states of matter Word Searches

U.S. 50 States Word Search 2026-05-04

50 Items: IowaOhioUtahIdahoMaineTexasAlaskaHawaiiKansasNevadaOregonAlabamaArizonaFloridaGeorgiaIndianaMontanaNewYorkVermontWyomingArkansasColoradoDelawareIllinoisKentuckyMarylandMichiganMissouriNebraskaOklahomaVirginiaLouisianaMinnesotaNewJerseyNewMexicoTennesseeWisconsinCaliforniaWashingtonConnecticutMississippiNorthDakotaRhodeIslandSouthDakotaNewHampshire...

Bird Words - ColorBird.org 2024-10-13

26 Items: What a bird flies with.A general word for a baby bird.What a bird pecks and eats with.A person who enjoys birdwatching.A sound that birds make (1 of 4).A sound that birds make (2 of 4).A sound that birds make (3 of 4).A sound that birds make (4 of 4).Birds flap their wings to do this.Some birds use these to grab prey....

example 2026-08-30

20 Items: Best man's nameNumber of guestsName of their dogName of the venueStreet they live onBride's middle nameWhere Aoife grew upWhere Conor proposedMaid of honour's nameHoneymoon destinationColour of Aoife's eyesConor's favourite drinkMonth they got togetherNumber of years togetherTrip they take every yearCouple's favourite dessert...

PHYSICAL SCIENCE 2016-11-29

32 Items: GASMASSGRAMSOLIDMATTERVOLUMELIQUIDBEAKERBALANCEDENSITYELEMENTMIXTUREPRODUCTVARIABLEMENISCUSCYLINDERKILOGRAMBUOYANCYCOMPOUNDSOLUTIONPHYSICALCHEMICALREACTANTHYPOTHESISEXOTHERMICOBSERVATIONTEMPERATUREENDOTHERMICTEMPERATUREDISPLACEMENTPURESUBSTANCESCIENTIFICMETHOD

Earths formation 2024-08-21

25 Items: lawatommotevastshiftprotonphotonquasarcosmicgalaxymattergravitystellarinfiniteuniversecoalescepostulatecosmologysingularitycosmologistinadvertentbang theoryinfinitesimalelectromagnetismbackground radiation

Soil Texture 2024-04-16

10 Items: The mass of soil per unit volume, indicating how compact or loose the soil is.The physical state or firmness of soil, which can range from loose to compacted.Essential elements or compounds present in the soil that are necessary for plant growth and development....

Psychopharmacology Word Search 2022-09-29

19 Items: axonapneaanionsystemmidbraindendritemembraneintersexforebrainhindbrainserotoningray mattertestosteroneprogesteronenorepinephrinenervous systemneurotransmitterprefrontal cortexinsensitivity syndrome

The Science Of Colours Word Search 2026-01-21

14 Items: Red gemstone coloured by chromiumEye cells responsible for colour visionVisible colour with the longest wavelengthStudy of matter using its colour fingerprintIshihara plates are used to detect what diseaseMethod of measuring colour using light absorptionScientist who proved white light contains all colours...

splatoon music 2023-08-13

20 Items: OCTLINGS"agent 1"splatfest songsong for shopsdeep cut battlemanta ray/musicianleader of deep cutevil octling artistsquid sisters hit songartist of "tide goes out"artist of "salmon noises""dont get cooked, stay______"octling member of off the hookoctavio versian of tide goes outShoot targets while on a riderailartist of triple dip and clickbait...

Gastritis Word Search 2026-02-24

20 Items: Pain in a jointExcessive thirstLow platelet countInflammation of the skinAbnormally slow breathingCondition of kidney stonesLow white blood cell countAbnormally rapid breathingDisease of the heart muscleDisease or damage of nervesHigh fat levels in the bloodPainful or difficult urinationAbnormally low body temperatureRunny nose from nasal discharge...

The Ten Commandments & The First Commandment 2023-09-20

22 Items: The way God gave us His LawHumanity's fallen conditionInherited from Adam and EveThe Ten Commandments are thisThe First way God uses His LawThe Third way God uses His LawThe Second way God uses His LawAttribute of God by which He is all-knowingAttribute of God by which He is this very wordAttribute of God by which He keeps His promises...

