states of matter Word Searches

States We Visited Together 2025-09-15

15 Items: IowaYorkUtahTexasMexicoFloridaGeorgiaIndianaColoradoIllinoisMichiganTennesseeWisconsinCaliforniaPennsylvania

Southeast Region - States and Capitals 2026-01-20

24 Items: AlabamaGeorgiaFloridaRaleighAtlantaJacksonArkansasVirginiaKentuckyRichmondColumbiaLouisianaTennesseeNashvilleFrankfortCharlestonMontgomeryBatonRougeLittleRockMississippiTallahasseeWestVirginiaSouthCarolinaNorthCarolina

U.S 50 states and territories 2026-04-08

55 Items: IowaOhioUtahGuamIdahoMaineTexasAlaskaHawaiiKansasNevadaOregonAlabamaArizonaFloridaGeorgiaIndianaMontanaNewYorkVermontWyomingArkansasColoradoDelawareIllinoisKentuckyMarylandMichiganMissouriNebraskaOklahomaVirginiaLouisianaMinnesotaNewJerseyNewMexicoTennesseeWisconsinCaliforniaWashingtonPuertoRicoConnecticutMississippiNorthDakotaRhodeIsland...

Countries and States Word Search 2026-07-17

246 Items: ChadCubaFijiIranIraqLaosMaliOmanPeruTogoIowaOhioUtahBeninChileChinaCongoEgyptGabonGhanaHaitiIndiaItalyJapanKenyaLibyaMaltaNauruNepalNigerPalauQatarSamoaSpainSudanSyriaTongaYemenIdahoMaineTexasAngolaBelizeBhutanBrazilBruneiCanadaCyprusFranceGambiaGreeceGuineaGuyanaIsraelJordanKuwaitLatviaMalawiMexicoMonacoNorwayPanamaPolandRussiaRwandaSerbiaSweden...

Ownership and Risk of Loss in Sales 2026-04-10

14 Items: collect on delivery“cost, insurance, freight” pricepublic sale to the highest biddershipping term meaning “free on board”physically existing goods owned by the sellergoods that are not both existing and identifieddesignated subject matter of a particular sales contractcompleted sale in which the buyer has the option of returning the goods...

Bethlehem's Significance 2023-10-18

21 Items: innholylandstarjudeaHerodfieldcensuslineageWisemenmessiahJourneyof Davidbiblicalof Breadnativityof JosephEphrathahbirthplacepropheciespilgrimage

Civil War 2025-12-10

30 Items: UnionFerrySumterShilohCavalryAntietamBlockadeInfantryRegimentManassasFreedmenIroncladsSecessionAbolitionArtilleryVicksburgGettysburgAppomattoxPetersburgSharpsburgWildernessConfederacyChattanoogaMason-DixonEmancipationBorder-StatesReconstructionChancellorsvilleAtlanta-CampaignGettysburg-Address

Unit 5 Vocabulary 2024-12-10

28 Items: TERMIMAGESLOPEANGLEANGLESSIMILARVARIABLEDILATIONFUNCTIONVARIABLEROTATIONCLOCKWISECONGRUENTOF CHANGEINTERCEPTREFLECTIONTRANSLATIONTRANSVERSALRELATIONSHIPOF EQUATIONSOF A DILATIONCORRESPONDINGTRANSFORMATIONTO AN EQUATIONTRANSFORMATIONINTERIOR ANGLESCOUNTERCLOCKWISEOF TRANSFORMATION

Industrial Revolution Word Search 2026-01-21

24 Items: Steel-making processCo-creator of communismBlack rock used for fuelModernized the steam engineFather of modern capitalismUses steam to power machinesCreator of the Spinning JennyAcute contagious viral diseaseBuilding where goods are producedTurns cotton to threat super efficientlyStimulates immunity to a certain disease...

Economics Ch. 17.1 2025-01-07

9 Items: Revenue minus expensesLack of a particular resourceWhen business owners may operate however they see fitEconomic system where decisions are made by IndividualsWhen a company is the only one selling a product or providing a serviceeconomic market where you have the right to buy and sell goods as you want...

