30% of AFAB with TSCcondition caused by TERT, TERC, DKC1gold standard of cystic fibrosis testinginjury or inflammation to the alveolar spaceoculocutaneous albinism, Puerto Rican founder mutationsymptoms include high pressure in arteries of the lungs...

Deaf Appreciation Month Word Search 2025-03-11

15 Items: Not completely deafDeaf Awareness MonthTo have loss of hearingA device that can help people hearA famous deaf inventor and businessmanThe last name of the inventor or hearing aidsA famous deaf disability rights activist and an authorThe past of deaf or hard of hearing people and cultureA famous deaf composer and pianist in the 1700s and the 1800s...

Double Consonants 2023-03-19

20 Items: oddofferworryhobbyborrowrabbitmatterbottleriddenbubblesuffersaddlewrittencurrentlettuceshuddertomorrowslippersdifferentgrasshopper

Word Search #2 science 2025-07-03

40 Items: pHDNAAtomCellAcidBaseDataForcePowerTableMotionEnergyMatterVolumeTheorySpeciesProteinGravityDensityElementPhysicsBiologyMoleculeOrganismGeneticsChemicalReactionCompoundEcosystemEvolutionChemistryMicroscopeLaboratoryHypothesisExperimentChlorophyllTemperatureObservationPhotosynthesisThermodynamics

221 - Astrophysics 2025-07-19

40 Items: gasionjetrayatombeambulkcoredarkfluxheatmassmuonspinstarwavebosonfieldforcegluonlightphasequarkspacebaryondipoleenergyequatematterphotonplasmaangulardensitydopplerentropygravityneutronnuclearorbitalneutrino

Algebra 1 Unit 1 Vocabulary 2025-09-25

17 Items: Q3-Q1. Measures variability in dataMedian of the first half of the dataMedian of the second half of the dataconsists of the minimum, the three quartiles, and the maximum.Average. Add up the data points and divide by total number of data pointsMiddle value. Put data in order from least to greatest to find the middle...

MNP Word Search 2023-05-30

20 Items: She offers protection from rabies.These are usually found flanking the goddess.This deity is placed on the top arch of the Mata’s temple.The Chitara family come from the _____ taluka of Ahmedabad.This is the symbol of the sun which controls day and night.She is symbolized only by a fly whisk made of peacock feathers....

Intro to Botany 2025-02-04

29 Items: scientist that study plantsa plant having one cotyledona plant having two cotyledonplants do this to conserve waterouter layer of tissue in a plantspace on a stem between two nodesgrowth that increases plants widththin stalk that attaches the blade to the stemsecond set of leaves that appear after germination...

HYPER AND HYPO ! 2023-10-08

15 Items: LONGSIGHTEDNESSEXTREME WEAKNESSSHORTSIGHTEDNESSEXCESSIVE VOMITINGTHICKENING OF BONEDEFICIENT MUSCLE TONEEXCESSIVE PERSPIRATIONEXCESSIVE TALKATIVENESSEXCESSIVE SECRETION OF MILKDECREASES BLOOD SUGAR LEVELLOW POTASSIUM LEVEL IN BLOODDEFICIENCY OF SODIUM IN THE BLOODDECREASED AMOUNT OF OXYGEN IN THE TISSUE...

Which word in the puzzle is one of the seven plagues of Egypt 2025-03-20

10 Items: licehailbloodfrogsfliesboilslocustsdarknessof livestockof firstborn

Global I Review 2024-01-09

30 Items: Be goodBe chillBe good or elsePlebeians and...The first civilizationThe Islamic code of conductChristianity, Judaism, IslamThe Greek word for city-stateThe dynasty started by Liu BangA city-state that rivaled AthensAncient Mesoamerican civilizationCapital of the Eastern Roman EmpireHinduism, ancient Egypt, Rome, Greece...

Plate Tectonics Wordsearch 2023-02-15

14 Items: The outer layer of the EarthWhen one plate slips below anotherThis continents are in constant ___When this rises and cools, it creates new crustWhen plates push up, it creates this kind of landformType of heat transfer that causes tectonic plates to moveLast name of the scientist who proposed continental drift...

