states of matter Word Searches

Class of 2023 2023-05-05

19 Items: teahallyannaashiamollykyleelaurabrookekayleecarleyjasmynlindeekamrynpaytonjessicarebekahcourtneyannalisekatherine

League of Legends 2024-08-28

19 Items: LuxZedAhriJinxJhinAsheYasuoTeemoGarenRivenAkaliEzrealThreshAatroxSorakaDariusLeeSinKatarinaFiddlesticks

Word Search 2024-06-13

15 Items: sampleunexpectedlya part of a seriesfast/ at high speedto a very great degreein an extremely hungry waythe quality of being honesthappening because of good luckin a way that was not expectedsuggests or resembles a miracle.an animal that feeds on other animalsa place where a plant or an animal livein a way that is difficult to understand...

BURN INJURIES 2023-02-21

19 Items: burnAREApalmWATERDEGREEDEGREEDEGREEmeasurethermalblisterOF NINESchemicalepidermisTHICKNESSTHICKNESSradiationelectricalpercentagesuperficial

Shaytaan Word Search 2024-03-30

9 Items: "Risalat""Tasbeeh""Shaytaan""Creation"Our GuidebookIslamic Doctrine3rd Pillar of IslamHands And Feet Will TestifyExamples Of The Aad and Thamud

Key Features for Waves 2024-01-07

10 Items: phaseequilibriumKey Feature 1Key Feature 2Key Feature 3Key Feature 4Key Feature 5Key Feature 6Type of Wave 1Type of Wave 2

The Great Depression 2014-03-11

26 Items: ofOzFDRtheSoupGonewithwindKingKongPoorDustBowlStockGreatBlackCaponeWizardMarketFarmerTuesdayShirleyTemplesMonopolyDepressionHooverville

Imperialism causes and effects 2015-05-19

25 Items: ofrawNewtheTsavoWealthMedicalMilitaryImperialtransferRetardedmaterialsconflictsInvestmentMan-eaterssuperioritycompetitiondevelopmentimprovementsadvancementsopportunitiesPhilosophicaljustificationTransportationInterdependence

Imperialism causes and effects  2015-05-20

25 Items: ofRawNewtheTsavoWealthMedicalMilitaryImperialtransfermaterialsconflictsRestartedInvestmentMan-eaterssuperioritycompetitiondevelopmentimprovementsadvancementsopportunitiesPhilosophicaljustificationTransportationInterdependence

POC 2020-12-23

26 Items: isoftipcostpartwholemarkupdivideexpensepercentretailermarkdownmultiplydiscountsalestaxnetincomegrossincomesellingpricecrossmultiplyamountofchangeoriginalamountpercentequationpercentofchangeinverseoperationonehundredpercentproportionequation

Explore 5 - Chpt 3 - Our Mysterious World 2022-10-09

23 Items: ofinuglypaleghostalienthinkgiantmagicaloneawfulwickedscaredmysterycuriousmonsterstrangethroughcarefulimaginehorribledangerousfrightened

Federal Rules of Evidence 2024-09-12

20 Items: NoticeHearsayWitnessWitnessEvidenceof ProofRelevanceObjectionTestimonyPrivilegeFoundationExaminationImpeachmentMaterialityExclusionaryInadmissibleAdmissibilityPreponderanceAuthenticationCross-Examination

Henrietta Elizabeth Bromwell 2023-05-17

17 Items: ArtjulybooksnettieSisterartistauthordenverMuseumillnesshistorybromwellCemeteryillinoiscoloradohenriettaof Denver

Social studies vocabulary 2022-06-14

12 Items: globecolonyimporttacticIndiansPassageartifactindustrypatriotsmigrationjamestownof exploration

Social studies vocabulary 2022-06-14

12 Items: globecolonyimporttacticIndiansPassageartifactindustrypatriotsmigrationjamestownof exploration

Social studies vocabulary 2022-06-14

12 Items: globecolonyimporttacticIndiansPassageartifactindustrypatriotsmigrationjamestownof exploration

Higgins Weekly -Guess The Words! 2023-05-01

18 Items: EggJazzFlat fishShake a cowLot of keysIt's a TriangleThe BEST cookieA Cheesy delight!The Hardest Math ClassA great breakfast foodA two fish constellationGreat for making potteryAn evolved form of shearsBig disk that hit with hammerStupidly hard to spell instrumentAn american-version of buttercreamAnother Stupidly hard to spell instrument...

