states of matter Word Searches

Principles of Government 2017-04-21

19 Items: PollsSystemPowersBranchGlobalVotingSenateRightsFederalCitizenJudicialCongressExecutiveSeparationParliamentLegislativeCitizenshipRepresentativesResponsibilities

History of Healthcare 2020-01-30

19 Items: DarkAgesMiddleAgesRobertKochHippocratesRenaissanceClaraBartonAncientTimesMichelangeloApothecariesEdwardJennerJosephListerLouisPasteurWilliamHarveyLeonardoDaVinciBenjaminFranklinGabrielFahrenheitElizabethBlackwellAntonVanLeeuwenhoekFloranceNightingale

Town of Salem 2020-10-26

19 Items: SpyTownRoleHungMafiaWitchCovenClaimJailorJesterDoctorMediumMafiosoSherrifLookoutArsonistAttackedInvestigatorSerialKiller

City of Ember 2021-04-19

19 Items: linaorlyboatemberpoppyclarymurdomayornammyriverlooperlizzievindiegrannyfleerycandlelightspipeworksmessenger

Gulf of Mexico 2021-05-28

19 Items: redseaGulfJessTexasHotubMexicoAlonsosnapperturtlesAlabamaFloridacurrentJeffreyDespairfounderAlwarezLouisianaMississippi

Types of animals 2023-05-08

19 Items: frogswanbirdswhalesnakesharkeaglefisheslizardpigeonmammalsdolphinpiranhareptilescapybaraseahorsecrocodileamphibianssalamander

Throne of Glass 2024-04-17

19 Items: cainelenagraveerileanehemiaadarlankaltaindamarisnoxowenassassinendovierridderakwyrdmarksarobynnhamelchaolwestfallkingschampiondukeperringtondorianhavilliardcelaenasardothien

COORDINATION OF BENEFITS 2024-08-23

20 Items: PCPCOBPPOHMOTPLEOBBASICOHIAAOHIPDOHIAATRICAREMEDICAIDMEDICARECLAIMFORMINSURANCECAPITATIONPREFERREDPROVIDERPROVIDERREMITTANCEWORKERSCOMPENSATIONSUPPLEMENTALINSURANCE

Henrietta Elizabeth Bromwell 2023-05-17

17 Items: ArtjulybooksnettieSisterartistauthordenverMuseumillnesshistorybromwellCemeteryillinoiscoloradohenriettaof Denver

Counties in Ireland 2023-11-29

7 Items: The capital of IrelandHas the Cliffs of MoherHome to the Munster Rugby TeamThe smallest county in IrelandHas the highest mountain in IrelandHas the most southerly point in IrelandA county in the north of the country that is not part of Northern Ireland

Musical Theater 2024-02-20

7 Items: Amount of broadway theatersA musical with over 12,000 playsModern version of the Wizard of OzMany songs from musicals become ____A play where music is important to the storyAmount of broadway shows per week in a theaterMusical about someone auditioning for a musical

Exploring Ethics 2016-12-11

14 Items: ethicspiracycitingfair-usesnoopingcopyrighttrademarkpermissionplagiarismTerms-of-Usefile-sharingpublic-domaincyberbullyingintellectual-property

Word Search 2024-06-13

15 Items: sampleunexpectedlya part of a seriesfast/ at high speedto a very great degreein an extremely hungry waythe quality of being honesthappening because of good luckin a way that was not expectedsuggests or resembles a miracle.an animal that feeds on other animalsa place where a plant or an animal livein a way that is difficult to understand...

Teens & Taxes 2024-10-16

15 Items: StateIncomeMedicareWithholdingAmount you make per yearWho sends you your w-2 formDeductions are listed on thisAmount of money made per hourAn example of a tax is social ______Amount of time you are being paid forYou use a w-2 form to file a tax ______You receive your w-2 form once every _______Federal, State, and Social Security are examples...