Trigonometry Identities 2025-05-07

21 Items: a² + b² = c²Reciprocal of sineReciprocal of cosineReciprocal of tangentBest pre calc teacherOpposite over adjacentStudy of triangle mathSpace between two linesGreek letter for anglesAdjacent over hypotenuseSays two things are equalMath rule or relationshipFlipped version of a valueFunction where f(–x) = f(x)True equation for all values...

Macbeth 2024-10-30

10 Items: his heirs will be kingthe author of the playthe protagonist of the playmanipulates Macbeth with magiccomes up with the plan to kill Duncanthe son of Duncan who flees to Englandthe son of Duncan who flees to Irelandthe only person Macbeth should beware ofthe king of Scotland at the beginning of the play...

Types of speech : Informative (no.1-5) Persuasive (no.6-10) 2024-06-30

10 Items: Informative speeches may be grouped into _____ categories.Persuasive speeches may center on questions of _____, value, or policy.Speeches about _____ usually are organized in chronological, spatial, or topical order._____ is the process of creating, reinforcing, or changing people’s beliefs or actions....

Thermal Energy Word Search 2024-09-23

40 Items: sunhoticeaircoldfiremasstimewoodmoneymetalstovefrozenenergysystemmattercoppercelsiusplasticsciencemaximizeminimizecriteriaaluminumlavalampradiationconductorinsulatorstyrofoammaterialsconductionconvectionfahrenheitconstraintthermometertemperatureenvironmentheattransferthermalenergykineticenergy

Earth Sci 2025-03-10

41 Items: DNANeonLifeStarFireGlobeWaterArgonFungiStateFluidPlanetOxygenHeliumCarbonTheoryMatterPlantaeGlucoseDioxideHydrogenTungstenAnimaliaOmnivoreCreationMagneticReactionChemicalBacteriaPlanetaryCelestialOxidationDistilledEukaryoteCarnivoreHerbivoreCombustionProkaryoteHypothesisPhotosynthesisChemosynthesis

38 - Physics Terms 2025-07-12

40 Items: atomheatfieldgammalaserlightwavesenergyforcesfusionjoulesleptonmagnetmattermomentphotonplasmaquantascalarspinorstrainvectorvortexzoningbarrierbosoniccoulombcurrentdensitydiffuseelasticentropyfractalinertiaionizedkineticneutronwattagefrictiongraviton

Physical Science - Semester 1 Word Find 2025-12-02

40 Items: gasionmassatomsolidcloudmattervolumeweightliquidplasmaprotonyieldsfusiondensityelementmixtureneutronnucleusformulaproductfissionphysicalchemicalcompoundelectronequationreactantbalancedsubscriptexothermichomogeneousevaporationcoefficientendothermicradioactivecondensationpuresubstanceheterogeneousperiodictable

Atom - nuclear 2023-10-17

20 Items: protons + neutronssaid electrons travelled in orbitals.radiation with high penetrating powersubatomic particle with neutral chargeparticle that is basically an electronsubatomic particle with positive chargesubatomic particle with negative chargeidentity of element. Number of protons.discovered electrons. Cookie dough model...

Spring into Security 2024 Word Search 2024-02-14

20 Items: Basic unit of digital information.Programming instructions for software.Pattern recognition through algorithms.Advanced neural network-based learning.Process of acquiring knowledge or skills.Extraction of insights from large datasets.A specific job or assignment to be completed.Field involving automated machines and systems....

NATP Chapter 14 2025-04-09

22 Items: Heart relaxesSlow breathingRapid breathingHeart is at workNormal breathingDifficulty breathingInhaling air into lungsThe absence of breathingExhaling air out of lungsUsed to measure temperatureWarm soak of the perineal areaUsed to measure blood pressureConsistently low blood pressureConsistently high blood pressure...

Environmental Events and their Implications to Human Lives 2023-03-11

15 Items: The extent of being liable.It is a potential source of harm.A real threat to general welfare.It is commonly known as biohazards.It is also known as social hazards.It is commonly known as tidal waves.The gradual caving in or sinking of an area.The sudden and violent shaking of the ground.These are hazardous substances that can cause harm....