Aerial Word Search 2025-03-27

15 Items: Related to the air; often used to describe military operations conducted by aircraft.A type of military aircraft designed primarily for air-to-air combat against other aircraft.The quality of being open to attack or harm, often used in the context of military defenses....

Unit 4 Vocab 2025-10-22

15 Items: PowersymbolsInverseSquaredSimplifyExponentsexpressionParenthesisof equalityproperty of additionproperty of equalityproperty of equalitySubstitutionpropertyproperty of multiplicationproperty of multiplication

Terraria Bosses 2024-09-02

17 Items: BeeLordGolemSlimeSlimePrimeTwinsFishronCultistof LightPlanteraof FleshDeerclopsof WorldsDestroyerof Cthulhuof Cthulhu

Practice of Science 2016-09-07

30 Items: cupfivetapedataworldtoolsrulerinfermattersensesrecordnaturalobservemeasurebalancemeasureexplainresultscylinderclassifyfindingsevidencemeasuringgraduatedmaterialsprocedurepredictionhypothesisinvestigatecommunicate

science 2024-09-19

29 Items: CellHeatMassForceAbsorbEnergyFossilMatterCircuitClimateDensityErosionGravityHabitatDissolveFrictionPredatorCarnivoreConductorEcosystemFoodchainLifecycleMagnetismAtmosphereDecomposerWatercycleEvaporationBiodegradablePhotosynthesis

Rainforest Word Search 2026-04-29

29 Items: LayersCanopyLinearMatterFoliageSpeciesDeclineExploitEnzymesOxidizeHumidityGeometryReversedDialogueLandscapeResourcesUntouchedReactantsCatalystsDepletionSubstanceRainforestIrrigationAbstractionMeasurementsFermentationPrecipitationDeforestationQuotationmarks

matter properties 2025-09-16

6 Items: catlionzebrahippoelephantMan's best friend

Atomic Structure & Periodic Properties 2024-11-25

20 Items: The energy required to remove an electron from an atom.The distribution of electrons among the orbitals of an atom.The energy change that occurs when an atom gains an electron.The outermost electrons of an atom, involved in chemical bonding.Energy levels surrounding the nucleus where electrons are located....

Foreign Policy 2015-04-06

36 Items: aidwarforceunionpolicytreatysovietunitedstatesspherealliesactionscultureamericaforeignVietnamconflictmilitarydiplomacymediationsanctionsinfluencecommunismeconomicsdemocracyconditionscapitalismpropagandacooperationmotivationscontainmentisolationismnegotiationsdictatorshipinternationalinternationalism

Solid Word Search 2024-12-02

36 Items: gasatomheatsolidratioliquidstatesvolumesampleoxygencarbonballoonkineticthermalelementformulaparticleperiodicmoleculecompoundhydrogenchemicalpressurefreezingcondenseprocedurepotentialsubstancemagnesiumexpansionpropertiesattractiontemperaturethermometercontractionvaporization

BioMid Review 2025-12-09

31 Items: the study of cellsthe study of cells2nd phase of mitosis1st phase of mitosis3rd phase of mitosis4th phase of mitosiscondensed threads of chromatinDNA to RNA; occurs in the nucleusDNA enables life through this criteriaorganelle responsible for protein synthesisRNA to protein; takes place inthe cytoplasm...

Memory 2025-09-09

17 Items: loss of memoryfirst step in memorytype of memory for skillsmemory that is relatively permanentretention of information or experiencethe retention of information over timethe memory of emotionally specific eventsconcentrating on more than one activity at the same timememory loss for a segment of the past but not for new events...

Onix Middle Names 2024-08-10

18 Items: pegasus’ first namethe ruler of MordorDeveloped the PokédexRank 14 in classic WoWthe act of electrocutionthe most photogenic hourName of the gang in KantoName of generation 1 HeroName of Generation 1 RivalName of Dietrich’s brotherthe hardest mineral on earthReleased alongside Gold versionthe plateau of champions in gen 1...

CHONDRICHTHEYES 2025-04-14

26 Items: shark.fields.sharks.mother.mother's body.changes in water pressure.The family of rays, also known as eagle rays.The tail fin of a shark or ray, used for propulsion.The family of carpet sharks, including the wobbegongs.A compound found in the liver of sharks, used for buoyancy.The superorder of cartilaginous fish that includes all sharks....