Exploring Ethics 2016-12-11

14 Items: ethicspiracycitingfair-usesnoopingcopyrighttrademarkpermissionplagiarismTerms-of-Usefile-sharingpublic-domaincyberbullyingintellectual-property

2023-2024 2023-09-07

15 Items: rymoneyValueCharts(Basic)graphingpercentsroundingCountingperimetermeasurementprobabilitysubtraction(Multi-Digit)of Operations

Shabbos 2024-07-18

19 Items: fishholysoupwinekugelsevenfamilyparshacandleschallahchickencholentOF RESTkiddushshabboshavdalahspiritualFROM HASHEMNINE MELACHOS

TOPIC 2: Civilizations of the Fertile Crescent 2023-02-08

16 Items: Codearmytraitempireof lawimportexportcolonytributeirrigatealphabetzigguratscuneiformdiffusioncity-statepolytheism

Australian parliamentary system 2024-06-06

15 Items: senatemonarchcabinetministerdemocracydemocracyjudiciaryexecutiveparliamentfederationreferendumconstitutioncommonwealthgovernor-generalof Representatives

Tay Word Search 2024-08-16

15 Items: RoadCityRoseJuneGarethCyprusCruiseRebeccaAnthonyand DipBrambleGuinnessSeptemberNewcastleof Bradgate

6A 2024-10-16

22 Items: rugbedlampwalluglysamelargesmallmirrorprettybedroomcurtainspaintingimportanttelevision setown, one’s ownnight/end tableshelf, bookshelfto the right (of)closet or wardrobeclock (alarm clock)dresser or chest of drawers

ELC 4 wordsearch 2023-09-25

15 Items: only one type of atomused to separate solids and liquidsname for water that is safe to drinkused to seperate solutes from the liquidused to separate smaller particles from watertwo or more substances not chemically combinedmolecule made of only hydrogen and carbon atomslarge particles settling to the bottom of water...

Young Avengers V1 2024-10-13

8 Items: SpeedWiccanHulklingKate BishopCassie LangEli BradleyFounder of the young avengersthe original number of young avengers

Chapter 8: Social Stratification: United States and Global  2016-05-18

25 Items: powerwealthprestigeunderclassbourgeoisielifechancesmeritocracypovertylineproletariatsocialclassworkingpoorsocialmobilityabsolutepovertyrelativepovertycorporatewelfareverticalmobilityDavis–Moorethesishorizontalmobilitysocioeconomicstatussocialstratificationfeminizationofpovertyopenstratificationsystemintergenerationalmobility...

Chapter 8: Social Stratification: United States and Global 2016-05-18

25 Items: powerwealthprestigeunderclassbourgeoisielifechancesmeritocracypovertylineproletariatsocialclassworkingpoorsocialmobilityabsolutepovertyrelativepovertycorporatewelfareverticalmobilityDavis–Moorethesishorizontalmobilitysocioeconomicstatussocialstratificationfeminizationofpovertyopenstratificationsystemintergenerationalmobility...

Higgins Weekly -Guess The Words! 2023-05-01

18 Items: EggJazzFlat fishShake a cowLot of keysIt's a TriangleThe BEST cookieA Cheesy delight!The Hardest Math ClassA great breakfast foodA two fish constellationGreat for making potteryAn evolved form of shearsBig disk that hit with hammerStupidly hard to spell instrumentAn american-version of buttercreamAnother Stupidly hard to spell instrument...

Shaytaan Word Search 2024-03-30

9 Items: "Risalat""Tasbeeh""Shaytaan""Creation"Our GuidebookIslamic Doctrine3rd Pillar of IslamHands And Feet Will TestifyExamples Of The Aad and Thamud

harry potter 2020-09-01

28 Items: ofofwandDeatheatermagicalleymanorBlackDobbywinkydiagonMalfoymalfoyPotterWesleycrouchchamberAzkabanPrewittministryseacretsHogwartsHogsmedeslughornKreatureLestrangeGreengrass

Classic Films 2024-02-25

22 Items: etjawspsychomatrixvertigotitanicGodfathercasablancacitizenkanepulpfictionforrestgumpspaceodysseyjurassicparkof the Lambsthewizardofozschindlerslistgonewiththewindsinginintherainsunsetboulevardlawrenceofarabiabreakfastattiffanysshawshankredemption

