states of matter Word Searches

Chapter 2: Fundamentals Of Ecology Vocabulary review Part 1 2025-09-11

18 Items: The living aspects of an organism's environment.A large increase in a population of phytoplankton.The nonliving aspects of an organism’s environment.The collection of all of the earth’s ecosystems together.Tiny photosynthetic organisms that float in ocean currents.The specific place in the environment where an organism lives....

Unit 2 Vocabulary 2025-09-26

35 Items: GasMassCoreCoreCoreSolidCrustCrustFocusFaultDriftMatterVolumeLiquidMantleTrenchDensityCurrentSeismicVolcanoEpicenterTectonicsDivergentTransformSpreadingMechanicalMesospherePlasticityEarthquakeConvergentSubductionLithosphereOcean RidgeCompositionalAsthenosphere

basic electricity 2025-10-11

32 Items: ArcFlashthe rate of doing worka simplified schematic diagramthe unit of measurement for voltagethe bypassing of a load by a conductora coil of wire wrapped around a soft iron corehaving a continuous path for current to followa device that converts AC voltage to DC voltagethe basic unit of measurement for electric current...

Jackys cool word search 2022-11-28

10 Items: moves parrelnumber of wavesmeserued in meterslocation of maximunmaximum displacementmeasure of displacementhighest point on the wavethe distance of wave cycleereas of maximum displacementwaves move the medium perpendicular

ENVIROMENTAL 2023-03-15

20 Items: Worldwideits powerIts all around usIts pure not manmadeDefective or not in useThe industry of buildingRenewable or non renewableThe reusing of old materialsa threat from global warmingIs harmful to the environmentThe release of greenhouse gasesA Hydrocarbon found in the groundThe conversion of sunlight into energy...

Week 6 Biology Word Search 2025-10-08

11 Items: Maintaining a balanced environment.The movement of water across the membrane.The passive and spontaneous movement of particles across the membrane.The release of large particles in vesicles to the outside of the cell.When the concentration of the solution is lower than the inside of the cell....

Academic vocabulary 2025-12-11

11 Items: The rhythm and intonation of a languageSomeone who regularly travels between work and homeAny of two or more actual representations of a morpheneRelating to the grammatical arrangment of words in a sentenceConnected with the accepted way of spelling and writing wordsConsisting of parts or things that are very different from each other...

Dungeons 2025-10-14

17 Items: itemMagicchainsDragonszombieskingdomof EvilmonstersTreasureand Doomof KingsPrisonersskeletonsadventureLabyrinthand poisonsTreacherous

SCIENCE 2025-08-20

40 Items: atomcelldataacidbasescaleforcemagnettheorymatterdeluluenergygalaxygravityelementphysicsbiologygeologyecologyskibididensityerosiondensityorganismvariablesolutioncatalystfrictionevolutionchemistryexperimenthypothesisadaptationmeasurementobservationmeteorologymomlovesyouhomeostatisrespirationphotosynthesis

TSFA 2 2025-12-09

21 Items: the level of light received on a plant surfacethe storage or shipment of flowers out of watersells florals good and services to the consumerthe impression of the design being stable and self supportedin Flowers is due to the inability of water to enter the stemgrowers wholesalers and retail florist must process their flowers...

AP World Final 2025-12-09

21 Items: Religious text of IslamHinduism, Buddhism, Islamplace or study in context.Exchange of goods and servicesa follower of the religion of IslamFaith, Prayer, Alms, Fasting, PilgrimageLink North and West Africa. Moved salt and goldcommon goods and luxury goods in large quantitiesa particular attitude or way of considering a matter....

Musical Genres 2024-03-11

17 Items: suiiimusic popularmade for moviesA sub-genre of pieclub and party musicpopular music of MexicoPopular music of Jamaicapopular music of Argentinahad its "boom" in the 1940'senjoyed in theatres and hallscommonly uses electronic drumsguitars and drums and keyboardscategory of musical compositionmusic that is popular in Colombia...

Reformation 2024-04-18

17 Items: Kings or queens.Church officials.Local church community.Official letter from the Pope.Church tax equal to 10% of income.Church court that punishes heresy.Period of art and learning revival.Major religious change and movement.Group of people gathered for worship.Formal statements of religious belief.Biased information to influence opinion....