Shabbos 2024-07-18

19 Items: fishholysoupwinekugelsevenfamilyparshacandleschallahchickencholentOF RESTkiddushshabboshavdalahspiritualFROM HASHEMNINE MELACHOS

שמואל ב פרק ג 2024-02-13

28 Items: Dovid's 1st born son (2)Avner held this positionThis many people never sinnedYoav sent these to Avner (26)Dovid refused to do this (35)Avner killed his brother, AsahelYoav stabbed Avner in the __ ribHow many ways did Dovid curse Yoav?Dovid walked behind Avner's __ (31)Son of Shaul; supported by Avner (6)Which tribe did Avner speak to? (20)...

32.The McCarthy era saw the rise of anti-communist hysteria in the United States. 2023-03-05

27 Items: sovietmarxismredscaresecuritycommunistwitchhuntsocialismespionagepropagandagovernmentcensorshipfreespeechradicalismmccarthyeramccarthyismloyaltyoathsanticommunismfearmongeringjosephmccarthycivillibertiescoldwarpoliticspoliticaldissentfbiinvestigationsamericanactivitieshollywoodblacklistpoliticalrepressionconstitutionalright

Ancient Greece Timeline 2023-01-25

15 Items: academy 386 BCE: Plato establishes this school.776 BCE: The first of these takes place to honor Zeus.431 BCE: These wars, between Athens and Sparta, begin.432 BCE: This temple to the goddess Athena was completed.323 BCE: This period begins after the death of Alexander the Great.490 BCE: The Greeks battle this Middle Eastern group for independence....

Ancient Greece Timeline 2023-01-25

15 Items: 386 BCE: Plato establishes this school.776 BCE: The first of these takes place to honor Zeus.431 BCE: These wars, between Athens and Sparta, begin.432 BCE: This temple to the goddess Athena was completed.323 BCE: This period begins after the death of Alexander the Great.490 BCE: The Greeks battle this Middle Eastern group for independence....

Principles of Government 2017-04-21

19 Items: PollsSystemPowersBranchGlobalVotingSenateRightsFederalCitizenJudicialCongressExecutiveSeparationParliamentLegislativeCitizenshipRepresentativesResponsibilities

History of Healthcare 2020-01-30

19 Items: DarkAgesMiddleAgesRobertKochHippocratesRenaissanceClaraBartonAncientTimesMichelangeloApothecariesEdwardJennerJosephListerLouisPasteurWilliamHarveyLeonardoDaVinciBenjaminFranklinGabrielFahrenheitElizabethBlackwellAntonVanLeeuwenhoekFloranceNightingale

Town of Salem 2020-10-26

19 Items: SpyTownRoleHungMafiaWitchCovenClaimJailorJesterDoctorMediumMafiosoSherrifLookoutArsonistAttackedInvestigatorSerialKiller

City of Ember 2021-04-19

19 Items: linaorlyboatemberpoppyclarymurdomayornammyriverlooperlizzievindiegrannyfleerycandlelightspipeworksmessenger

Gulf of Mexico 2021-05-28

19 Items: redseaGulfJessTexasHotubMexicoAlonsosnapperturtlesAlabamaFloridacurrentJeffreyDespairfounderAlwarezLouisianaMississippi

Types of animals 2023-05-08

19 Items: frogswanbirdswhalesnakesharkeaglefisheslizardpigeonmammalsdolphinpiranhareptilescapybaraseahorsecrocodileamphibianssalamander