Porcini Word Search 2024-06-27

20 Items: EarManemorelenokioysterreishiporcinicreminiTrumpetlobstermaitaketruffleshiitakehedgehogshiimejipuffballmatsutakeportobellochanterelleof the Woods

Ancient Greece Timeline 2023-01-25

15 Items: academy 386 BCE: Plato establishes this school.776 BCE: The first of these takes place to honor Zeus.431 BCE: These wars, between Athens and Sparta, begin.432 BCE: This temple to the goddess Athena was completed.323 BCE: This period begins after the death of Alexander the Great.490 BCE: The Greeks battle this Middle Eastern group for independence....

Ancient Greece Timeline 2023-01-25

15 Items: 386 BCE: Plato establishes this school.776 BCE: The first of these takes place to honor Zeus.431 BCE: These wars, between Athens and Sparta, begin.432 BCE: This temple to the goddess Athena was completed.323 BCE: This period begins after the death of Alexander the Great.490 BCE: The Greeks battle this Middle Eastern group for independence....

Infinity and beyond 2024-07-18

10 Items: claysunnyfathomScarletskywingof EvilalbatrossclearsightDarkstalkerquicksilver

Infinity and beyond 2024-07-18

10 Items: claysunnyfathomScarletskywingof EvilalbatrossclearsightDarkstalkerquicksilver

Tertiaryeducation Word Search 2023-07-12

12 Items: fencebookwormDiciplineis go crazySkipp lessonsHas five cornersHas four cornerssynonym of stupidIn relaxed mannersynonym of higher educationSpiritually commune with deadPlace for living for students

Cat Word Search 2024-01-04

10 Items: Counted among the most dangerous of all animals (Isaiah 11:8)The practice of this is condemned in the Bible (Deuteronomy 18:10)Malchus lost one when Peter struck him with his sword (John 18:10)The greatest one of all human history takes place at Har–Magedon (Revelation 16:14, 16)...

Muscles 2024-09-19

14 Items: The starting point of the muscleWhere the muscle inserts on the boneThick fleshy central part of the muscleJunction between the nerve fibre and the muscleConnective tissue sac filled with synovial fluidChemical that transmits the impulse across the gapWhen a muscle is used or exercised and becomes bigger...

lawsons word serch 2023-12-18

18 Items: study of spacea pattern of starsa small icey objectlooks like a big bearalso known as ursa majoralso known as ursa minora galaxy that we live inlooks like a little bearthe study of constalationssomeone who gos in to spacea rock that tuches the grownda rock is in earths atmospherea huge object that has a orbitthe same size a a dust particle...

SOBRIQUETS OF PLACES OF THE WORLD 2020-02-28

15 Items: FRISCOBLIGHTYSINCITYBEANTOWNWINDYCITYEMPIRECITYTINSELTOWNQUAKERCITYLANDOFCAKESLANDOFMARBLELANDOFLILIESCHOCOLATECITYLANDOFKANGAROOROOFOFTHEWORLDPORTOFFIVESEAS

One Word Search 2024-03-15

18 Items: What is her favourite food to eat?What is Stacey’s favourite colour?What is her favourite sport to watch?What is her favourite alcoholic drink?How many car accidents has she been in?On what day of the week was Stacey born?What is Stacey’s favourite sport to play?What beverage will she not willingly drink?...

judaism 2024-08-12

20 Items: TorahSederRabbiHesedTorahKippahKosherTallitKippurSukkotShabbatMitzvahMenorahMitzvahMitzvahKaddishChanukahTefillinof DavidHashanah

Professorfaber Word Search 2022-08-19

15 Items: sieveFaber calls himself this."That Favorite Subject, ______"The two-way radio invented by Faber.Mildred and her friends watch this on the walls.This was waiting outside Guy and Mildred's home.Faber believes people do not have enough of this.The poem that Guy reads to Mildred and her friends.Book that Montag starts ripping up in front of Faber....

f 451 2 2022-12-14

15 Items: sandFaber calls himself this."That Favorite Subject, ______"The two-way radio invented by Faber.and her friends watch this on the walls.This was waiting outside Guy and Mildred's home.Faber believes people do not have enough of this.The poem that guy reads to Mildred and her friends.Book that Montag starts ripping up in front of Faber....