Unit 9: Climate Change 2025-04-29

15 Items: The warm periods that occur between ice ages.A mixture of gases that surrounds a planet or moon.the removal of large areas of forests for human purposes.the development of towns and cities on previously natural areas.Gases Gases in Earth's atmosphere that trap heat near the surfaceWarming An increase in the average temperature of Earth's surface....

Manatees 2025-04-29

12 Items: Where this takes placeOne place of pollutionAnother example of pollutionAnother example of pollutionPeople that opposed the protectionWhen the plan started to take actionAnother group of people that opposedOrganization involved with protectionA problem with evolution in the futureBeds of this dying leading to starvation...

6th Grade Review 2025-05-05

20 Items: FCCLA's official flowerWhat the F in FCCLA stands for.The number of teaspoons in a tablespoonThe amount the recipe makes (Ex. 16 cookies)Red, yellow and blue are these types of colors.One of the MyPlate food groups that includes cheeseOne of the MyPlate food groups that includes chickenOne of the MyPlate food groups that includes broccoli....

Nervous System 2025-02-11

23 Items: Relating to movementRelating to the synapseAnother term for a neuronUnpleasant sensory experienceStructure that detects stimuliSupporting cells of the nervous systemRelating to sensation or sensory organsThe control center of the nervous systemInsulating layer around some nerve fibersThe fundamental unit of the nervous system...

Emor 5.0 2025-05-11

21 Items: KorbanPesach“HaShem”“set apart”“Commandments”‘priests’, Hebrew.The day of complete rest.The 10th day of the seventh month.Punishment for blasphemy of The Name.Animal korbanot are to be without ______.What kind of oil was used in the menorah?The Haftarah Emor comes from the book of ______.A kohen is to marry a ______ from among his people....

February Word Search 2025-11-24

20 Items: Strong emotion or intense affection.A gentle feeling of fondness or care.To hold someone dear or value deeply.Comfortable and warm during chilly days.Sweet treats commonly gifted in February.To remain in winter rest, nearing its end.Injury caused by extreme cold in late winter.The cold, frosty quality of February weather....

Some Venues/States FOTR is Playing 2022-11-14

26 Items: ohiocanadaattpacdallasnewyorkfloridamichiganbicknellcoloradoscrantoncalifornianeworleansgougecenteralbertabairwhitneyhallstatetheatreclarkstatepacyoukeytheaterorpheumtheatresaengertheatreeisenhowerhallsaroyantheatersantandercenterstatefarmcenterthepalacetheatremorrisauditorium

THE ULTIMATE 50 STATES WORD SEARCH 2025-06-05

50 Items: IowaOhioUtahIdahoMaineTexasAlaskaHawaiiKansasNevadaOregonAlabamaArizonaFloridaGeorgiaIndianaMontanaNewYorkVermontWyomingArkansasColoradoDelawareIllinoisKentuckyMarylandMichiganMissouriNebraskaOklahomaVirginiaLouisianaMinnesotaNewJerseyNewMexicoTennesseeWisconsinCaliforniaWashingtonConnecticutMississippiNorthDakotaRhodeIslandSouthDakotaNewHampshire...

Illegal Migration in the United States 2025-10-09

23 Items: ICECustomsDreamersGreenCardSmugglingImmigrationDeportationCitizenshipTraffickingHumanRightsLegalStatusDACAProgramUndocumentedAsylumSeekerUnaccompaniedRefugeeStatusSanctuaryCityBorderCrossingNaturalizationBorderSecurityDetentionCenterCitizenshipTestFamilySeparation

Here’S Word Search 2025-03-21

55 Items: Having a clear intention or goalA purpose-driven goal or objectiveWork done to help or benefit othersWorking together towards a common goalA new plan or effort to achieve a goalUnity and mutual support within a groupSomething given or done to help a causeAssistance provided to those in distressHelp or support given to someone in need...

Chapter 13 - Economic Challanges 2025-11-29

20 Items: Inflation that is out of control.Grant Federal funds given to the states in lump sums.Basket A representative collection of goods and services.Rate The percentage rate of change in price level over time.Income Income that does not increase even when prices go up.Unemployment that occurs when people take time to find a job....

Plankton vocab 2024-01-22

22 Items: respirationother organismsLargersized plankton visible under a microscopeSmall crustaceans that are a common type of zooplanktonExtremely smallsized plankton smaller than microplanktonSmall animals that feed on phytoplankton or other zooplanktonOrganisms that obtain their energy by consuming other organisms...