Life of Pi 2026-08-31

25 Items: reverent.innameonlywidlyknownandesteemedshowingrespectforagodclearlyrevealedtothemindthefloatingremainsofashiphesitantorlackingconfidencein theoriginalornaturalplacesiteinactivityresultinginnotlikigworkIn a serious, solemn, or somber manner.The quality of being deeply religious orsomeonewhoisunfamiliarwithsailingandthesea...

Muses Word Search 2025-03-28

9 Items: Muse of musicMuse of hymnsMuse of danceMuse of comedyMuse of historyMuse of tragedyMuse of astronomyMuse of epic poetryMuse of love poetry

grade 5 revision 2025-05-11

21 Items: Way What galaxy do we live in?What falls during an ice storm?What is the closest star to Earth?What is the North Star also called?What force pulls tectonic plates apart?What phase comes after a crescent moon?What type of front brings stormy weather?What is the outermost layer of Earth called?What is plant and animal matter in soil called?...

What's the matter 2025-11-03

8 Items: cutcoughfeverscratchheadacherunnynosetoothachestomachache

My Emotions Matter 2025-11-12

8 Items: SADHAPPYANGRYTIREDBOREDSCAREDEXCITEDWORRIED

Snack Word Search 2026-09-08

20 Items: The direction opposite westA tool that shows directionsTo go from one place to anotherAn exciting experience or journeyThe opposite direction from southA natural stream of flowing waterThe place you are traveling towardSomething you buy to remember a placeTo look around and discover a new placeA place travelers stop when nature calls...

Work 2025-05-27

28 Items: RedcityparkrockWalkGoldTourfallslaborGnomeGrapefallsTrailhousesJoshuaBattlestatesNatureInclinePatrickLookoutGeorgiaBluebirdJenniferRailwaysFairylandAdmissionsman squeeze

UNIT 85 LESSON 1 2025-09-12

21 Items: ActRaidStoweBrownPartyCourtKansasDebateRightsTubmanArsenalCollegeWarfareRailroadSlave LawSecessionAntebellumSovereigntyAbolitionistSectionalismScott Decision

Affirmations 2025-02-01

5 Items: You rise no matter whatA reminder of your worthYou deserve love and joyYour potential has no boundsOverflowing with good things

__________The Wordsearcher God of Mythology: Known as the Master of Word Searches 2025-03-01

30 Items: A gorgon with snakes for hair, whose gaze turns people to stone. She is often seen as a symbol of danger and fear.The god of the sea, earthquakes, and horses. He is one of the most powerful gods in Greek mythology and wields a trident....

Highways and Roads 2026-04-13

17 Items: EXIT12EXIT16HWY 306EXIT 15 EASTEXIT 15 WESTHWY 141 EAST OF HWY9HWY 141 WEST OF HWY9HWY 369 EAST OF HWY9HWY 369 WEST OF HWY9HWY 20 EAST OF ATLANTA HWYHWY 53 FROM DAWSON TO HALLHWY 9 SOUTH OF CITY LIMITSHWY 20 WEST IN THE CITY LIMITSHWY 9 NORTH OF THE CITY LIMITSHWY 20 WEST OUT OF THE CITY LIMITSHWY 9 NORTH INSIDE THE CITY LIMITS...

EL Science 2024-03-22

5 Items: grotematterscienceflammableevaporation

Nurse Practitioner Week 2023! 2023-11-11

18 Items: A1c > 6.4%A disorder of the enthesesBlood pressure above 119/79State of elevated cholesterolWork jointly with others or a teamThe art of displaying kindness and concern for othersA person competent or skilled in a particular activityGive training in or information on a particular subjectDeficiency in the amount of oxygen reaching the tissues...

Snack Word Search 2026-09-08

20 Items: The direction opposite westA tool that shows directionsTo go from one place to anotherAn exciting experience or journeyThe opposite direction from southA natural stream of flowing waterThe place you are traveling towardSomething you buy to remember a placeTo look around and discover a new placeA place travelers stop when nature calls...

Architecture 2022-09-15

25 Items: an opening made in the wallthe lowest part of the buildingtriangular upper part of a walllowermost part of a window framea structure which combined with lintelthe horizontal upper portion of a stepa guard rail to give grasp to the handan isolated vertical load bearing memberwhere two of roofs surface meet together...