Kiley's word search 2024-05-21

15 Items: soft tissueconnects bone to boneconnects bone to muscleLargest artery in the bodyforms the skeleton of headknown as the 'common shoulder muscle'Inner organ for the circulation of bloodblood vessels located throughout your bodydistribute oxygen-rich blood to your body.transport materials throughout the human body...

Ultimate Frisbee 2023-09-20

8 Items: pulldisccatchpivotdefenseturnoverreceivingin-of-bounds

Revolutions, Nationalism, and Unification Extra Credit 2022-12-08

22 Items: peruitalychilegermayargentinaPride in ones countryCommanded the Red Shirts"Brains" of Italian Unificationcountry named after Simon BolivarLiberated: Argentina, Chile & Perucolonizer country of Latin AmericaRegion colonized by Spain and PortugalItaly and Germany were created throughUsing war or military force to unit Germany...

Brady and Meghan 2024-05-06

30 Items: City they met inBrady's Best ManMeghan's home stateFirst Date locationMother of the GroomMother of the BrideCouple's dog's nameCouple's cat's nameBrady's middle nameMonth Brady proposedMeghan's middle nameBrady's college townWhere Brady proposedHoneymoon destinationDating app they met onBrady's birthday monthFavorite movie theatre...

Vocabulary 2023-09-22

7 Items: Perspective-Noun; Point of viewNotable-Adjective; Worthy of attentionToxic-Adjective; Poisonous; destructiveBalderdash-Noun; Senseless talk or writingContradict-Verb; Asserting the opposite of the truthDialogue-Noun; A conversation between two or more peopleConsequence-Noun; A result or effect of an action or condition

Ethans Spelling Word Search 2023-04-05

35 Items: lukejohnmusclesprintfitnesswarm-upstadiumworkoutathletehandballmuscularolympicsexerciseequipmenttreadmillgymnasiumstopwatchgymnasticsracquetballperspirationcoordinationcalisthenicscross-countryweighttrainingstationarybikea long race or contesthaving to do with the heart and blood vesselsthe power to stand something without giving out...

20 of my most challenging words form 2023 2023-12-06

20 Items: to be givena reverse movementnot alined proplelyan expert in scientsto be full of glamoura person who fixs teethto be scade of somethinga rainforest in queanslandto let someone do somethingbefore what has just happenda animal that lives in africaa animal that lives in the seafuels a fuel made out of fossilsto see something that is obviose...

Policy Library 2024-10-07

9 Items: WorkLeaveEmergencyWorkspaceOf ConductHarassmentTimekeepingAntiBriberyConfidentiality

Network Admin - Valentine's Day 2024 2024-02-14

14 Items: three-headed dog of HadesThe earlier version of RADIUSKerberos term for the client/userPrivate Key scheme which uses a 56-bit keyThe gibberish produce by encrypting a messageThe type of encryption also known as public keyThe type of encryption also known as private keyPublic key scheme used in to protect web traffic...

Andreakia's Food Web Word Search 2024-09-04

10 Items: omnivoreautotrophherbivoretop predator/carnivorebreaks down dead organic matterConsumers who get their energy by eating other organismswhere less energy is transferred to the next level (only 10%)producers that capture energy from the sun and use it to make their own food...

Key Features for Waves 2024-01-07

10 Items: phaseequilibriumKey Feature 1Key Feature 2Key Feature 3Key Feature 4Key Feature 5Key Feature 6Type of Wave 1Type of Wave 2

Imperalism 2015-05-19

25 Items: ofrawnewtheTsavowealthmedicalmilitaryimperialtransferretardedmaterialsconflictsinvestmentman-eaterssuperioritycompetitiondevelopmentimprovementsadvancementsphilosificalopportunitiesjustificationtransportationinterdependence

Mr & Mrs Hopkins 2024-08-02

24 Items: lovecakeleonjackbibleringsconorchurchushersfamilyweddingbestmansydwellhopkinsfriendshusbandmarriagemarriagenewlywedshappinessof honourflowergirlringbearerbridesmaids

Polynesian panthers 2024-10-14

9 Items: who ended dawn raidswhat did the Polynesian panthers facewho influenced the Polynesian pantherswhat was the purpose of the dawn raidswhat event was the Polynesian panthers inwhat was the main goal of Polynesian pantherswho was the leader of the Polynesian pantherswhat did the Polynesian panthers do foe the community...