Askiathegreat Word Search 2024-10-04

24 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriatheologian from AlexandriaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthagegreat early church fathers and martyrs from Carthage...

Medical Abbreviations 2 2025-02-04

19 Items: historyfractureafter mealsbefore mealsdate of birthcubic centimeterover the counterdate of admissionlower extremitiesdo not resuscitatenon-weight bearingbathroom privilegeswithin normal limitsdischarge/discontinueagainst medical advicecentral nervous systemactive range of motionactivities of daily livingtemperature, pulse, respiration

Orlando 2024-05-13

22 Items: EyeBayCoveEolaepcotCenterCenterof ArtOrlandoSpringsStudiosStadiumKingdomExhibitionof AdventureSpot AmericaOrlando ResortAnimal KingdomTyphoon LagoonRip Ride RockitDisney World ResortWizarding World of Harry Potter

The English Renaissance - part 2 (Characters) 2025-11-20

20 Items: mother of Hamletfriend of Sebastianbest friend of Hamletdisguised as a man - Cesariofriend of Toby's; courting Oliviasitting king; murdered his brotherViola's twin brother; thought deadson of Polonius; doesn't like Hamletgood king; ghost; murdered by brotherOlivia ___ Sebastian; Orsino ___ Violasteward (butler) to Olivia; secret crush...

Insurance and Mail facilities 2023-09-03

10 Items: Direct advertisingRemittance of moneyA range of delightful cardsSafeguard against rising medical costProvide measure of financial support to farmersEffective vehicle for indian corporate to advertise brandReliable delivery ensuring your packages reach destination quicklySum of money is secured to the assured in even of death of bulls cows...

Sharecropping Word Search 2024-11-04

16 Items: The ability to read and write.A part of a legal document or contract that has its own meaning.A change or addition to a law or document, like the Constitution.A person who believes that one group of people is better than all others.A person who has served in the military, often someone who has fought in wars....

Renaissance and Reformation 2024-10-04

15 Items: PerspectiveHad 6 wiveswho painted the Mona lisaFrench word meaning “rebirth.”Where did the renaissance startwas married to Katharine von BoraWho painted "The school of Athens"aimed to establish freedom of religionthe monumental marble David in Florence;belief about a particular category of people...

Week 18 Thursday 2024-02-04

25 Items: SpyingYoungera choicehelp or supportFor a short timePermitted by lawAt the present timeMoney for investmentMasses of bread or meatthe act of being presentA way of acting or behavingSomeone who repairs machinesA deep, gaping hole; a gorgeTo have said yes to somethingThe reason why something happensA relative who lived in the past...

March 2024 Ambassador Word Search 2024-03-11

20 Items: Basic unit of digital informationProgramming instructions for softwarePattern recognition through algorithmsAdvanced neural network-based learningProcess of acquiring knowledge or skillsExtraction of insights from large datasetsA specific job or assignment to be completedField involving automated machines and systems...

CC3 Chapter 5 Vocab 2025-12-12

15 Items: formtermValuesBustergrowthconstantequationsolutionvariableequivalentcoefficienty-interceptof equationscounterexampleof intersection

Chapter 7 Vocab 2025-10-21

14 Items: What are the building blocks of protein?What is the resting phase of hair growth?What is a circular growth pattern of hair?What is the outermost layer of the hair shaft?What elements make up the composition of hair?What is the innermost layer of the hair shaft called?What is the short fine unpigmented hair that appears on the body?...

MileHigh Vocab 2025-10-29

50 Items: Proof of LossReplacement CostActual Cash ValueContinuing EducationTexas Insurance Codeuncertainty of a loss.Commercial Ocean MarineCommercial Inland MarineRecoverable DepreciationInsurance Service Officelegislative acts or laws.Additional Living ExpensePersonal Injury ProtectionCommercial Property PolicySpecial Investigation Unit...

First Aid 2025-04-17

54 Items: beneath the top layer of skinHeavy, uncontrollable bleedingA wound that is torn and raggedNot serious; on the surface;shallowDamp,soft,sticky, and unusually coolarrest The sudden stoppage of the heartA snug bandage used to control bleedingAn anti toxin used to counter act venomOintment and bandages applied to a wound...