Throne of Glass 2024-04-17

19 Items: cainelenagraveerileanehemiaadarlankaltaindamarisnoxowenassassinendovierridderakwyrdmarksarobynnhamelchaolwestfallkingschampiondukeperringtondorianhavilliardcelaenasardothien

COORDINATION OF BENEFITS 2024-08-23

20 Items: PCPCOBPPOHMOTPLEOBBASICOHIAAOHIPDOHIAATRICAREMEDICAIDMEDICARECLAIMFORMINSURANCECAPITATIONPREFERREDPROVIDERPROVIDERREMITTANCEWORKERSCOMPENSATIONSUPPLEMENTALINSURANCE

TOPIC 2: Civilizations of the Fertile Crescent 2023-02-08

16 Items: Codearmytraitempireof lawimportexportcolonytributeirrigatealphabetzigguratscuneiformdiffusioncity-statepolytheism

Australian parliamentary system 2024-06-06

15 Items: senatemonarchcabinetministerdemocracydemocracyjudiciaryexecutiveparliamentfederationreferendumconstitutioncommonwealthgovernor-generalof Representatives

Tay Word Search 2024-08-16

15 Items: RoadCityRoseJuneGarethCyprusCruiseRebeccaAnthonyand DipBrambleGuinnessSeptemberNewcastleof Bradgate

Ultimate Frisbee 2023-09-20

8 Items: pulldisccatchpivotdefenseturnoverreceivingin-of-bounds

harry potter 2020-09-01

28 Items: ofofwandDeatheatermagicalleymanorBlackDobbywinkydiagonMalfoymalfoyPotterWesleycrouchchamberAzkabanPrewittministryseacretsHogwartsHogsmedeslughornKreatureLestrangeGreengrass

Classic Films 2024-02-25

22 Items: etjawspsychomatrixvertigotitanicGodfathercasablancacitizenkanepulpfictionforrestgumpspaceodysseyjurassicparkof the Lambsthewizardofozschindlerslistgonewiththewindsinginintherainsunsetboulevardlawrenceofarabiabreakfastattiffanysshawshankredemption

Porcini Word Search 2024-06-27

20 Items: EarManemorelenokioysterreishiporcinicreminiTrumpetlobstermaitaketruffleshiitakehedgehogshiimejipuffballmatsutakeportobellochanterelleof the Woods

ELC 4 wordsearch 2023-09-25

15 Items: only one type of atomused to separate solids and liquidsname for water that is safe to drinkused to seperate solutes from the liquidused to separate smaller particles from watertwo or more substances not chemically combinedmolecule made of only hydrogen and carbon atomslarge particles settling to the bottom of water...

judaism 2024-08-12

20 Items: TorahSederRabbiHesedTorahKippahKosherTallitKippurSukkotShabbatMitzvahMenorahMitzvahMitzvahKaddishChanukahTefillinof DavidHashanah

1 2022-06-26

6 Items: heitofweohhis

Infinity and beyond 2024-07-18

10 Items: claysunnyfathomScarletskywingof EvilalbatrossclearsightDarkstalkerquicksilver

Infinity and beyond 2024-07-18

10 Items: claysunnyfathomScarletskywingof EvilalbatrossclearsightDarkstalkerquicksilver

Ethans Spelling Word Search 2023-04-05

35 Items: lukejohnmusclesprintfitnesswarm-upstadiumworkoutathletehandballmuscularolympicsexerciseequipmenttreadmillgymnasiumstopwatchgymnasticsracquetballperspirationcoordinationcalisthenicscross-countryweighttrainingstationarybikea long race or contesthaving to do with the heart and blood vesselsthe power to stand something without giving out...

20 of my most challenging words form 2023 2023-12-06

20 Items: to be givena reverse movementnot alined proplelyan expert in scientsto be full of glamoura person who fixs teethto be scade of somethinga rainforest in queanslandto let someone do somethingbefore what has just happenda animal that lives in africaa animal that lives in the seafuels a fuel made out of fossilsto see something that is obviose...