Sustainable Development 2024-05-30

15 Items: Type of energy harnessed from the sun.The act of preserving natural resources.Type of farming that avoids synthetic chemicals.Type of energy that can be replenished naturally.The long-term pattern of weather in a particular area.Type of gas that traps heat in the Earth's atmosphere.The process of converting waste into reusable material....

Waves 2016-03-21

33 Items: heatechoatomswavessoundgasesenergyenergyabsorbmattersolidsnucleusreflectliquidstransmitmoleculesfrequencywaterwavelightwaveswavelengthsoundwavesvibrationslightenergysolarenergysoundenergyseismicwavevisiblelightinfraredlightstateofmatterenergytransfernuclearreactionultravioletlightelectromagneticspectrum

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Science Terms 2024-09-24

31 Items: iongasatommassworkforcesolidweightenergymatterplasmavolumeelementgravitymeltingboilingmixturecompoundfreezingsubstancedepositionsublimationevaporationtemperaturecondensationvaporizationnuclearchangestateofmatterthermodynamicsphysicalchangechemicalchange

Non-Contact Forces 2024-11-14

30 Items: rubmasswirepolerepelNewtonweightmattervolumehammerchargegravitycurrentvoltagebatterycompassattractGalileofallingfeatherballooncircuitrevolvedistancepositivenegativemagnetismresistanceelectricityelectromagnet

solar system! 2026-02-13

32 Items: sunmarsfactorbiteightvenusearthringsplutostarsspacesaturnuranusmattertheoryexpandhubblemercuryjupiterneptunegravitybigbanggalaxiesuniverseeinsteinlemaitreredplanetfriedmanntelescopedwarfplanetsolarsystemastrophysicist

Unit 1 Vocabulary 2026-09-18

33 Items: GasMassRepelGramsSolidMatterVolumeLiquidAttractDensityThermalMeltingSolublePropertyDissolveClassifyParticleIncreaseDecreaseMaintainSubstanceMagnetismSubstanceConductorInsulatorInsolubleElectricalSolubilityMillilitersTemperatureEvaporationConservationCondensation

Landmarks Around the World 2026-09-09

17 Items: BenYorkMahalChinaIndiaItalySphinxFranceMexicoLondonDakotaof PisaRushmoreof LibertyStonehengeWall of ChinaTower, Colosseum

Citizenship and Immigration 2026-07-10

15 Items: to not allow; to refusegovernment aid to people in needan action we are required to performa legal process to obtain citizenshipan obligation that we meet of our own free willthe rights, responsibilities, and duties of citizensan individual who moves permanently to a new countrythe ruling authority for a community (town, state, nation)...

Percy Jackson TV Show 2026-06-01

23 Items: The monster with snake hair.The Son of Poseidon and main hero.God of the Sea and Percy's father.The name of Percy’s magical sword.Percy’s fiercely protective mother.The food of the gods used for healing.Goddess of Wisdom and Annabeth's mother.A person who is half human and half god.The grumpy god of wine who runs the camp....

Jenna & Spencer OO 2024-10-14

25 Items: grooms siblingbrides siblingbest mans namegrooms car colorbrides middle namegrooms middle namegrade Jenna teachesmonth groom proposedcolor of grooms eyesgrooms birthday monthbrides college mascotbrides favorite colormatron of honors nameschool Jenna teaches atcity the couple lives inmother of the grooms namemother of the brides name...

United States: Fifty States, One Nation—From Sea to Shining Sea 2025-11-17

20 Items: EAGLECANALJEANSTEXASGECKOSTATUEALASKACOYOTELIBERTYCAPITOLLINCOLNNEWYORKFREEDOMFOOTBALLDEMOCRACYHOLLYWOODWASHINGTONCALIFORNIAMISSISSIPPIGRANDCANYON

General Knowledge 2023-09-08

33 Items: A group of islands.The genetic code of life.The study of celestial objects.A ruler, often a king or queen.The study of heredity and genes.The study of ancient life forms.A cloud of gas and dust in space.The variety of life forms on Earth.A cultural revival and rebirth of art.A dramatic change in form or appearance....

Test 2024-09-26

15 Items: Growth of cities.Group of islands.Half of the Earth.Earth's surface features.Community of living things.Typical weather in a region.Spreading of cultural traits.Large, continuous area of land.Major ecological community type.Moving from one place to another.Narrow strip connecting two lands.Distance north or south of equator....