LEVEL 3 2024-04-09

39 Items: erawaroortvoiddarkorbitsolardwarfgammasaganbattlenebulameteorcosmickuipermatterhubblekeplernewtongravityeclipsevoyagercassinigalileohawkingmilkywayspectruminfraredeinsteinrebellionblackholesatellitecelestialandromedameteoritemeteoroidradiationultravioletobservatory

word study VT 2024-09-13

39 Items: warmdancesystemcommonregionEuropesimpleenergyfigureobjectsquarematterfilledwindowcannotcircleproducemachinemembersspecialperhapssubjectgeneraldividedincludeminutesnothingbelievelanguageequationexercisematerialscientistsyllablesdirectionthousandsdevelopedgovernmentunderstand

Cat Word Search 2024-10-07

36 Items: catMASSGENECELLlionFORCELIGHTSOUNDzebrahippoPROTONENERGYMATTERWEIGHTFOSSILGRAVITYNEUTRONPHYSICSBIOLOGYCIRCUITELECTRONMOLECULEFRICTIONVELOCITYPRESSUREORGANISMelephantCHEMISTRYMAGNETISMEVOLUTIONECOSYSTEMPHOTOSYNndTEMPERATUREELECTRICITYACCELERATIONMan's best frieATOM

Cristmas Revision 2022-11-28

15 Items: Buying and selling of church positionsSupporter of reform in the Catholic churchEnglish or Scottish soldiers who had fought for the crownPeople who were planted in foreign territory by the crown.The appointing of relatives to Church jobs regardless of meritLaws, Laws that suppressed the status of Catholics in Ireland....

Islam Timeline 2023-07-26

15 Items: 570: _____ is born in the city of Mecca.1187: _____ retakes the city of Jerusalem.1526: The _____ Empire is established in India.630: Muhammad returns to _____ and gains control of the city.1099: Christian armies recapture _____ during the First Crusade.632: The dispute over who would lead Islam begins between these two groups....

Islam Timeline 2023-07-26

15 Items: 570: _____ is born in the city of Mecca.1187: _____ retakes the city of Jerusalem.1526: The _____ Empire is established in India.630: Muhammad returns to _____ and gains control of the city.1099: Christian armies recapture _____ during the First Crusade.632: The dispute over who would lead Islam begins between these two groups....

The Graveyard Book - Chapter 5 2023-04-26

20 Items: Side by side and facing the same way.Pertaining to or consisting of flowers.A twisted mass of something; to become twisted together.Simultaneously; at the same time; in harmonious agreement.A shrill, wailing sound, especially associated with bagpipes.Firm, dry, and brittle; or fresh and sharp in taste or manner....

Askiathegreat Word Search 2024-10-04

29 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriatheologian from Alexandriaspans much of southernAfricathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthage...

Askiathegreat Word Search 2024-10-04

29 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriatheologian from Alexandriaspans much of southernAfricathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthage...

40 literary terms,elements,& devices 2022-10-07

40 Items: meaningA words literal definitionSomeone who is the voice of the poem.the time and place in which a story is toldA person who tells a story in a film or literatureA figure of speech that is an exaggeration for emphasisAn obstacle that characters have to overcome in a storyThe main message that is being conveyed throughout a story...

BEOWULF Characters 2024-11-04

10 Items: The king of Danes.Beowulf's childhood friend.The warrior who saved the Danes.The Danish warrior envious of Beowulf.Hygelac's wife and the Queen of Geats.The uncle of the heroine and the king of Geatland.The trusted companion of Beowulf in all his battles.The monster who slaughtered the warriors of Daneland....

compliance and Ethics Day 1 Puzzle 2024-10-02

24 Items: AbuseFraudHIPAAhotlineProgramAuditingMedicareEducationWork Planof ConductGovernmentGrievancesMisconductMonitoringSanctionedAntiKickbackInvestigationFalseClaimsActConfidentialityComplianceOfficerComplianceCommitteeConflictsofInterestCorrectiveActionPlanof Inspector General

french veverlition 2024-10-15

15 Items: LegacyLibertyEqualityMonarchyBastilleNapoleonupheavalFraternitycourt oathGuillotineNationalismEnlightenmentEstates-GeneralRevolutionariesof the Rights of Man