Environmental Events and their Implications to Human Lives 2023-04-01

15 Items: The extent of being liable.It is a potential source of harm.A real threat to general welfare.It is commonly known as biohazards.It is also known as social hazards.It is commonly known as tidal waves.The gradual caving in or sinking of an area.The sudden and violent shaking of the ground.These are hazardous substances that can cause harm....

emotions word search 2025-06-11

18 Items: most people are ...what people say when there cryingmarried people feel this for each othera feeling of worry, unease, or nervousnessmost people feel thins when they see a spidermost people feel this when a good thing happensmost siblings feel this when they get into an argumentpeople feel this when they see or hear something grows...

CHRISTMAS IN UNITED STATES 2024-12-06

10 Items: ELFTREESNOWGIFTSANTABELLSNORTHFROSTYREINDEERSTOCKING

Globalization 2025-08-19

27 Items: In comparison.Public perception.Area of expertise.Provider of goods.A reduction in priceTo use up completely.To take something awayA product not made abroad.To leave out or not include.Operates in several countries.Purchase and use of goods and services.Making something easy to use or access.Most important, powerful, or influential....

English 1 Terms 2024-12-02

17 Items: __________ is the central idea___________ is a writer's attitude.The exact meaning of a word is _________.A sequence of events that make up a story.To illustrate is to show an ______________.______ is a transition for adding information.Something that stands for something is _________.Words that join other words are ________________....

family 2024-11-13

41 Items: sonhugroadareaeachtearhidecarekissracepullalongservecarrymarrysolvepowersilentstrictfollowabsentseldomacrossmemorygrowthreasonparentfinishrefuseresultmatterpostmanharmonyseriousdiseasetrailermountainhandsometouchingpositionrelationship

family 2024-11-13

41 Items: sonhugroadareaeachtearhidecarekissracepullalongservecarrymarrysolvepowersilentstrictfollowabsentseldomacrossmemorygrowthreasonparentfinishrefuseresultmatterpostmanharmonyseriousdiseasetrailermountainhandsometouchingpositionrelationship

5-404 WINTER WORDSEARCH 2024-12-20

39 Items: DATASOILJERULUCAGIFTSJULIAIMRANDYLANJAELAELSIEGRACEANANOJESUSWINTERGRINCHSLEIGHENERGYMATTERHAREEMSHAKERMOAMENGISELEMARIAMOLIVERSOPHIASOPHIEGIANNAABIGAILVACATIONPRESENTSEVIDENCEKIMBERLYLAWRENCECANDYCANEECOLOGISTECOSYSTEMJEFFERSONDECOMPOSERENVIRONMENT

Sharp 2025-02-11

40 Items: hotlabwindcoldworkdeskMarscloudvaporsharpgrademoodyEarthLightparcelchangeenergyfactorsourcemattersafetyhunterPlanetpatternweatherbulldogsciencerespectpartnerJupiterpressurehumiditytransferforensicsatmospherebasketballevaporationmeteorologytemperaturecondensation

War Word Search 2025-04-30

40 Items: WarLandJoinFlagTreeSoilStateCycleHumanEmpireTrenchTreatyBorderAlaskaHawaiiEnergyMatterChangeBeaverImpactSoldierAustriaGermanyFoodwebHabitatAlliancePurchaseSunlightProducerConsumerOrganismTerritoryExpansionFoodchainNutrientsEcosystemPollutionDecomposerNationalismAssassination

Ears Word Search 2025-06-03

41 Items: GasEarsNoseHeatEyesMassAtomSkinSoundCellsBonesHandsLungsBrainLiverVeinsForceBloodSolidLightMouthHumanHeartSpineLiquidEnergyMagnetVolumeMotionNervesMatterGravityMusclesCircuitDensityStomachKidneysFrictionArteriesMoleculeElectricity