SOBRIQUETS OF PLACES OF THE WORLD 2020-02-28

15 Items: FRISCOBLIGHTYSINCITYBEANTOWNWINDYCITYEMPIRECITYTINSELTOWNQUAKERCITYLANDOFCAKESLANDOFMARBLELANDOFLILIESCHOCOLATECITYLANDOFKANGAROOROOFOFTHEWORLDPORTOFFIVESEAS

Blueback 2023-11-27

7 Items: abels mumbig blue fishguy resting under the treemain character of the moviethe main character of the bookthe main antagonist of the bookthe guy that gave abel his boat

Cat Word Search 2024-01-04

10 Items: Counted among the most dangerous of all animals (Isaiah 11:8)The practice of this is condemned in the Bible (Deuteronomy 18:10)Malchus lost one when Peter struck him with his sword (John 18:10)The greatest one of all human history takes place at Har–Magedon (Revelation 16:14, 16)...

Happy New Year 2023-12-14

17 Items: hatdroptimeyearsquaretuxedodancingholidaymidnightsparklercelebratechampagnecountdowngatheringnoisemakerresolutionof midnight

1920s Crossword 2022-10-20

8 Items: Religion vs. EvolutionIllegal traffic in liquorWomen in the 1920s who wore skirtsContributed to the understanding of evolutionCultural revival of african-american music and artAmerican Gangster who was famous during the Prohibitiontransportation production and consumtion of alcohol now legal...

Social studies vocabulary 2022-06-14

12 Items: globecolonyimporttacticIndiansPassageartifactindustrypatriotsmigrationjamestownof exploration

Social studies vocabulary 2022-06-14

12 Items: globecolonyimporttacticIndiansPassageartifactindustrypatriotsmigrationjamestownof exploration

Social studies vocabulary 2022-06-14

12 Items: globecolonyimporttacticIndiansPassageartifactindustrypatriotsmigrationjamestownof exploration

Imperalism 2015-05-19

25 Items: ofrawnewtheTsavowealthmedicalmilitaryimperialtransferretardedmaterialsconflictsinvestmentman-eaterssuperioritycompetitiondevelopmentimprovementsadvancementsphilosificalopportunitiesjustificationtransportationinterdependence

Mr & Mrs Hopkins 2024-08-02

24 Items: lovecakeleonjackbibleringsconorchurchushersfamilyweddingbestmansydwellhopkinsfriendshusbandmarriagemarriagenewlywedshappinessof honourflowergirlringbearerbridesmaids

BB9 04 2017-09-26

30 Items: OFNIVOLDNEWJOHNPOPEHOLYWRITKINGLATINROMANBIBLEPRESSGREEKISLESBIBLECHURCHJEROMEHEBREWTYNDALEVULGATEBRITISHENGLISHENGLISHENGLANDWYCLIFFEPRINTINGLANGUAGETESTAMENTTESTAMENT

BB 9 04 2017-09-26

30 Items: OFNIVOLDNEWJOHNPOPEHOLYWRITKINGROMANBIBLEPRESSLATINGREEKISLESBIBLECHURCHJEROMEHEBREWENGLISHTYNDALEVULGATEBRITISHENGLISHENGLANDWYCLIFFEPRINTINGLANGUAGETESTAMENTTESTAMENT

Network Admin - Valentine's Day 2024 2024-02-14

14 Items: three-headed dog of HadesThe earlier version of RADIUSKerberos term for the client/userPrivate Key scheme which uses a 56-bit keyThe gibberish produce by encrypting a messageThe type of encryption also known as public keyThe type of encryption also known as private keyPublic key scheme used in to protect web traffic...