שמואל ב פרק ג 2024-02-13

28 Items: Dovid's 1st born son (2)Avner held this positionThis many people never sinnedYoav sent these to Avner (26)Dovid refused to do this (35)Avner killed his brother, AsahelYoav stabbed Avner in the __ ribHow many ways did Dovid curse Yoav?Dovid walked behind Avner's __ (31)Son of Shaul; supported by Avner (6)Which tribe did Avner speak to? (20)...

Social studies vocabulary 2022-06-14

12 Items: globecolonyimporttacticIndiansPassageartifactindustrypatriotsmigrationjamestownof exploration

Social studies vocabulary 2022-06-14

12 Items: globecolonyimporttacticIndiansPassageartifactindustrypatriotsmigrationjamestownof exploration

Social studies vocabulary 2022-06-14

12 Items: globecolonyimporttacticIndiansPassageartifactindustrypatriotsmigrationjamestownof exploration

1920s Crossword 2022-10-20

8 Items: Religion vs. EvolutionIllegal traffic in liquorWomen in the 1920s who wore skirtsContributed to the understanding of evolutionCultural revival of african-american music and artAmerican Gangster who was famous during the Prohibitiontransportation production and consumtion of alcohol now legal...

ELA7 Review 4: Word Find of the Day (Q1 Cumulative) 2023-10-24

18 Items: to have ambitionto rejoice greatlyto make more noticeablevery strange or unusualan official ban on traderepetition of the same soundsnoisy, energetic, and cheerfula comparison between two thingsa curve in the shape of an ovalthe scientific study of languageto deceive by elaborate trickerya mistaken belief; a false notion...

lawsons word serch 2023-12-18

18 Items: study of spacea pattern of starsa small icey objectlooks like a big bearalso known as ursa majoralso known as ursa minora galaxy that we live inlooks like a little bearthe study of constalationssomeone who gos in to spacea rock that tuches the grownda rock is in earths atmospherea huge object that has a orbitthe same size a a dust particle...

Fussilat 2024-03-30

9 Items: "Risalat""Tasbeeh""Shaytaan""Creation"Our GuidebookIslamic Doctrine3rd Pillar of IslamHands And Feet Will TestifyExamples Of The Aad and Thamud

norse mythology 2023-01-18

15 Items: Many slain in battle will end up here.The Nine Realms all cling to this ash tree.The day Tuesday is named after this Norse God.After the Ragnarok cataclysm, these two re-populated the world.This monstrous wolf and problem for the gods is somehow Loki's offspring.We know so much about Norse Mythology because of the writings of this man....

herd of hounds 2022-07-25

18 Items: greyhoundotterhoundbloodhoundafghanhoundibizanhoundbassethoundazawakhhoundpharaohhoundirishwolfhoundgreekharehoundsilkenwindhoundenglishfoxhounditaliangreyhoundredbonecoonhoundbluetickcoonhoundscottishdeerhoundnorwegianelkhoundblackandtancoonhound

Evidence of Evolution 2023-02-10

18 Items: dnatimedarwinfossilsmelaninevidencemutationevolutiongeographycladogramanalogousvestigialanatomicalembryologyhomologousadaptationenvironmentcommonancestor

ANIMALS OF AFRICA 2023-05-07

18 Items: foxliontopizebrababoonimpalajackalcheetahgiraffewarthogaardvarkelephantmongooseporcupinerhinoceroswildebeesthippopotamusklipspringer