Anatomy & Physiology: D 2026-02-05

34 Items: ToothSet of teethFreely mobile jointExcess production of urineThree-stage process of swallowingPancreatic enzyme that digests DNACompound that increases urine outputDownward motion of the scapula/mandibleMolecule that activates protein kinasesBruch border enzyme that acts on proteinsDecrease in the number of hormone receptors...

ch 4 vocab 2025-02-26

15 Items: Rate at which energy is converted.Energy that is due to chemical bonds.Machine that does work with only one movement.The ability to cause change, measured in joules.Energy a moving object has because of its motion.States that energy cannot be created or destroyed.Transfer of energy when a force is applied over a distance....

Emily's Birthday Word Search 2025-05-27

25 Items: sunteagameemilypartyall y'allcroissantbirthstonehair colormini colorzodiac signplace of birthwhat today is!!!____, emily ____animal i despiseupcoming vacation#1 lady of my lifefavorite breed of dog32 of these on a cakethe month of my birthfavorite kind of cakeband seen the most timescountry visited the most#1 fella of my life (RIP)...

Jesus Word Search 2024-12-30

15 Items: LordRockJesusChristSaviorMessiahEmmanuelRedeemerThe WordTrue VineSon of GodLamb of GodGood ShepherdBread of LifePrince of Peace

Word Search (Lv. 2) 2026-03-08

20 Items: [a girl child][the past form of swim][the past form of bring][on the day before today][the twelfth month of the year][the art of making beautiful writing][a solution to a question or a problem][the study of numbers, shapes and space][the capital city of England and the UK][the sister of someone's father or mother]...

Unit 1 Review 2025-09-01

10 Items: Which branch makes laws?Which branch enforces laws?Who is one Senator from Indiana?Who is one Senator from Indiana?Which branch judges or interprets laws?Who is Indiana's district 5 Representative?What are the freedoms people have in a society?What is the division of power between the state and federal government?...

Sheffield Word Search 2025-06-10

28 Items: Amelia’s ageThe Groom’s sisterThe Bride’s brotherThe Bride’s maiden nameThe month they first metThe name of the best manAmelia’s favourite singerFather of the Grooms nameFather of the Brides nameThe Bride’s favourite foodThe Groom’s favourite foodThe Groom’s birthday monthMother of the Groom’s nameMother of the Bride’s name...

Lesson 4: Reformation and Reaction Word Search Puzzle 2023-03-21

45 Items: sectromejewsbiblejesusspainparisfaithghettoLutherchurchThesesCalvinof GodjesuitsaintsXaviergermanypriestsconventmuslimscatholicof Wormsreformerof AvilaPaul IIIof Trentreligionsacramenttheocracyisolationchristiancalvinismof LoyolacarmeliteindulgencecorruptionprotestantgovernmentreformationtemperamentlutheranismcatholicismInquisitionpredestination

Federalism Word Search 2025-10-28

20 Items: CartaLockeSenseof LawBranchCollegeRepubliccontractof powersRebellionDemocracyFederalismCompromisecompromisesovereigntyand balancesAnti-Federalistof ConfederationAmerican revolutionEnglish bill of rights

Fantastic Fiction 2025-03-06

20 Items: This title character travels to the islands of Laputa & LilliputPeter Beagle wrote of 'The Last ___' who lived alone "in a lilac wood"Home of House Tyrell, Highgarden is a fertile wine-growing region on this continentThis sword-wielding barbarian from ancient Cimmeria was created by Robert E. Howard...

Year 7 Science 2022 2022-12-07

18 Items: Not depleted when used.An animal lacking a backbone.An organism that makes it own food.An imaginary line about which a body rotates.Any substance that has mass and takes up space.The process of turning from liquid into vapour.A substance made by mixing other substances together.A system of interlocking and interdependent food chains....

Mechanicalwaves Word Search 2026-05-01

15 Items: the lowest point in a wavethe distance between crests of a wavethe highest point, peak, or maximum positive displacement of a wavea disturbance or oscillation that travels through space and matter,energy-carrying waves produced by the acceleration of charged particlesthe number of waves that pass a fixed point in a specific amount of time...