APRIL COVERAGE REVIEW 2024-04-10

34 Items: SIUDOLagentcrocschangeLETTERdutiesREPORTpolicyrentalPHOTOSSEARCHOF SALEcontactOF LOSSPAYMENTinsuredCARRIEROUT UPDwitnessclaimantcoveragemetadatacollisionliabilityINCEPTIONOF RIGHTSSPECIFICSdealershipdeductibleproceduresinvestigateoverlappingcomprehensive

WE4 Units 1 - 1 Review Wordsearch 2025-05-13

46 Items: HioldNicemeettallwifetaxichefAsiaHelloyoungshortChinasinglemotherfathersisterdoctorartistdriverbankerLondonMexicoKigaliStatesMexicoRwandaAfricaEuropemarriedbrotherhusbandteacherBeijingAmericakitchenbedroomengineerarchitectAustraliaattractiveWashingtonGoodmorninggrandmothergrandfatherUnitedKingdom

Sailanki's Introduction 2025-02-20

17 Items: Current Rolehobbies-booksPast roles- 1stPast roles- 2ndCurrent companyPast companies-2ndPast companies- 1sthobbies-sweet goodshobbies-binge watchhobbies-playing with petplace of birth-City of Joyplaces lived-silicon valleyplaces lived-City of Pearlsmajor subject- life sciencesplaces lived-City of Monumentsplaces lived-Detroit of South Asia...

APHUG Unit 5 test review 2024-01-31

21 Items: farmingUses many inputsHaving enough to sellCanada and the Western USthe minimum amount to sustain lifeplantation farming found in this type of climatediseases like malaria and small pox traveled from ____ to _____water contamination and depletion is a _ of the Green Revolutionuse of little labor and capital to increase agricultural productivity...

Askiathegreat Word Search 2024-10-04

24 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriatheologian from AlexandriaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthagegreat early church fathers and martyrs from Carthage...

Education in Zion Gallery 2025-06-04

15 Items: One of BYU’s Four AimsOne of BYU’s Four AimsOne of BYU’s Four AimsOne of BYU’s Four AimsEducation in ______ GalleryThe first permanent principal of Brigham Young Academy“If any of you lack wisdom, let him _____ of God” (James 1:5)The first temple built by the Church of Jesus Christ of Latter-day Saints...

Chapter 7 Econ 2025-03-13

19 Items: Market structure characterized by a single producerGroup of firms producing similar or identical productsIllegal agreement by firms to charge a uniform price for a productPhilosphy that government should not interfere with business activityReal or imagined differences between competing products in the same industry...

math wordsearch 2022-11-30

31 Items: oddeveneventmarkupinverseoutcomedivisionmarkdownsubtractadditionfractionsinferenceprincipalpopulationproportioncross-sectioninterest-ratepercent-erroradjacent-anglescomplex-fractioncomposite-figurepercent-equationinvalid-inferencepercent-of-changeindependent-eventsisolate-a-variablecomparative-inferenceexperimental-probability...

The Shaws 2024-06-27

20 Items: The brides nameThe grooms nameThe month of ProposelThe couples dogs nameThe grooms ProfessionThe brides birth monthThe grooms middle nameThe grooms sisters nameThe brides favorite foodThe grooms favorite drinkthe couples favorite storeThe state of the engagementThe color of the couples eyesType of vehicle the couple drives...

Kingdom Hearts 2024-09-13

32 Items: PumpkinFinny FunNot ChewyThe GAMESSky FriendUnion LuxuTerra AnsemJunior HeroThe Mage DuckRumbly TumblyKing of DisneyHold on to youfooling myselfWisdom in ZeroNot the planetFull of Strifethe other JackMaster by sleepEarths DarknessMaster of MagicWith an I, no XAnsem with an XThe Loyal ShieldCloud's DarknessHeartless MemoryThe Others Nobody...

Musical Genres 2024-03-11

15 Items: suiiimade for moviesA sub-genre of piepopular music of MexicoPopular music of Jamaicapopular music of Argentinahad its "boom" in the 1940'senjoyed in theatres and hallscommonly uses electronic drumsguitars and drums and keyboardscategory of musical compositionmusic that is popular in Colombiamusic made with digital instruments...