Fourth of July 2023-06-22

18 Items: redbluejulystarswhiteparadesummeramericafreedomhotdogslibertystripesbarbecuefireworkspatrioticsparklersdeclarationindependence

Thermal Energy 2023-11-08

6 Items: the energy for heatanother word for heatthe rising and falling of thermal energytransfer of heat through electromagnetic wavesthe direct transfer of heat through atoms movingthe unit of degrees that measure the degrees in something

Julia's sky science word search 2023-12-18

20 Items: we live on onelight bounces off ita rock covered in icethe galaxy we live onpeople who go to spacealso called ursa majoralso called ursa minorthe study of the planetsa rock floating in spacealso called the big dipperstars arranged in a patternalso called a shooting staralso called the little dippera lot of solar systems together...

Astronmy Word Search 2023-12-18

11 Items: the study of zodiacthe study of the universesomthing that creats lighta person how works in spacesomthing that reflects lighta consellation know a ursa majora consellation kown as ursa minora bunch of stars creating a picturea ball of ice and dust that orbits the suna day twice a when the suns exaty abobe the eqator...

I Am the Mountain 2023-12-13

6 Items: to think deeply about somethinga tall mountain with a pointed or narrow topa high, steep surface of rock, earth, or icea very large mass of ice that moves very slowlya state of having a lot of knowledge and wisdomthe spiritual, mental and emotional part of humans

Explorers of Texas 2014-09-19

19 Items: NewEastReneTexasTiguaTexasCanadaCortezMarcosAlvarezVasquezEuropeanColumbusCoronadoMatagordaKarankawaAmericansMississippiConquistador

Effects of Imperialism  2014-11-03

19 Items: newrulecashcropscropspowersglobalwesterncultureEuropeanresistedculturalimperialeducationchallengesimperialisttraditionalnationalistindustrialized

4th Of July 2016-05-13

18 Items: redfundayblueproudhappypeoplefamilyhotdogsAmericanbaseballbarbequecarnivalfireworkshonorablehistoricalcelebrationIndependence

Elements of Fiction 2022-09-12

18 Items: lead character of the storythe sequence of events in a storycharacter stays the same with no changeenemy or opposition of the main charactera struggle or central problem in the storycharacter vs. a fight against other peopleperson; told by the protagonist - I, me, mycharacter changes due to evens in the story...

Symptoms of stress 2023-03-14

18 Items: edgyupsetangrylividscaredguiltysnappypanickyanxiousinsomniaconfusedsweatingirritableheadachesresentfuldefeatistfrightenedrunningaway

Vicar of Dibley 2023-10-17

18 Items: jimowenhugoalicedavidfrankcomedypuddlesvillagetvseriesgeraldinechocolatemrscropleydawnfrencheasterbunnyvicarofdibleychristmaslunchcommitteemeeting

Constructive & Destructive Forces 2024-01-23

14 Items: Wide, flat areaLiquid, molten rockMound or ridge of sandDeep crack in the Earth's crustSudden movement of Earth's crust.A deep valley with high, steep sidesA physical feature on Earth's surfaceLand that rises high above the groundMass of land that forms at the mouth of a riverOpening in Earth's crust where magma can rise up...

30 most famous landmarks around the world 2024-02-07

30 Items: BenFujiWallTowerMahalTowerGüellLouvreSquarePicchuSquarePalaceKhalifaAl ArabalhambraLong BayFountainMountaincolosseumborobudurof Libertyde TriompheOpera Housethe RedeemerWall of Chinaoeur BasilicaState BuildingDame CathedralPeters BasilicaSagrada Familia

Around Town 2022-11-10

10 Items: bankbelowmarketcentrebehindbesidestationlibraryoppositefront of

005 2023-03-08

10 Items: hairnearcurlycleanlightlot ofeitherthe netparentssometimes

Jesus 2024-07-14

12 Items: IIIgodmarklukejohnjesusfaithSpiritmatthewgenesisLamb of God

Esthetician Vocabulary 102.02 2023-01-18

22 Items: safety data sheetHazzard communication standardenvironmental protection agencySodium Hypochlorite 5.25% ConcentrateDispose of items that can no longer be usedMethicillin-resistant Staphylococcus aureusUsually able to disinfect within 10 minutesoccupational health and safety administrationmaterial that allows liquid or air to pass through...