Bethlehem's Significance 2023-10-18

21 Items: innholylandstarjudeaHerodfieldcensuslineageWisemenmessiahJourneyof Davidbiblicalof Breadnativityof JosephEphrathahbirthplacepropheciespilgrimage

greek gods 2024-02-02

10 Items: messengergod of wargod of firegod of the seagoddess of lovegoddess of huntthe king of godsgod of underworldthe god of archerygoddess of harvest

ELD Unit 1 2026-09-04

33 Items: The act, process, or result of developing.During this stage, children are added to the family.Something that is suitable for a particular age or age groupInvolve movements of the large muscles of the arms, legs, and torso.bility to make movements using the small muscles in our hands and wrists....

Cougar Quarterly Word Search 2023-05-10

20 Items: carredcamoarmyArmyArmynavyblueblackGuardwhitegreenmarinesairforceArmed ForcesSecurity VehicleFighting VehiclePersonnel CarrierStates Army SouthNational Armed Forces

WEST / SOUTHWEST US STATES 2026-01-23

15 Items: UTAHIDAHOTEXASOREGONALASKAHAWAIINEVADAMONTANAWYOMINGARIZONACOLORADOOKLAHOMANEWMEXICOWASHINGTONCALIFORNIA

U.S. States and Cities 2026-05-19

15 Items: NevadaHelenaAlbanyMontanaNewYorkMarylandMichiganOklahomaNewJerseyAnnapolisCarsonCityMississippiNorthDakotaPennsylvaniaOklahomaCity

U.S. States and Cities 2026-05-05

15 Items: IowaMaineHawaiiAlabamaArizonaFloridaPhoenixIllinoisKentuckyHartfordHonoluluDesMoinesCaliforniaMontgomeryConnecticut

Parts of an Essay 2025-05-12

6 Items: Something that proves an ideaSummarizes the main idea of an essayA statement that expresses the focus of your writingThe sentence that states the main idea of a paragraphAn opening statement that grabs the reader's attentionThe final sentence in a body paragraph that explains how the example supports the topic sentence

Waves and Their Behaviors 2023-10-09

11 Items: A form of radiation wave that travels though the universe.To cause (light, heat, sound, etc.) to pass through a medium.The number of waves that pass a fixed point in unit time (Hertz).A point on a wave where the displacement of the medium is at a maximum.The distance between identical points in the adjacent cycles of a waveform....

schwa sound /er/spelling list 2013-05-27

30 Items: actorhumorangermajormayorpolarlunarenterhonormirrorpowderbannerpillarflavorfingerclovermatteroysterclamortremoranswercollardoctortheaterthunderburglartractorquarterscholarchamber

Science Word Search 2023-06-02

30 Items: sungasbiomheatsolidearthatomsforceliquidmatterphasesvolumeenergyscienceprotonsdensitysolutionneutronsevidencedissolveconsumergeosphereecosystemmoleculesparticleselectronsatmospheredecomposerhydrospherecondensation

Science Practices & Crosscutting Concepts 2023-08-31

30 Items: dataplanmodelcausescaleeffectenergymatterchangeengagedsystemsdevelopanalyzethinkingargumentpatternsquantityfunctioncarryoutquestionsstructurestabilityinterpretconstructconceptualproportionexplanationcommunicateinformationinvestigation

Grade 3 Science - Scientific Method 2024-09-11

30 Items: datahelpspaceearthrecordmatterenergylivingbiologygeologyresultszoologyvariablediscovercomputerinterpretscientistquestionspersevereequipmentcooperatebrainstormentomologyexperimentlaboratorypredictioninvestigateconclusionsobservationsinterconnected

The Search 2024-10-26

30 Items: blutriobaolpelolevimaterleechdeityliderflakesnowymaskyhingerainermatterheraldentitypyritepicklebasuraintentstewardrasgadobracketmanifestvestatronindividualglowsterioantimatterthirdentity

space 2024-12-18

25 Items: WayStarHoleYearCometOrbitGalaxyPlanetNebulaMeteorSystemRocketCosmosQuasarMatterEclipseGravityAsteroidSatelliteTelescopeAstronautExoplanetSupernovaAndromedaSpacecraft

first 3 topics 2025-02-05

30 Items: DenseAtomsGroupcellsStainMatterLiquidEnergyBrittleMagnifyInfraredElementsHalogensParticlesNonmetalsStrontiumconductionInsulatorsTransitionMicroscopeEvaporationElectricitySpecialisedCellmembraneRedbloodcellEyepiecelensLivingthingsDoubleglazingPeriodictablephotosynthesis