States in the Southeast 2020-09-03

10 Items: GeorgiaAlabamaFloridaKentuckyVirginiaTennesseeMississippiWestVirginiaNorthCarolinaSouthCarolina

States and Their Nicknames 2024-09-18

10 Items: AlohaoceanGoldensoonerPelicanbeehivebuckeyeSunshinelonestarevergreen

CHRISTMAS IN UNITED STATES 2024-12-06

10 Items: SCARFPARTYPARADETINSELCOOKIESHOLIDAYSNOWFALLPEPPERMINTWINTERTIMENUTCRACKER

CHRISTMAS IN UNITED STATES 2024-12-06

10 Items: ICEYULECAROLCLAUSTINSELWINTERSNOWMANPRESENTORNAMENTPOINSETTIA

Constitution 2023-09-19

20 Items: vetoratifyReviewPowersPowersPapersProcessCollegepreambledelegaterepublicamendmentbicameralof Powersof RightsfederalismConventionSovereigntyconstitutionand Balances

The Nutcracker Ballet 2023-10-11

20 Items: taleclaraPrinceCoffeemagicalde deuxof SnowelegancegracefuldazzlingballeticSoldierswhimsicalof SweetsgrandiosedreamlikeenchantingPlum Fairytchaikovskyof the Flowers

Bady 2016-10-25

3 Items: FarahUnitedStates

Game Online of Colaboration Project (National Hero, Province/Capital City, Local Foods, Tradition, and Culture) 2025-11-12

10 Items: A hero from MalukuOne of Palembang's typical foodsThe capital of North Sulawesi provinceThe capital of West Kalimantan provinceThe name of the capital of Central JavaThe name of the capital of East KalimantanAngklung and gamelan musical instruments come fromLompat Batu is a traditional culture from the island of...

CELL CYCLE 2025-01-07

18 Items: double helixresting phasemeans "one part"means "many parts"life activities of a cellbuilding block of proteinprovides quick energy for cellcarries DNA message to ribosomecarries amino acids to ribosomebuilding block of nucleic acidsDNA replicates during Interphasecell divides into 2 identical cellsa structural component of ribosomes...

APP Week 2025-05-31

17 Items: ExpertsAutonomyMidwivesEmpoweredEducatorsSeptemberAdvocatesChampionsAssistantLeadershipof PracticeAnesthetistPublicationsPractitionerCertificationBased Practiceof Nursing Practice

Sharks Word Search 2025-03-25

22 Items: What are mermaid’s purses? ________What are baby sharks are called? ________What type of skeleton do sharks have? ________What is the fastest species of shark? ________What is the smallest species of shark? ________How do sharks communicate with each other? ________What is an excessive fear of sharks called? ________...

Water from the Rock 2025-06-02

26 Items: Israel's leaderMoses' successorPast tense of bringSet up, as in a tent_____________ of IsraelAnother word for a rockA hard geographical itemThe children of ___________Another word for "traveled"Meaning "based upon all this"To take in liquids into the bodyWhere the rock was (Exodus 17:6)God told Moses to _______ the rock....

Lesson 4: Father of Many Nations 2024-04-05

14 Items: heirisaacshieldrewardnationnationsbehavioralmightyoffspringtestamentof promisedemonstrateof the earthrighteousness

Econ concepts 2023-07-16

16 Items: iloveeconomicsmyfavoriteclassbestteacherevergreatlifelessonsThe study of the economic behavior of individuals and firms.A situation in which extra units of something produce successively smaller benefits.A school of economic thought advocating government spending to pull economies out of recession....

Solar System 2025-10-22

14 Items: orbits star directlyfails to clear orbitorbits planet directlysame as asteroid but smallerSun-based solar system modelEarth-based solar system modelmass from space hitting surfaceforce of attraction between massescelestial mass of rock, gas, & dustmass from space striking atmospherefield of comets & debris past Neptune...