Addictionary Word Search 1 2023-08-08

10 Items: Not consuming the drug of choice during a specified period of time.An attribute, behavior, or condition that is socially discrediting.The use of punishment as a threat to deter people from committing offenses.A state in which one is not intoxicated or affected by the use of alcohol or drugs....

computer 2024-07-19

10 Items: A set of rules or steps followed to solve a problem or perform a task.Software intended to damage or disable computers and computer systems.A set of rules governing the format of data sent over a network or the internet.The process of converting information into a code to prevent unauthorized access....

Word Search Puzzle 2024-08-07

10 Items: One of the "3 As" of rural marketingThis analysis helps organizations identify their internal positives and Negitives.The additional satisfaction or benefit gained from consuming one more unit of a good or service.A Japanese term meaning "continuous improvement," focusing on incremental, ongoing improvements in processes....

Happy New Year 2023-12-14

17 Items: hatdroptimeyearsquaretuxedodancingholidaymidnightsparklercelebratechampagnecountdowngatheringnoisemakerresolutionof midnight

Word Test 0926 2023-09-25

10 Items: to come to an end; to bring sth to an enda member of the same team or group as yourselfto promise to do sth; to promise sth will happenshy, awkward or ashamed, especially in a social situationserious and often involving a lot of action in a short period of timethe study of the nature and meaning of the universe and of human life...

Blueback 2023-11-27

7 Items: abels mumbig blue fishguy resting under the treemain character of the moviethe main character of the bookthe main antagonist of the bookthe guy that gave abel his boat

color 2024-07-19

10 Items: A purplish-red color.A deep, rich red color.A vivid purplish-red colorA deep orange-yellow color.A deep and rich blue-purple color.A deep yellow or orange-brown color.A deep blue color like that of a clear sky.A yellow-green color like that of unripe fruit.A greenish-blue color like that of the gemstone....

1 2022-06-26

6 Items: heitofweohhis

Photosynthesis SC.8.L.18.1 2023-01-02

12 Items: An organism that makes its own foodEnergy stored in chemical bonds and released through chemical reactionsA colorless, odorless, tasteless liquid that living things need to surviveA gas produced by animals during respiration that plants use for photosynthesisA gas produced by plants during photosynthesis that animals use for respiration...

lawsons word serch 2023-12-18

18 Items: study of spacea pattern of starsa small icey objectlooks like a big bearalso known as ursa majoralso known as ursa minora galaxy that we live inlooks like a little bearthe study of constalationssomeone who gos in to spacea rock that tuches the grownda rock is in earths atmospherea huge object that has a orbitthe same size a a dust particle...

social studies Vocabulary 2022-06-14

13 Items: mesabillgranttreatyfeatureroanokeneutralmilitiaresourceoverseerconquistadorof explorationwithout representation

Prefix Suffix Root 2023-09-04

28 Items: suffix meaning without3 letter prefix meaning middleprefix that means too much or aboveprefix meaning not; used in nonsensesuffix meaning made of; used in woodenprefix meaning not; used in impossibleprefix meaning not; used in inattentiveprefix meaning not; used in uninterestedword part meaning water; used in hydrant...

BB9 04 2017-09-26

30 Items: OFNIVOLDNEWJOHNPOPEHOLYWRITKINGLATINROMANBIBLEPRESSGREEKISLESBIBLECHURCHJEROMEHEBREWTYNDALEVULGATEBRITISHENGLISHENGLISHENGLANDWYCLIFFEPRINTINGLANGUAGETESTAMENTTESTAMENT

BB 9 04 2017-09-26

30 Items: OFNIVOLDNEWJOHNPOPEHOLYWRITKINGROMANBIBLEPRESSLATINGREEKISLESBIBLECHURCHJEROMEHEBREWENGLISHTYNDALEVULGATEBRITISHENGLISHENGLANDWYCLIFFEPRINTINGLANGUAGETESTAMENTTESTAMENT