Sound Waves 2026-01-19

30 Items: gasforcepitchhertzsoliddeformmediummattervolumeliquidvacuumreflectdensityloudnesstransmitvibrationcollisionamplitudefrequencyparticlesmoleculeswavelengthemptyspacephenomenonsoundsourcecompressionrarefactionsoundreceiverkineticenergyenergytransfer

Elements and Compounds 2026-05-14

30 Items: AtomPureIronGoldSaltBondTableWaterSugarReactMatterProtonOxygenCarbonSilverElementNeutronNucleusMethaneAmmoniaFormulaCompoundMoleculeElectronPeriodicHydrogenNitrogenChemicalSubstanceCarbonDioxide

Matter and Energy in Ecosystems Word Search 2026-05-15

28 Items: fatinputatomssystemstarchoutputenergycarbonmattermatterproductglucoseconnectdioxidebiodomereactantproducermoleculeglycogenconsumerorganismsecosystemdecomposerchloroplastrespirationmitochondrionphotosynthesisstorage molecule

ABOUT THE SCIENCE 2026-08-06

30 Items: DNAATOMCELLENERGYMATTERMAGNETTHEORYFOSSILSCIENCEGRAVITYBIOLOGYPHYSICSGEOLOGYECOLOGYMICROBEELEMENTVOLCANOMOLECULEGENETICSRESEARCHREACTIONCHEMISTRYASTRONOMYEVOLUTIONTELESCOPEEXPERIMENTLABORATORYMICROSCOPEHYPOTHESISELECTRICITY

Science Word Search 2026-08-20

30 Items: TestTubeAtomCellHeatFlaskForceLightWaterPlantSampleBeakerEnergyMatterOxygenCarbonAnimalSafetyScienceBiologyPhysicsGravityResearchMoleculeChemistryDiscoveryLaboratoryMicroscopeExperimentObservation

Nasso 5.0 2025-06-02

25 Items: “Kohen”“Asah” Englishson of Shedeur“Nasso” English“Shema” English“Shamar” EnglishThe prince of the tribe of Gad.This clan of Levi totaled 3,200.The prince of the tribe of Judah.resentment against another person.This vow separates you for Adonai.This gift can never be taken away.The Hebrew “Gershon” means _______.The prince of the tribe of Zebulun....

Coloum 2022-09-15

25 Items: A rounded roofThe pillar of a buildingA person who designs buildingsHorizontal member of step (stair)Vertical member of a step (stair)A structure that has a roof and wallsA design plan or other technical drawingA fence or balustrade made of rails and postsThe lower surface of a room that people walk on...

ICD-10-PCS - Root Operations 2026-03-16

31 Items: Expand an orifice or lumenCut off all or part of a limbPut back a separated body partCut out a portion of a body partBreak solid matter in a body partTake out a device from a body partDestroy all or part of a body partCut into a body part to separate itPartially close an orifice or lumenCompletely close an orifice or lumen...

Ch. 11 Vocabulary Review Growth and Expansion 2026-04-07

14 Items: An artificial waterwayRoad on which tolls are collectedThe official count of a population- to transfer control of somethingA market where there is only one providerA machine that removes seeds from cotton fiberSole legal right to an invention and its profitsRivalry based on the special interests of different areas...

collective noun 2026-04-25

11 Items: A group of fishA group of peopleA group of flowersA group of playersA group of soldiersA group of studentsA group of grapes or keysA group of birds or sheepA group of wolves or cardsA group of bees or insectsA group of cattle or elephants

Fourth Grade Rules 2024-06-05

5 Items: mathbandrecessscienceand capitals

Dani & Jake 2025-05-25

30 Items: Bride's SiblingBest Man's NameGroom's SibilingCouple Coaches AtGroom's Birth MonthBride's Birth MonthPlace of EngagementMonth Groom ProposedMaid of Honor's NameHoneymoon DestinationTown Groom Grew Up InBreed of Couple's CatsCouple's 1st Cat's NameCouple's 2nd Cat's NameName of Bride's CollegeCouple's Favorite SportDating App Couple Met On...