Smell Word Search 2024-06-08

40 Items: spyfanwildlifthairsofasmellstinkslinkwringteachneedymushysteelfrogsbleedprintsmilefalseflingwritebecomesteadyremovechoosematterprettyhaircutqualifyimperilpuzzledtenuoussplendidspitefulintroducebefittinginsuranceadjustmentsuperficialadventurous

Science! 2024-09-09

40 Items: GASATOMHEATDATAFORCELIGHTSOUNDSOLIDMATTERENERGYLIQUIDMETHODGRAVITYCIRCUITBOILINGMELTINGMIXTUREHABITATRESULTSKINETICFRICTIONFREEZINGCHEMICALSOLUTIONDISSOLVETRANSFERMAGNETISMINSULATORCONDUCTORECOSYSTEMPOTENTIALEXPERIMENTHYPOTHESISCONCLUSIONELECTRICITYTEMPERATUREEVAPORATIONCONDENSATIONGRAVITATIONALTRANSFORMATION

Science 2024-10-06

40 Items: DNACELLFORCEVIRUSENERGYMATTERNEURONPROTONGENOMEENZYMEFOSSILcatATOMGRAVITYQUANTUMSPECIESPROTEINCLIMATENEUTRONHORMONEPHYSICSBIOLOGYANATOMYGEOLOGYINERTIAMOLECULEBACTERIAELECTRONMUTATIONREACTIONFRICTIONSPECTRUMEVOLUTIONECOSYSTEMASTRONOMYCHEMISTRYMAGNETISMRADIATIONBIODIVERSITYPHOTOSYNTHESISELECTROMAGNETISM

Sea Word Search 2025-05-09

38 Items: furgasbinrunnestcavecoopfoodfoodjumpswimrideshellsolidmetalglasspaperdairyfruitlunchhabithabitanimalanimalscalesmatterliquidgroupsgrainsdinnerbeehiveplasticpictureproteinfeathersexercisebreakfastvegetables

Exercise 2025-05-09

38 Items: furgasbinrunnestcavecoopfoodfoodjumpswimrideshellsolidmetalglasspaperdairyfruitlunchhabithabitanimalanimalscalesmatterliquidgroupsgrainsdinnerbeehiveplasticpictureproteinfeathersexercisebreakfastvegetables

Word Search #2 Ciencia 2025-07-03

40 Items: pHDNAAtomCellAcidBaseDataForcePowerTableMotionEnergyMatterVolumeTheorySpeciesProteinGravityDensityElementPhysicsBiologyMoleculeOrganismGeneticsChemicalReactionCompoundEcosystemEvolutionChemistryMicroscopeLaboratoryHypothesisExperimentChlorophyllTemperatureObservationPhotosynthesisThermodynamics

38 - Physics Terms 2025-07-12

40 Items: accelgammalightwavesactionatomicbosonschargecosmicenergyfieldsforcesfusionjouleslaserslengthmattermotionnucleiohmicsphotonplasmaquarksqubitsscalarstaticstraintensorvectorcurrentdensityentropygravitahadronsinertiaionizedkineticmassiveneutronvoltage

US States A - M Puzzle 1 2020-04-06

26 Items: IowaIdahoMaineAlaskaHawaiiKansasAlabamaArizonaFloridaGeorgiaIndianaMontanaArkansasColoradoDelawareIllinoisKentuckyMarylandMichiganMissouriLouisianaMinnesotaCaliforniaConnecticutMississippiMassachusetts

Cities and States In The US 2023-02-17

24 Items: usaohioiowadoveralbanydallashelenakansasbostonseattlehoustonorlandophoenixtrentonalabamachicagogeorgialakesideportlandminnesotawashingtonsacramentomontpelierphiladelphia

United States Becomes a Power House 2023-10-11

35 Items: MaineCanalhawaiiWilsonB. Doleu-boatsFreedomWarfareWarfareT. MahanTelegramDiplomacyallianceslusitaniaMigrationRebellionCorollaryJournalismpropagandamilitarismof NationsimperialismDoor PolicynationalismService ActimperialismprohibitionAmerican WarisolationismStick PolicyDome Scandalof VersaillesAntitrust ActReserve SystemTeddy Roosevelt

Nature 2024-10-29

10 Items: a natural wide flow of fresh watera raised part of the earth's surfacethe small, soft, white pieces of icean area of land, used for growing cropsa large area of water surrounded by landa high area of rock with a very steep sidea piece of land completely surrounded by waterwater, dropping from a higher to a lower point...