Civics Test Review 2026-05-13

15 Items: â€” rejection of a bill— first ten amendments— advisors to the President— highest court in the U.S.— legal member of a country— change to the Constitution— the supreme law of the land-- Last name of 1st President— government where people vote— money paid to the government— leader of the executive branch— war between the North and South...

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Week 3 - tt as in letter NEW 2026-05-03

32 Items: LetterBetterButterKittenLittleBottleMatterBittenMittenCottonKettleDottedSittingGettingCuttingPuttingWrittenSettingLettingHittingFittingBattingPatternScatterGlitterFlutterClutterSpottingChattingShuttingTatteredShattered

Aug 2025-06-27

20 Items: sinwarlifewilllifegracegoodscitiesprayerof Godeternitydoctrinescripturereasoningof heavenof Christconversionof neighborilluminationspirituality

tire vocab 2024-11-06

21 Items: describes the tire's compositionindicate the wet traction of a tireamount of weight a single tire can carrywidth of the tire measured in millimetresthe ratio of the height of the tire's sidewallindicate the ability of the tire to withstand heatthe size of the wheel measured from one end to the other...

History - Chapter 3: The Fertile Crescent 2016-07-11

37 Items: dikesSumerAkkadTorahMosesSinaiDavidJudahstylusTigrisSargonExodusCanaanIsraelPersianBabylonJudaismcontactHebrewsAbrahamGoliathSolomonHittitescovenantpromisedzigguratscuneiformHammurabiEuphratesAssyriansJerusalemMesopotamiacity-statesPhoeniciansPhilistinesCommandmentsFertileCrescent

4th of July 2024-07-04

40 Items: bbqredflagribsbluejulystarspartywhiteparadefamilyhotdogstatesholidaylibertyamericafreedomfreedomstripespicnicscarnivalamericanapplepiesparklerpopsicleicecreampatrioticcherrypiehamburgersparklingpresidentsbakedbeanswatermeloncelebrationcelebrationgrilledcornpotatosaladpeachcobbleramericanflagindependenceday

Veterans Day Word Search 2025-11-10

35 Items: WWIARMYFLAGNAVYWWIIFORCEGUARDFLEETSERVETROOPBATTLECOMBATDEFENDHEROESMARINESTATESWEAPONBRAVERYBULLETSCOUNTRYCOURAGEFREEDOMPROTECTTRIBUTEVETERANVICTORYVIETNAMINFANTRYMEMORIALMILITARYREMEMBERSOLDIERSAMERICANSPATRIOTICSACRIFICE

Key Terms Chapter 19 2023-04-19

18 Items: cavitiessweatingfaintingbad breathwaxy substanceturn white or paleOily, waxy surfaceouter layer of skinarea that feels hardblack necrotic tissueglands that produce sebuminner, thicker layer of skinmain determinant of skin colorincrease of severity or symptomsproper care of skin, hair, teeth, and nailsblood rushing to place of decreased circulation...

Capital cities of the world 2026-01-06

10 Items: Capital of JapanCapital of ItalyCapital of KoreaCapital of VietnamCapital of AustraliaThe capital of FranceThe capital of Russia is___?Athens is the capital of ___?New Delhi is the capital of___?What is the capital of Singapore?

Magnetism and Matter Topic Tree Key words 2025-08-24

25 Items: bar-magnetcuries-lawangle-of-dipdiamagnetismgausss-law-inparamagnetismmagnetic-fieldneutral-pointsferromagnetismelectromagnetsmagnetic-dipolepotential-energyearths-magnetismpermanent-magnetsaxis-of-a-bar-magnetearths-magnetic-axisangle-of-inclinationforce-on-a-bar-magnetuniform-magnetic-fieldtorque-on-a-bar-magnetsolenoid-as-bar-magnet...

Snack Word Search 2026-09-08

20 Items: The direction opposite westA tool that shows directionsTo go from one place to anotherAn exciting experience or journeyThe opposite direction from southA natural stream of flowing waterThe place you are traveling towardSomething you buy to remember a placeTo look around and discover a new placeA place travelers stop when nature calls...

Gerrie 2025-12-15

16 Items: Your NFL TeamYour last nameYouur bosses nameYour husbands nameYou wear these to seeFriend that plays golfthe color of your hairFriend that likes DisneyThe company you work forYour husband had this jobFriend that plays poly hockeyYou celebrate this holiday in DecemberWe went to this city in Florida in 2024We played this activity at Hinkle Fun Center...