Baron Alexander von Humboldt 2023-10-24

20 Items: ofvontheageship17691859¨of¨baronlarrysouthamericaexplorerhumboldtspyglass"father¨¨modern¨alexanderdiscovery¨geography."

JULY 2024-07-03

36 Items: redflagjulyblueadamsgamespartywhitestarsfamilyparadepicnicstatessummerfourthnationsummeramericafreedomfriendsholidayhotdogslibertystripescampingbarbecuecoloniescongressunclesamvacationfireworksjeffersonpatrioticdeclarationindependencedayfoundingfathers

Solid Word Search 2024-10-02

30 Items: gasmeltheatatompuresolidphasestateliquidfreezeenergymotionexpandchangeOKeefematterthermalkineticelementmixturecontractmoleculesubstancedepositionevaporationsublimationtemperaturevaporizationcondensationclassification

Geology and Mineralogy 2025-11-19

30 Items: OreCoreLavaPolarPolesEarthCrustDenseMagmaMantleMatterGeologyEquatorOceanicIgneousOrganicPressureVolcanicPlutonicGeologistEvolutionExtrusiveIntrusiveLimestoneInorganicAdaptationLithosphereContinentalCompositionSedimentary

Mass, Volume and Density 2026-03-02

30 Items: airMassgramcokecubesinkliterwaterfloatmodelblockBeakerVolumeWeightMatterDensityBalancePipetteaerogeldietcokemeniscuscylinderevidencesubstancereasoningmillilitercentimeterarchimedesGraduatedCylinderwaterdisplacement

Unit 4 Word Search 2026-03-24

30 Items: MASSBIOTICMATTERVOLUMESOLUTEHABITATFOODWEBABIOTICDENSITYMIXTURESOLVENTORGANISMPRODUCERCONSUMERSURVIVALSOLUTIONDISSOLVEECOSYSTEMCOMMUNITYFOODCHAINCONDUCTORINSULATORPOPULATIONDECOMPOSERADAPTATIONSOLUBILITYTEMPERATURETHERMALENERGYPHYSICALCHANGEELECTRICALENERGY

Unit 3: Matter and Energy in an Ecosystem (Amplify Science 6th Grade) 2026-04-24

30 Items: fatatomsinputmatterbioticcarbonenergyoutputstarchsystemabioticbiodomedioxideconnectstorageglucoseproductcellularconsumerglycogenmoleculeproducerreactantecosystemorganismsdecomposerrespirationchloroplastmitochondrionphotosynthesis

Chemical Change 2026-05-29

30 Items: GoldAtomMetalSodiumMatterProtonSymbolElementMercuryNeutronNucleusDuctileMixturePhysicalChemicalPropertyToxicityElectronPeriodicCompoundAlchemistScientistSubstancePotassiumMalleableMetalloidReactivityObservationFlammabilityInvestigation

Semester 1 Exam Revision 2026-06-16

30 Items: solidionicProtonMatterreflexenergyisotopefissionnuclearsensoryglucosedendritereactantcovalentaluminiumcorrosionHypothesisMassnumberperipheralexothermicIndependentpenetrationhomeostasisrespirationchloroplastBohrsdiagramcarbondatingchemotherapyphotoreceptorelectromagnetic

EscapeRoomWordSearch 2022-07-10

18 Items: Tongue’s senseMother's sisterPooh’s nervous friendShifting tectonic platesAmerica has fifty of theseWicked and Hamilton are thisWhat the wicked witch defiesLoves lasagna, hates MondaysFirst word of leprechaun cerealCoat that can only be put on wetLives in an underwater pineappleWhere today comes before yesterdayOff to see the wizard to get a brain...

Start of the Cold War 2026-04-10

20 Items: The line that divides EuropeStopping the spread of communismLeader of the USSR, died in 1953The fear of communism in AmericaUnion of Soviet Socialist RepublicsA war to contain communism 1950-1953U.S. financial aid to Europe and AsiaA race to control more nuclear weaponsThe alliance of communist countries 1955Leader of the People's Republic of China...