Electrical Circuits 2025-04-21

15 Items: unit of powera part of an elementthe opposition to flowone path in a circuitbomultiple paths in a circuitbase unit of an electrical unitboth series and parallel circuitsomething that can deliver energyallows electrical current to flowa circuit with a break in the pathhow hard it is for electricity to flowthe flow of electricity in one direction...

Absolutism 2025-03-25

12 Items: of lawarmadahereticcapitalrepubliccrucifixinflationAbsolutismLegitimatedisciplinepresumptiveright of kings

Flowers Word Search 2024-05-13

23 Items: MANdancakekissvowsloveYORKringsdresskirrenflowersbramblesiewertforeverceremonyOF HONORpetersoncoloradogroomsmenbridesmaidsOF THE GODSphotographerHICKORY HILL

CH3 - Rocks and Minerals 2022-12-18

16 Items: The layer of rock that forms Earth's outer surface.________________________Process in which sediment is laid down in new locations.________________________A dense sphere of solid iron and nickel at the center of Earth.________________________The layer of hot, solid material between Earth's crust and core.________________________...

Korach 2025-06-22

15 Items: Israel’s 1st King.His staff produced almonds.The prophet of the Haftarah?Korach means ___ ______ ______.The main character of Portion Korach?“He who guards his _______ preserves life.”“The ________ has power over life and death.”Israel’s first King was from the tribe of _________.The 250 men offering incense were consumed by ______....

Word Search - Elijah Smith 2023-09-13

31 Items: Moving airair that surrounds Earthtoo much water in one placeThe distance above sea levelHow hot or cold something isthe current outdoor conditionswater found in lakes and glaciersbuilding up of something overtimeInformation that has been collectedThe amount of water vapor in the airthe continuous flow of water on earth...

vocabulary 2023-10-05

27 Items: an ancestorlead by, guided(of a place) without inhabitantsan airplane with one set of wingscontaining or using only one colornext to or adjoining something elselikely to be the case or to happen.relating to or resulting from motionoperated by or equipped with machinesliving the life of a nomad; wanderingmeter used to determine the altitude attained...

Askiathegreat Word Search 2024-10-04

29 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriatheologian from Alexandriaspans much of southernAfricathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthage...

QUIZ 2025-11-28

15 Items: Who pioneered the technique of PCR?Who is known as the Father of Genetic Engineering?What type of tertiary structural protein is Keratin?Which is the least abundant Granulocyte in our body?Which family of organism does Dengue virus belongs to?Gout's disease is caused due to higher accumulation of?...

Monday's not coming by Tiffany D. Jackson 2024-11-29

16 Items: Name of the highschool?What happened to Monday?Name of Monday's sister?Name of Claudia's church?What sound haunted Claudia?What is Monday's moms name?Name of the housing complex?What is Claudia's dads name?Monday's favorite color was?Name of Claudia's boyfriend?Where did everyone think Monday went?What color was the house they spent time in?...

B&N 2024-07-31

21 Items: Brides first jobBrides occupationBrides birthstoneGrooms middle nameGrooms birth monthName of Grooms gymNumber of bridesmaidsGrooms favorite drinkState the Bride is fromBrides favorite holidayGrooms major in collegeCouples favorite concertName of Brides oldest nieceBride is the queen of theseNumber of tattoos Groom hasVenue of couples first concert...

Daniela and Adam 2024-12-11

24 Items: - Wedding Hotel- Grooms BestMan- Maid of Honour- Name of the Bride- Name of the Groom- Name of their son- Location of Church- Town they live in.- Bride's maiden name- What is in the air?- School Adam attended- Name of their Daughter- First holiday together- The Couples new Surname- School Daniela attended- Favourite Football team...

Scrum Glossary 2023-07-21

34 Items: 10, See "Product Backlog __________"5-4, A self-managing team consisting of one Scrum Master, one Product Owner, and Developers.8, The selection of items from the Product Backlog Developers deems feasible for implementation in a Sprint....