Think Word Search 2025-05-28

20 Items: mindsoulfulllovehappyplacecheckrisesvibesheartmattergentlybrightupliftbalancemindfulinspireradiatebelievegot this

WORD SEARCH (ADULTS) 2025-01-25

26 Items: AISHARAMADANABDMANAFNABIADAMJABALTHAWRIMAMAHMADBINHANBALOne of the Prophet's favourite fruits.The most authentic compilation of Hadith.The most mentioned Prophet in the Holy Qur'an.One of the beloved daughters of the Prophet s.a.w.The only Companion mentioned by name in the Holy Qur’an.This Companion was the amongst the ten promised paradise....

Medical terminology roots, suffixs and prefixs 2026-05-15

21 Items: slowskinfastpainheartbloodnervejointdiseasestomachdiseasediffucltstudy ofsurgicalexcessivedecreasedinflmationcutting intoGives the basic meaning of a terma group of letteres or a letter before a worda letter or a group of letters at the end of a word

Module 16 Vocabulary 2026-04-08

15 Items: The capital of ChinaA thin, beautiful type of potteryA body of unelected government officialsThe capital of China during the Qin dynastyThe capital of China under the Song dynastyA mixture of powders used in guns and explosivesA policy of avoiding contact with other countriesA device that measures the strength of earthquakes...

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Universe Word Search 2023-11-27

26 Items: wayvoidtimecometyearsaliendwarfastralsystemapollocosmicmattershuttleuniversegalacticgalaxiesredshiftcentauricentauriandromedasatellitessupergiantouterspaceinterstellarconstellationextraterrestrial

The ABCs of 5th Grade Science 2026-05-05

32 Items: PreyJouleTraitXylemYieldBioticMatterOpaqueQuartzVolumeAbioticGravityHabitatLearnedConsumerFunctionInstinctPredatorUniverseEcosystemFoodChainRenewableStructureZoologistDepositionReflectionRefractionWeatheringSedimentaryTransparentNonrenewableKineticEnergy

Lesson 3. Heal the World 2026-05-08

32 Items: furbathfeedlandmesspacksitespotteenvotewingblindbrushgreetmatterremoveselectslowlyaddressarrangeclearlydeliverelderlymanagervillagedonationpolitelyrecordingrewardingvolunteerbackgroundneighborhood

Homestuck Characters (+SBaHJ) 2025-04-28

81 Items: JohnDaveRoseJadeJaneDirkRoxyJakeAradiaTavrosSolluxKarkatNepetaKanayaTereziVriskaEquiusGamzeeEridanFeferiLilCalGeromyDadBertCalliopeCalibornSweetBroThe MayorHellaJeffMomLalondeBroStriderSpadeSlickClubsDeuceErisolspriteHeartsBoxcarThe cue ballGrandpaHarleyDiamondsDroogParcel MistressAimlessRenegadeColonelSassacreTavros' ancestorEquius' ancestor...

what's the matter 2026-03-27

8 Items: cutcoldcoughearacheheadachetummyachetoothachesorethroat

Where I want to go 2023-06-13

16 Items: WatTowerMahalFallsPicchuCanyonof Gizacolosseumof Athensof LibertyOpera Housethe RedeemerBarrier ReefWall of ChinaNational ParkNational Park

Inca and Maya Conflict Project 2022-09-20

15 Items: A female deity.Gods of the wild.We walk or dive on.Science of farming.An event of circumstance.A period of a hundred years.All visible future of an area.Person who designs a building.Largest continental mountain range.Widespread occurrence of a disease.The create and ruler of the universe.A condition of having too many people....

Integumentary system 2024-09-09

20 Items: skin turns bluefancy word for oilanother word for hairthe A in the ABCD ruleregulates body temperaturearrector pili muscle functionfunction of lamellular granulesproduces the pigment of our skinthe inability to produce melanina part of the integumentary systemthis degree is a full thickness burnlocated at the base of hair follicle...

Cycle 1 S2 Week 10 2025-04-16

11 Items: the distance around the outside of a shapeHaving more than one possible meaning; uncleara factor of a number that is also a prime numbermatter that has come from a recently living organismThe amount of money required to pay for the basic thingsNerve cells that carry electrical messages around your body...