The Legislative Branch 2025-12-15

20 Items: to make lawsthe House of Representatives + the Senatethe leader of the Senate; also called the "President of the Senate"the "Upper House" of Congress, where each state has 2 representativesa lawmaking body made of two separate chambers or houses (the House of Representatives and the Senate)...

Prosecutors and Defense 2026-02-17

15 Items: counts,process,counsel,counsel,attorney,prosequi,attorney,defender,discovery,efficiency,sufficiencyprosecution,sufficiency,States attorney,attorney general,

Math Vocab 2023-10-05

24 Items: basetermsfactorsvariableexponentdiscretemonomialbinomialpropertyequationtrinomialrewritingexpressionsubstitutecontinuouspolynomialtrichotomyexpressionscoefficientcoefficientof equalityof a monomialof operationsof a polynomial

2nd Quarter Literature 2022-11-25

28 Items: The main character of a story _____________A type or category of literature _____________Prose that tells of real people and events _____________A literary tool to make the audience laugh _____________An expression of one thing in terms of another _____________The major turning point for the main character _____________...

Alcohol Laws 2026-04-03

12 Items: chemical breakdown by bacteria, yeast or other microorganismsbusiness which sells alcohol for consumption at a different locationbusiness which sells alcohol for consumption at the location of sale(ABV) measure of how much alcohol (ethanol) is in a given volume of a beverage...

Earth Science CH 2 2016-01-18

30 Items: IonGasBohrMassBondAtomsForceIonicStateSolidMatterLiquidPlasmaProtonsmixtureDensityElementsNeutronsisotopesCompoundMoleculeCovalentMetallicHydrogenSolutionElectronsMassnumberhomogeneousAtomicnumberHeterogeneous

Logic Word Search 2024-03-19

30 Items: mindsoulformlogiccauseethicsvirtuemattermotionbiologypoeticspoliticsrhetorictheologysyllogismintellectknowledgereasoningaristotlesubstancehappinesseducationteleologyactualityphilosophygoldenmeaneudaimoniaempiricismmetaphysicspotentiality

Fluid Word Search 2024-10-14

30 Items: PumpFluidBoatsWHMISValveSoluteMatterPascalEnergyAqueousSolventDensityBouancyGravityNewtonsGalileoSolutionParticlePressureCohesiveViscosityHydraulicPneumaticBarometerSubmarineSolubilityHydrometerTemperatureConcentrationChromatography

Draco's and all of that 2026-01-16

30 Items: GodLoshJakeKaelMaskDracoVichyHazemSarahNidalKoreaSeoulTommyNaplesSuberoSalishMatterAgencyJolishFerranJordanJoshuaCindlayRedfieldMarseilleDracobloxGodpowersHighschoolElementaryBrookhaven

Year 8 Science - Term 2 2026-04-21

30 Items: gasatommassacidbasesolidliquidvolumesolutemattersymbolelementmixturedensitymeltingboilingsolventproductneutralcompoundmoleculefreezingsolutiondissolvereactionreactanttemperatureevaporationcondensationperiodictable

Early Finishers 2026-04-29

30 Items: DNADataAtomCellForceEarthSolarMatterEnergyMotionPlanetScienceControlGravityElementClimateWeatherAnalysisVariableEvidenceMoleculeCompoundReactionOrganismEcosystemExperimentHypothesisConclusionObservationPhotosynthesis

GRADE 7 SCIENCE 2026-06-30

30 Items: GASSOLIDPHASELIQUIDPLASMAMATTERTHEORYMOTIONENERGYKINETICHEATINGCOOLINGMELTINGDIAGRAMSPACINGPARTICLEFREEZINGMOVEMENTMOLECULARPARTICLESVIBRATIONDEPOSITIONIONIZATIONARRANGEMENTTEMPERATUREEVAPORATIONSUBLIMATIONCONDENSATIONILLUSTRATIONSTATESOFMATTER

Discover Italy 2024-09-03

21 Items: Capital of ItalyItaly's currencyMeans "Cathedral"Italian famous cheeseItaly's national sportSea to the east of ItalySea to the south of ItalyLives in the Vatican CityCity famous for its fashionVolcano that destroyed PompeiTasty meal originated in Naples95% of Italians are this religionA country that borders with Italy...