KPOP DEMON HUNTERS 2025-08-20

15 Items: The tigerThe magpieHuntr/x's managerHuntr/x's best songSaja Boys' best songMain dancer of Huntr/xLeader of the Saja BoysRuler of the demon realmThe lead vocalist of Huntr/xSaja Boy who wears a yellow beanieSaja Boy whose hair covers his faceThe "maknae" (youngest member) of Huntr/xSaja Boy whose hair is shaped like a heart...

social studies vocabulary 2022-06-14

14 Items: jurycivilgroupenlistof lawappealvaluesdonatedemandsupplyinquiryof rightsconventionpoint cabinet

Sixth Year -Week 3 2024-11-05

15 Items: Filth; miseryTo live in or onAn area of land; a regionNot the same; unmistakableA place of safety or shelterHard or impossible to believeA great amount; more than enoughOf or relating to the countrysideVery dry; having little to no rainfallMagnificence; brilliance of appearanceHaving a large amount of moisture in the air...

Islam Word Seach 2025-05-15

15 Items: The holy book of IslamThe Arabic word for God.the last prophet sent by GodA cube-shaped building in MeccaA place of worship for Muslims.The Islamic declaration of faithAn annual Islamic pilgrimage to MeccaThe migration of the Prophet MuhammadAn obligatory act of charity in IslamAn Arabic word that literally means "veil"...

TpT Email 2022-07-30

13 Items: judaismbradburystarwarsRelating to the Middle Ages.The "end times" in Norse mythology.The primary religion of people from India.The last of the Ptolemaic leaders in Egypt.Short story from the perspective of Lady Capulet.His assassination sparked the beginning of The Great War.Approximately one-third of the SAT and ACT are based on this....

Criterion Challenge 2025 2025-04-10

52 Items: ThiefGummoCrumbVampyrStalkerDaisiesRoboCopTampopoRepo-ManNashvilleChoose-MeHappinessThe-BeastLa-StradaLa-CienagaFunny-GamesCitizen-KaneSafety-Last!Paris,-TexasPerfect-DaysTaipei-StoryThe-Third-ManPink-FlamingosHeart-Of-A-DogPan's-LabyrinthAce-In-The-HoleThe-CelebrationThe-Burmese-HarpFantastic-PlanetDouble-IndemnityPunch-Drunk-Love...

Procedure Text 2025-07-27

20 Items: ordinary/commonverb, act, duty,part of ingredientsa stage in a processa set of instructionThe name of a projectexisting or happening nowverb, to produce somethingis a kind of question wordThe instruction or directionunspecified or unknown thingdirect command or instructionconstruction or organization of something...

human development 2025-09-04

20 Items: : Connected to feelings and mood: The life stage before adolescence: One's sense of self or who they are: The acquisition of knowledge or skills: The process of becoming fully developed: Physical increase in size or development: Key developmental achievements or stages: The stage of maturity or full development...

IDEO: idea 2025-11-10

16 Items: ideoIdeaideogramideologyideogenyof ideasideologueideocracyideosphereideophobiaor mistrust of ideasruled strictly by an ideology or set of principlessystem of ideas and ideals, especially in economics or politicsarea where ideas are thought to be created and grown, intellectual space...

Wedding 2025-02-09

14 Items: doManLoveVowsWifeKissBrideGroomDanceHusbandof HonorBridesmaidsof the Brideof the Bride

CNA Lesson 17 Review 2023-01-22

15 Items: walkingturning upwardturning a jointturning downwardbending backwardbending a body part or jointstraightening of a body part or jointmovement of a limb toward the midline of the bodymovement of a limb away from the midline of the bodydevice used to maintain a body part in a fixed positionpermanent stiffening of a joint or muscle caused by atrophy...

May words 2022-06-06

33 Items: Of or pertaining to a year.The using up of a resource.Stick fast to a surface or substance.In spite of the fact that; even though.Craving or consuming large quantities of food.Rigorously binding or exacting; strict; severe:A union or association formed for mutual benefit.A group or system of interconnected people or things....

Volleyball 2025-03-24

12 Items: total points in a gamemost popular type of servename a type of forearm passhow a ball is put into playhow tall the top of the net isit's in the middle of the courtfast offensive hit to a specific spotChief official of the volleyball gamenumber of players on the volleyball teamDefensive technique for stopping a spike...

Zoren 2025-12-09

15 Items: Zoren's assumed RaceAsuang and Zoren are this creatureZoren Claims to be this professionZoren is trying to capture this personThe name of the village Zoren is targetingThe time of day Naesala is associated withThe name of the village healer Zoren killedWhat the villagers of Thistlepine Hollow needThe group of elves Solarian's made amends with...