CCES Wisers Extended 2023-02-22

15 Items: parademinifairfielddemoboardgamesartcontestthewitnesssportsgamesName of your schooltheme for this yeargroup _____ of Todaygroup ____ of TomorrowBarangay of your schoolgroup _____ of Yesterdaybeing celebrated right nowWhat you call the students who goes to your school

HISTORICAL FIGURES (VERY COOL 🗣️🔥🔥🔥🔥) 2023-11-24

14 Items: French empireQueen of EgyptKing of FranceEmpress of RussiaQueen of ScotlandKaiser of PrussiaItalian noblewomenA Indian philosopherThe longest processdorEmperor of Maurya DynastyEmperor of the Mongolia empireThe greatest military commanderRole in the political and religiousKnown for creating the largest empires

Radiation Units of Measurement 2024-11-03

14 Items: Commonly usedRoentgen equivalent man“radiation absorbed dose”Internationally recognizedThe SI unit for radioactivityThe SI unit of electric chargeNamed after “Father of Radiation Protection”The release of ionizing radiation from a substanceThe quantity of energy that is absorbed by an object or person...

Skin Word Search 2024-09-09

20 Items: bruiseproduces keratinred color to skinlack of blood supplyproduct of oil glandprogrammed cell deathfancy word for earwaxpale color to the skinanother word for cuticlethe largest organ of our bodyactive infection of oil glandsusually caused by liver diseasedetermines the color of our hairthis sweat gland offset is puberty...

Absolute Word Search 2026-05-19

45 Items: suitable for growing cropsthe use of goods and servicesa serious disagreement or argumentan English-speaking resident of Quebeca good or service sold to another countryrain: rain mixed with pollutants in the aira good or service bought from another countrymoney that is earned from work or investmentsa climate that is dry with very little rainfall...

Chapter 10-3/5 Vocab 2023-05-17

25 Items: anarchistto fight againstto support publiclya type of dried meatan enclosure for animalsto refuse to allow; to forbida sled pulled by a dog or horseshare of a corporation's profitreplacement for a striking workerto tell about something that happeneda share of ownership in a corporationa shortage, lack, or insufficient supply...

Culture Word Search 2023-11-07

23 Items: - Belief in one God- Belief in many gods- growth to a global or worldwide scale- gender roles that are less restrictive- A restriction on behavior imposed by social custom.- the physical things created by members of a society- Central to a society and it helps to compare societies- the visible imprint of human activity on the landscape...

Foundation Word Search 2022-09-15

25 Items: an opening made in the wallthe lowest part of the buildingtriangular upper part of a walllowermost part of a window framea structure which combined with lintelthe horizontal upper portion of a stepa guard rail to give grasp to the handan isolated vertical load bearing memberwhere two of roofs surface meet together...

Anatomy & Physiology: J / K / Q / U 2026-02-12

20 Items: The savory senseAnalysis of urine to diagnose diseaseIncrease in the number of hormone receptorsBone located on the medial side of the forearmGranulated protein found in the stratum granulosumGeneral sensory perception of movement of the bodyType of scar that has layers raised above the skin surface...

Beginning of Moses 2025-11-14

26 Items: SeaBushVeilRiverSinaiTorahAaronLeaderSaviorCanaanMiriamProphetPlaguesPharaohLawgiverMediatorof EgyptCovenantof StonePassoverDaughterDecalogueWildernessof the SeaIsraelitesCommandments

Mesopotamian myth 2022-12-14

15 Items: The god of the moon (Sumerian).The Sumerian goddess of fertility.She was goddess of love and war (Assyrian).The god of air, wind, and storms (Sumerian).The Sumerian goddess of fermenting, brewing, and ale.The Sumerian mother goddess of mountains and nurturing.The goddess of the sea; drawn as a huge dragon (Babylonian)....

Askiathegreat Word Search 2024-10-04

29 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthagegreat early church fathers and martyrs from Carthage...

Animals of the World 2024-09-15

15 Items: The largest animal on Earth, found in all oceans.A long-living reptile found in the Galápagos Islands.The largest land animal, known for its long trunk and tusks.The largest primate, native to the forests of central Africa.This bird of prey is the national symbol of the United States.A large, herbivorous mammal with one or two horns on its nose....