Google Docs Word Search 2024-09-20

16 Items: BoxBoldItalicFontSizeFontStyleLeftAlignTextColourCenterAlignInsertShapeInsertTableBulletedListIncreaseIndentDecreaseIndentBackgroundcolourParagraph Spacingof Document Goes Here

Vocabulary 2023-09-22

7 Items: Perspective-Noun; Point of viewNotable-Adjective; Worthy of attentionToxic-Adjective; Poisonous; destructiveBalderdash-Noun; Senseless talk or writingContradict-Verb; Asserting the opposite of the truthDialogue-Noun; A conversation between two or more peopleConsequence-Noun; A result or effect of an action or condition

unit 6 2023-11-06

12 Items: open to viewto copy exactlyto do make happenthe cause of ruinto pull out or removeto hide or keep secretto annoy or make angryhaving a sharpened edgevery great or very largeto show a burst of energya person not in a militarythe amount of space that can be filled

Lily VanMetre wordsearch 2024-05-15

14 Items: postively chargedneutrally chargednegatively chargedAtomic symbol is Hpotential energy storedan object that attracts ironchange from a liquid to gas stateelement usually deep yellow seen as valuableprocess by which sound waves travel through a mediumelectric potential energy between two places ona circut...

I Am the Mountain 2023-12-13

6 Items: to think deeply about somethinga tall mountain with a pointed or narrow topa high, steep surface of rock, earth, or icea very large mass of ice that moves very slowlya state of having a lot of knowledge and wisdomthe spiritual, mental and emotional part of humans

Andreakia's Food Web Word Search 2024-09-04

10 Items: omnivoreautotrophherbivoretop predator/carnivorebreaks down dead organic matterConsumers who get their energy by eating other organismswhere less energy is transferred to the next level (only 10%)producers that capture energy from the sun and use it to make their own food...

Astronmy Word Search 2023-12-18

11 Items: the study of zodiacthe study of the universesomthing that creats lighta person how works in spacesomthing that reflects lighta consellation know a ursa majora consellation kown as ursa minora bunch of stars creating a picturea ball of ice and dust that orbits the suna day twice a when the suns exaty abobe the eqator...

Tide Terms 2024-01-20

13 Items: the zone between high and low tidewe ____ through the two tidal bulgesterm for when celestial bodies line upgravitation of this is main cause of the tidesthe changing water levels experienced on earththe tide pattern when the sun earth moon are in syzygythe tide pattern when the sun moon and earth are at right angles...

Thermal Energy 2023-11-08

6 Items: the energy for heatanother word for heatthe rising and falling of thermal energytransfer of heat through electromagnetic wavesthe direct transfer of heat through atoms movingthe unit of degrees that measure the degrees in something

Around Town 2022-11-10

10 Items: bankbelowmarketcentrebehindbesidestationlibraryoppositefront of

005 2023-03-08

10 Items: hairnearcurlycleanlightlot ofeitherthe netparentssometimes

norse mythology 2023-01-18

15 Items: Many slain in battle will end up here.The Nine Realms all cling to this ash tree.The day Tuesday is named after this Norse God.After the Ragnarok cataclysm, these two re-populated the world.This monstrous wolf and problem for the gods is somehow Loki's offspring.We know so much about Norse Mythology because of the writings of this man....

Fussilat 2024-03-30

9 Items: "Risalat""Tasbeeh""Shaytaan""Creation"Our GuidebookIslamic Doctrine3rd Pillar of IslamHands And Feet Will TestifyExamples Of The Aad and Thamud

Constructive & Destructive Forces 2024-01-23

14 Items: Wide, flat areaLiquid, molten rockMound or ridge of sandDeep crack in the Earth's crustSudden movement of Earth's crust.A deep valley with high, steep sidesA physical feature on Earth's surfaceLand that rises high above the groundMass of land that forms at the mouth of a riverOpening in Earth's crust where magma can rise up...