The Origin of Life 2024-07-10

5 Items: panspermiaprimordialabiogenesiscreationismStates that life originates only from other living things.

APP Week 2025-05-31

17 Items: ExpertsAutonomyMidwivesEmpoweredEducatorsSeptemberAdvocatesChampionsAssistantLeadershipof PracticeAnesthetistPublicationsPractitionerCertificationBased Practiceof Nursing Practice

Pope Word Search 2025-06-10

26 Items: ofMaypopeheadawaybornfromstaypoorhopeAprilpapalpeaceEarthbravefaithchosencaringleaderhumblenaturememoirprotectencouragethe age ofguesthouse

FTFC Word Search 2024-02-08

8 Items: BSN Treat Customer Fairly Charter (TCF) can be found in the Bank's ______As BSN staff, we need to uphold high standards of ______, integrity and professionalism in all dealings with financial consumers.One of BSN's promise in delivering fair treamtement to our customers is to ensure that customers are provided with fair and ________ terms...

3 Worlds Meet 2025-09-08

10 Items: a large farm zonea series of religious warsa monotheistic religion of the muslimsWhen you travel from one place to anothera mixed woodland grassland biome and ecosystemthe line of descendants of a particular ancestora period marked in time of Classical learning and wisdoman ethnolinguistic group of indigenous people of mesoamerica...

Physical Science Word Search 2024-04-11

43 Items: gasmassstirsizerustsolidcolorrulershapecolorrepelsievedecaymatterliquidvolumefilterexpandtexturebalanceattractmixturemeltingboilingpropertymeniscussolutiondissolvesolutionparticlefreezingsubstanceconditionswatervaportemperaturetemperaturedissolvingratephysicalchangechemicalchangegraduatedcylinderwaterdisplacementmagneticattraction...

Science! 2024-09-09

40 Items: GASATOMHEATDATAFORCELIGHTSOUNDSOLIDMATTERENERGYLIQUIDMETHODGRAVITYCIRCUITBOILINGMELTINGMIXTUREHABITATRESULTSKINETICFRICTIONFREEZINGCHEMICALSOLUTIONDISSOLVETRANSFERMAGNETISMINSULATORCONDUCTORECOSYSTEMPOTENTIALEXPERIMENTHYPOTHESISCONCLUSIONELECTRICITYTEMPERATUREEVAPORATIONCONDENSATIONGRAVITATIONALTRANSFORMATION

3 2024-11-14

41 Items: sonhugroadareaeachtearhidecarekissracepullalongservecarrymarrysolvepowersilentstrictfollowabsentseldomacrossmemorygrowthreasonparentfinishrefuseresultmatterpostmanharmonyseriousdiseasetrailermountainhandsometouchingpositionrelationship

Atom Word Search 2025-06-03

41 Items: GasAtomMassHeatSkinEyesEarsNoseForceLightSoundSolidHumanBrainHeartLungsBloodBonesLiverVeinsCellsSpineMouthHandsEnergyMagnetMotionVolumeLiquidMatterNervesGravityCircuitDensityMusclesStomachKidneysMoleculeFrictionArteriesElectricity

221 - Astrophysics 2025-07-22

40 Items: gasionjetrayatombeambulkcoredarkfluxheatmassmuonspinstarwavebosonfieldforcegluonlightphasequarkspacebaryondipoleenergyequatematterphotonplasmaangulardensitydopplerentropygravityneutronnuclearorbitalneutrino

Unit 1 Word Search 2025-09-15

40 Items: GasMassAtomBondSolidGroupModelMatterVolumeWeightLiquidPlasmaProtonPeriodSymbolMeltingNeutronNucleusElementMixtureFreezingElectronMoleculeCompoundIonicBondPropertiesPhasechangeSublimationVaporizationCondensationAtomicNumberCovalentbondChemicalBondPeriodicTablePureSubstanceInvestigationStatesOfMatterPhysicalPropertyChemicalPropertyMolecularStructure

God's Names - By: Dillon Postma 2024-04-10

18 Items: sonwordabbajesusbiblerabbisaviorof Godof GodfathermessiahteacherMessiahof JesusDelivererDelivererChosen OneRelated to Man

Memory Word Search 2024-12-17

18 Items: "Flash Drive" of the brain​Inferior to hippocampus proper​Paired, almond-shaped structure​Learning stage of memory creation​Ability for brain to adapt and learn​A type of memory correlated with smell​Receiving input from Entorhinal Cortex​A type of memory correlated with hearing​gateway between hippocampus and neocortex...