Famous art galleries 2026-05-14

18 Items: MuseumModernBilbaoCenterMuseumMuseumsMuseumsd'OrsayGalleryPompidoudel PradoRijksmuseumof Modern ArtGallery of ArtNational MuseumHermitage MuseumInstitute of ChicagoMetropolitan Museum of Art

Stewardship and Storms 2025-10-21

18 Items: rainSmogFuelsOzonegasesmatterEventseffectdioxidemethanePollutionAtmosphereStewardshipStratosphereThermosphereQuality Indexclimate warmingProtection Agency

Norse Mythology 2026-02-27

23 Items: AsgardMidgardHelheimAlfheimVanaheimNiflheimJotunheimFire GiantMusphelheimCorpse EaterSvartalfheimThor's HammerRainbow BridgeGods of AsgardGods of VanaheimThe World SerpentOlder Son of ThorWatcher of AsgardYounger Son of ThorBlow to Signal RagnarokThing used to kill BaldrHis death started Ragnarok3 year precursor to Ragnarok

Shaping Earth's Surface 2025-09-25

20 Items: Melted rock found beneath Earth’s surface.A plate boundary where two plates move apart.A small tectonic plate located near Indonesia.A mountain formed when magma, ash, and gases erupt.A measure of the energy released during an earthquake.A small tectonic plate in Southeast Asia, near Myanmar.An ancient mountain range in the eastern United States....

Korach 2024-06-30

15 Items: â€śKorach”“joining”Hebrew for “to join”Hebrew word for staffthe father of MethuselahThe land of Milk and HoneySatan’s final destiny 3wordsKorach root means __ _____ _____.severe criticism or harsh scolding.“The prince of the power of the air”the biblical name for the place of the dead.Hebrew: to guard, protect, keep, watch, preserve...

Africa Geography Word Search by Katlego Pekenya ST10207233 Group 1 TISS7412 2025-11-06

29 Items: The ocean found to the south of Africa.A country that borders the sea or ocean.The ocean that lies to the west of Africa.The ocean that lies to the east of Africa.The edge of the land where it meets the sea.A nation with its own government and borders.A very large landmass made up of many countries.A small landmass completely surrounded by water....

Science Puzzle 2026-07-29

37 Items: SI unit of force.Capacity to do work.Combining capacity of an atom.Smallest packet of light energy.Bond formed by sharing electrons.Turning effect produced by a force.Process involving loss of electrons.Process involving gain of electrons.Device used to store electric charge.Related to magnets or magnetic fields....

US Cities 2025-10-07

22 Items: Big DBeantownSin CityMusic CityWindy CityEmerald CityThe Big EasyLittle HavanaThe Big ApplePeachtree CityMile High CityCity of AngelsWestern Twin CityValley of the SunSite of the AlamoThe City BeautifulGateway to the WestThe City by the BayThe Nation's CapitalCity of Brotherly LoveBirthplace of CaliforniaCrossroads of the Pacific

Gallon Word Search 2025-10-20

6 Items: a unit of temperaturesomething is to keep it from ocurring.imperial unit of volume equal to 128 fluid ounces or about 3.78 liters.any kind of harmful foreign matter in a substance such as air or water.an imaginary line that circles the globe and is esquidistant from both poles....

Greek Gods 2026-09-14

10 Items: Messenger of godsthe goddess of wisdomruler of the underworldgod of fire and blacksmithingThe King of gods and god of lightningGod of the sea earthquakes and horsesqueen of gods and goddess of marriagethe Olympian goddess of the harvest and agriculture, presiding over crops, grains, food, and the fertility of the earth....

Wind Word Search 2026-04-15

5 Items: GASHEATSOLIDLIQUIDMATTER

Storey Word Search 2023-02-20

25 Items: the vertical surface of the staira room or a space directly unfder the roofthe lower square slab at the base of a columna continuous vertical brick or stone structurethe lower surface of a room on which one may walkthe provision of fresh air to a room, building, etc.a window that projects vertically from a sloping roof...

twist on vocabulary word search 2023-04-18

36 Items: The distance above sea levelthe transfer of heat by fluida tool that measures wind speeda device that measures temperaturethe flow of air from land to waterwinds that blow steadily over longThe lower layer of the thermosphereThe upper layer of the thermospherewinds that blow over short distancesThe middle layer of earths atmosphere...