Christmas Unscramble the Word Search #1 2022-10-10

12 Items: givebabycoldthankangeljoyouspresentor nicenativityof Peaceornamentsthe turkey

ELA7 Review 4: Word Find of the Day (Q1 Cumulative) 2023-10-24

18 Items: to have ambitionto rejoice greatlyto make more noticeablevery strange or unusualan official ban on traderepetition of the same soundsnoisy, energetic, and cheerfula comparison between two thingsa curve in the shape of an ovalthe scientific study of languageto deceive by elaborate trickerya mistaken belief; a false notion...

lawsons word serch 2023-12-18

18 Items: study of spacea pattern of starsa small icey objectlooks like a big bearalso known as ursa majoralso known as ursa minora galaxy that we live inlooks like a little bearthe study of constalationssomeone who gos in to spacea rock that tuches the grownda rock is in earths atmospherea huge object that has a orbitthe same size a a dust particle...

Estonia animals and plants. 2022-02-25

8 Items: catdogcoatwolfsheepcornflowersmokeswallowlily-of-the-valley

color 2024-07-19

10 Items: A purplish-red color.A deep, rich red color.A vivid purplish-red colorA deep orange-yellow color.A deep and rich blue-purple color.A deep yellow or orange-brown color.A deep blue color like that of a clear sky.A yellow-green color like that of unripe fruit.A greenish-blue color like that of the gemstone....

Addictionary Word Search 1 2023-08-08

10 Items: Not consuming the drug of choice during a specified period of time.An attribute, behavior, or condition that is socially discrediting.The use of punishment as a threat to deter people from committing offenses.A state in which one is not intoxicated or affected by the use of alcohol or drugs....

computer 2024-07-19

10 Items: A set of rules or steps followed to solve a problem or perform a task.Software intended to damage or disable computers and computer systems.A set of rules governing the format of data sent over a network or the internet.The process of converting information into a code to prevent unauthorized access....

Word Search Puzzle 2024-08-07

10 Items: One of the "3 As" of rural marketingThis analysis helps organizations identify their internal positives and Negitives.The additional satisfaction or benefit gained from consuming one more unit of a good or service.A Japanese term meaning "continuous improvement," focusing on incremental, ongoing improvements in processes....

Explorers of Texas 2014-09-19

19 Items: NewEastReneTexasTiguaTexasCanadaCortezMarcosAlvarezVasquezEuropeanColumbusCoronadoMatagordaKarankawaAmericansMississippiConquistador

Effects of Imperialism  2014-11-03

19 Items: newrulecashcropscropspowersglobalwesterncultureEuropeanresistedculturalimperialeducationchallengesimperialisttraditionalnationalistindustrialized

4th Of July 2016-05-13

18 Items: redfundayblueproudhappypeoplefamilyhotdogsAmericanbaseballbarbequecarnivalfireworkshonorablehistoricalcelebrationIndependence

Elements of Fiction 2022-09-12

18 Items: lead character of the storythe sequence of events in a storycharacter stays the same with no changeenemy or opposition of the main charactera struggle or central problem in the storycharacter vs. a fight against other peopleperson; told by the protagonist - I, me, mycharacter changes due to evens in the story...

Symptoms of stress 2023-03-14

18 Items: edgyupsetangrylividscaredguiltysnappypanickyanxiousinsomniaconfusedsweatingirritableheadachesresentfuldefeatistfrightenedrunningaway

Vicar of Dibley 2023-10-17

18 Items: jimowenhugoalicedavidfrankcomedypuddlesvillagetvseriesgeraldinechocolatemrscropleydawnfrencheasterbunnyvicarofdibleychristmaslunchcommitteemeeting

Reindeer Word Search 2023-10-11

20 Items: Unique ice crystalSanta's entry pointSweet, spiced cookieSnowman made of snowSanta's sleigh-pullersA festive, creamy drinkCircular holiday decorationRed and green holiday plantDecorative tree decorationsRed and white striped sweetA plant for holiday smoochesHung by the chimney with careFestive evergreen centerpieceFestive holiday song accessory...