Cycle 1 S2 Week 11 2025-04-23

11 Items: the loan on a homeHaving more than one possible meaning; unclearto express a math expression into its lowest termsmatter that has come from a recently living organisma character who recounts the events of a literary workThe amount of money required to pay for the basic thingsunrestricted buying and selling of goods between countries...

Occupational Therapy Care vocabulary 2023-03-10

23 Items: adulteatinghealthdevicereportbathingof lifeleisureculturegroomingmobilitydressingtoiletingpediatricassessmentadaptationenvironmentproductivitydevelopmentalaccommodationof daily livingcare activitiesrecommendations

St. Brendan the Navigator Word Search 2023-11-16

12 Items: fenitmonkstraleeirelandfinnianscotlandmonasteryannaghdowncolumcilleof Irelandthe Navigatorof the Blessed

PID 2023-01-31

47 Items: shayjulylifetaxespresscolonyvotingspeechstatesnationunitedanarchylibertycabinetfederalarticlesjudicialdictatormonarchycolumbuspropertyfranklinsenatorscitizensreligionassemblybeararmspetitionamendmentexecutivesovereignjeffersonwashingtontabularasademoncracyrevolutionkinggeorgedeclarationlegislativeindependencebillofrightsconstitutionstateofnature...

Child Welfare Information Gateway 2024-03-19

45 Items: kindatachattoolsyouthcourtsequitystatestraumatribeslibraryneglectparentswebsiteadoptionoutreachresearchbelongingdiversityinclusionknowledgewellbeingworkforcecaregiversengagementevaluationfostercarepermanencypreventiontechnologycommunitiespartnershipchildwelfaremaltreatmentpublicationscollaborationgrandfamiliesmodernizationreunificationsubscriptions...

Unit 3 Vocab Word Search 2025-11-14

12 Items: skewedspreadoutlierassociationcategorical dataline of best fitquantitative datameasure of centermeasure of spreadstandard deviationinterquartile rangecorrelation coefficient

CHAPTER 14 2023-04-21

16 Items: eraeonfossilepochsperiodshalf-lifekt-boundrypaleontologistplatetectonicsrelative-datingradiometricdatingcambrian-explosionlaw-of-superpostiongeologic-time-scaleendosymboint-theorytheory-of-biogenesis

Happy Birthday, Michael!! 2025-08-02

13 Items: to the leftto the righta great leapgroup of twomonth of loveseven of themmost of Earthjust next doorbackwards loopdrive with easewithout minionsbefore an audiencesounds like enchiladas

Improperfraction Word Search 2023-01-12

12 Items: part of wholetop of fractionbottom of fractionnumerator is larger thanfractions that are equalthe product of two factorsnumber whole number with fractionnumerator is smaller than denominatorfraction using lowest number possiblea number multiplied with another numberknown size or amount that helps understand the difference...

Spelling 6 2024-03-27

10 Items: opposite of shortthe opposite of pushanother word for nicethe solid form of waterthe eighth month of the yearused to make windows and cupspart of an animals foot, especially catsa mineral used in jewelry, like a diamonda small round piece of metal used for moneyparts of the body muscles connect to (plural)

Nail Diseases and Disorders 2025-03-12

20 Items: nailspoon nailswhite spotsbitten nailstrumpet nailfolded nailsingrown nailsfungal infectionram's horn or clawtiny pits roughnessdeformity or diseasethickening of the naildarkening or black bandlifting of the nail plateskin becomes split or tornsplit brittle nails with ridgesthin white nail plate very flexible...

Words Related to Sleep (States & Actions) 2025-12-03

20 Items: napdozerestyawndreamsnorewearysnoozedrowsesheetsslumberpajamaslullabyfatigueinsomniamattressnightmaresleeptalksomnolencesleepwalking

Aerodynamic Word Search 2025-10-30

25 Items: Real-world applicationEarly models of designsStudy of motion and forcesScientific tests conductedPhysical model for testingOutdoor real-world testingUsing computer calculationsHow well a system functionsFactors that can be changedPositive aspects or benefitsFacility for airflow testingPower efficiency measurementNegative aspects or drawbacks...