10 American States 2026-05-22

10 Items: OhioTexasNewYorkGeorgiaFloridaKentuckyLouisianaCaliforniaconnecticutMassachusetts

Greek Vocab 2025-10-03

31 Items: Before SocratesA circular buildingA citadel or "high city"An enigmatic facial expressionThe square top of a Doric capitalTwo handled jar with a narrow neckSlight bulge in the middle of a columnAncient Greek satue of a standing nude manAn independent city-state in ancient GreeceAncient Greek statue of a standing clothed woman...

. 2025-05-29

10 Items: ManBoybombUnionStatesProjectS. TrumanHiroshimaOppenheimerD. Roosevelt

Sheffield Word Search 2025-06-10

30 Items: Amelia’s ageThe Groom’s sisterThe Bride’s brotherThe Grooms hometownThe Bride’s hometownThe Bride’s maiden nameThe month they first metThe name of the best manAmelia’s favourite singerFather of the Grooms nameFather of the Brides nameThe Bride’s favourite foodThe Groom’s favourite foodThe Groom’s birthday monthMother of the Groom’s name...

Foot Pathologies - 2025 2025-10-16

25 Items: Also known as 'bunion'Also known as 'pump bumps'Also known as Tailor's bunionAnomalous fusion of two or more tarsal bonesAbnormally flattened medial longitudinal archInflammation along the entire ball of the footThis is rupture of the Posterior Tibial TendonResults in heel pain first thing in the morning...

Ecology: Word Search 2025-10-03

41 Items: Eat plants.Eat other animals.Consume dead animals.Single living entitiesBoth organisms benefit.Living parts of an ecosystemEat both plants and animals.The variety of life in an area.Nonliving aspects of an ecosystemThe number of species in an area.Neither organism affects the other.Consume dead organic matter (detritus)....

Saffron and Ashley OO 2024-09-17

25 Items: Groom hobbyMonth we metGroom hometownGroom Star SignBride star signBride eye colourFlower girl nameBride birth monthWhere did we meetGroom Middle nameBride middle nameGrooms high schoolNumber of best menMonth of engagementPlace of engagementMost recent concertMother of Bride nameMother of groom nameGrooms favourite carCouples first holiday...

Ash & Bhav 2025-04-25

24 Items: Their surnameMonth they metFirst movie dateBhavik's dream carBride's middle nameCity where they metAashini's dogs nameMaid of honor's nameMonth Bhavik proposedBride's brothers nameHoneymoon destinationBhavik's brothers nameBhavik's football teamBhavik's birthday monthColour of bride's dressAashini's birthday monthDream holiday destination...

Evolution Word Search 2024-11-14

20 Items: LyellAnningLamarckFossilRecordSexualSelectionHomologousStructure"Survival of the fittest"type of bird Darwin studiedchange is a species over timea change in the sequence of DNApreserved remains of an organismselective breeding done by humansdifferences in traits of a speciesmost broad classification of organism...

911 2026-09-11

30 Items: ONETWOYORKBELLBUSHPRIDEHEROESPOLICERESCUESTATESAMERICAFIGHTERFREEDOMBRAVERYHISTORYCOUNTRYLIBERTYPATRIOTSERVICEELEVENTHMEMORIALMOURNINGPENTAGONREMEMBERGIULIANIELEVENTHEMERGENCYSPETEMBERANNIVERSARYTRADE CENTER

~Science Vocab Search~ 2023-05-22

20 Items: Change in moisture contentMeasures the direction of the blowing wind.Intense tropical storm formed over warm ocean water.Measures the amount of precipitation that has fallen.The weight of the pressure of air pushing down on Earth.When cold air moves under warm air and forces warm air up.Narrow bands of high winds near the top of the troposphere....

Odin Word Search 2023-06-21

34 Items: EyeGodGododinthorgeriyuleHuntymirwodanbaldrfrekimimirof Warfenrirwolvesravenswisdomhuginnmuninnasgardmidgardsleipnirmagicianof poetswandererwednesdayand Emblayggdrasilberserkerallfatherof Wisdomof Vili & Veof Bestla & Borr