30 most famous landmarks around the world 2024-02-07

30 Items: BenFujiWallTowerMahalTowerGüellLouvreSquarePicchuSquarePalaceKhalifaAl ArabalhambraLong BayFountainMountaincolosseumborobudurof Libertyde TriompheOpera Housethe RedeemerWall of Chinaoeur BasilicaState BuildingDame CathedralPeters BasilicaSagrada Familia

HUMAN RIGHTS 2017-06-06

28 Items: ofnonotolifebornfreeplayhumanequalrightrightsspeechdignityrespectshelterfreedomslaverytortureprivacysecurityeducationuniversalcopyrightprotectiondeclarationnationalityresponsibility

Love YOUR Library Event Word Search 2024-01-19

21 Items: lovebooksrosescandycupiddramacomiclibraryoverduefictionhistoryfantasyromanceplatinumvalentinesnon-fictioninformationtiwa-kitchengraphic-novelscience-fictionlibrary-of-congress

Furniture 2024-03-20

21 Items: bedsofadeskchairtablefutonbenchvanitydresserottomanarmoirewardrobebookcasereclinersideboardnightstandshoe-closetdining-tablecoffee-tablerocking-chairchest-of-drawers

Yaltaconference Word Search 2023-08-11

12 Items: 1991: _____: The event that officially ended the Cold War era.Chinese government violently suppresses pro-democracy demonstrations.1968: _____: Soviet-led invasion suppresses liberal reforms in Czechoslovakia.1961: _____ : East Germany creates a barrier to prevent defection to West Germany....

Prefix Suffix Root 2023-09-04

28 Items: suffix meaning without3 letter prefix meaning middleprefix that means too much or aboveprefix meaning not; used in nonsensesuffix meaning made of; used in woodenprefix meaning not; used in impossibleprefix meaning not; used in inattentiveprefix meaning not; used in uninterestedword part meaning water; used in hydrant...

herd of hounds 2022-07-25

18 Items: greyhoundotterhoundbloodhoundafghanhoundibizanhoundbassethoundazawakhhoundpharaohhoundirishwolfhoundgreekharehoundsilkenwindhoundenglishfoxhounditaliangreyhoundredbonecoonhoundbluetickcoonhoundscottishdeerhoundnorwegianelkhoundblackandtancoonhound

Evidence of Evolution 2023-02-10

18 Items: dnatimedarwinfossilsmelaninevidencemutationevolutiongeographycladogramanalogousvestigialanatomicalembryologyhomologousadaptationenvironmentcommonancestor

ANIMALS OF AFRICA 2023-05-07

18 Items: foxliontopizebrababoonimpalajackalcheetahgiraffewarthogaardvarkelephantmongooseporcupinerhinoceroswildebeesthippopotamusklipspringer

Fourth of July 2023-06-22

18 Items: redbluejulystarswhiteparadesummeramericafreedomhotdogslibertystripesbarbecuefireworkspatrioticsparklersdeclarationindependence

Julia's sky science word search 2023-12-18

20 Items: we live on onelight bounces off ita rock covered in icethe galaxy we live onpeople who go to spacealso called ursa majoralso called ursa minorthe study of the planetsa rock floating in spacealso called the big dipperstars arranged in a patternalso called a shooting staralso called the little dippera lot of solar systems together...

Cognitive Behavior Therapy Model 2023-10-23

14 Items: express feelingsanything causing an emotionbecome aware of every thoughtcaused by negative ventilatorsan action to close out feelingsthoughts that cause an emotional reactionunderstanding of internal subjective worldmanage our thoughts by using the techniquesprofessional sports (golf) is where CBT began...

Astronomy Word Search 2023-12-18

14 Items: meteoroidsa job in spacea constellationa shooting starthe study of the universestars that make up an imagethere is one for all seasonsa smaller version of big dipperits the first day of a new seasona rock that falls from space to earththis is when something gives off lightthis is when light bounces off something...

Jesus 2024-07-14

12 Items: IIIgodmarklukejohnjesusfaithSpiritmatthewgenesisLamb of God