International Celebrations and Festivals. 2024-09-18

16 Items: festival of colorsMuslim fasting monthBeer festival in GermanyHindu festival of colorsWater festival in ThailandFestival of lights in IndiaJewish celebration with candlesLunar New Year celebrated in ChinaMexican holiday honoring the deceasedIrish holiday honoring the patron saintStAmerican holiday with a feast of gratitude...

La Chasseuse de la Particule - Vocabulaire 2025-05-21

17 Items: sofileproudprizematterweightcountrycenturyMoroccounknownpowerfulto teachto reactbuildingapparatusconservativeselementary particles

Hausa City States 2024-08-13

7 Items: RanoKanoGobirBiramDauraZazzauKatsina

THE BLOOD 2024-04-04

24 Items: ELSEloveWINEjesusBLOODWHOLEsavedcrossgloryLIVEStruthenoughchristOF GODCHAINSfreedomvictoryhealingsurrendercrucifiedhallelujahforgivenessresurrectionOF SUFFERING

Branches of Government Wordsearch 2024-12-18

22 Items: VetoBillsHouseSenateBranchOrdersPolicySpeakerCabinetCongressMajorityMinorityLawmakingCommitteePresidentPresidentFilibusterImpeachmentof the UnionBranch (Congress):of RepresentativesCommander-in-Chief

Mock Trial 2025-11-10

29 Items: JuryJuryjurorCourtIssueJudgeFelonycorpusMotionCounselprocessHearsayVerdictWitnessof proofof courtreporterevidenceMistrialAcquittalDefendantPlaintiffProsecuteTestimonyAdmissibleConvictionIndictmentMisdemeanorinstructions

Building Components 2023-02-20

25 Items: a lowest part of basea top that covering of a buildingto guide water flow from the roofa protection from the rays of the sunthe bottom horizontal member of a walla very tall building with many storiesthe part of a wheel or tire that makes contacta triangular portion of a wall between the edgesprovide the structure's stability from the ground...

Word Search - 2nd Game 2025-04-10

24 Items: Famous rice dish with chickenMost popular bun in BreadtalkA popular savory fried dough snackA small, steamed bun with a filling-BaoSoft and tender grilled skewers of meatSweet, chewy dessert made from glutinous riceMinced meat and dough and being fried afterwards.A thick rice porridge served with different toppings...

Chapter 7 Foundations Electricity 2025-05-17

31 Items: also known as probe1.1,000 of an amperealso known as insulatorray Tesla high-frequency currenttherapy also known as phototherapyany material that conducts electricitycurrent rapid and interrupted currentelectrode used on the area to be treatedsubstances that speed up chemical reactionsuse of electrical currents to treat the skin...

Unit 3 Vocabulary Word Search Review 2025-11-07

40 Items: a minor wrongdoingnot harmful or offensivevery unpleasant, annoyingbeyond criticism, faultlessbrisk and cheerful readinesscountless or extreme in numbernoxious, harmful, or poisonouscareful of one's speech/actionswarn or reprimand someone firmlyauthoritative counsel or warningthe state of being without guiltnot showing respect, impertinence...

2/28 2025-02-28

30 Items: Impeccable – Flawless or perfect.Benevolent – Well-meaning and kindly.Detrimental – Causing harm or damage.Tenuous – Weak or slight; insubstantial.Intricate – Very detailed and complicated.Epiphany – A sudden realization or insight.Imperative – Absolutely necessary or required.Surpass – To exceed or go beyond expectations....

Vocab Word Search 2022-09-08

20 Items: to ask a questionthe act of hunting for factsthe size or amount of somethingto work effectively with othersmodel a constructed model of somethingmodel a picture that represents somethinga guess or hypothesis based on observationsa factor in an experiment that affects the outcometools and supplies needed to conduct an experiment...

Geography Terms 2022-11-16

28 Items: A small streamWet spongy groundNatural elevationA small wooded hollowNarrow gorge with streamrounded hill or mountainA high steep face of rockA ring shaped coral islandA waterway dug across landA slowly moving mass of iceA steep rugged rock or cliffsmall low lying coral islandA small sheltered bay or inletA ridge of sand created by wind...