new year Word Searches

Toys 2025-05-30

25 Items: Large fluffy toys.A classic fidget toy.Where does Elmo live?First manga card game?Toy cars made since 1968Make a face on a vegetableNoughts and _______________A small doll in your kieszen.Has a new sister called Evie.A gun that shoots foam bullets.The best place to play Mario KartThis has 54 small coloured squares....

Galaxy Christmas Party 2025-12-16

74 Items: deanblockcoachcourtdrivejalenlayuppivotstealtysonassistcarterchargedeaniejaydenkainoapeytoncharliedefensedribbleinboundjabstepoffensereboundtimeoutbackdoorbaselinedeadballeurostepfadeawayhalftimehelpsideslamdunkturnoverbackboardbackcourtbreakawayfastbreakisolationperimetertravelingbasketballbouncepassdoubleteamoutletpasspointguardstrongside...

x 2023-02-03

191 Items: menasddsmmomdadsonhugpopseesawyouonetwokinnewoldfunaceawekeylabpepskyvexwaywhywhowrytoyslyspyorbactadohexeastwestalpsmaleboysadhdpureshutmemegoodfineauntcarenicekindloveaxispingpeekpokefeelfeltfaceseekwisegemsgoalminemindmorejustkindsingplaygamebossusedfreefunkheadopenwhennorthsouthbraingirlswomenloyaleagertruthplainquickshortreadyalertrulesblush...

Thin Word Search 2025-05-09

200 Items: newpieinnwaydiebayegothinbushsoakweardealmonkfacebiteplugselfcasequitmaskbellhelpsizeroofcropkillsavebombcarehangmovefearbarklovevainmazemildfroggaspfadesellmeatfearfoolsandwillglowstirtickfirsttradequeenplaceabuseshellswinggaffeslumpdancetermsgianttrainwoundbuildblamelearnsiegetwistdelayawarestriptiredsleepdeterqueueswipemanagepublicstrollnotion...

Assist Word Search 2025-12-16

74 Items: DEANBLOCKCOACHCOURTDRIVEJALENLAYUPPIVOTSTEALTYSONASSISTCARTERCHARGEDEANIEJAYDENKAINOAPEYTONCHARLIEDEFENSEDRIBBLEINBOUNDJABSTEPOFFENSEREBOUNDTIMEOUTBACKDOORBASELINEDEADBALLEUROSTEPFADEAWAYHALFTIMEHELPSIDESLAMDUNKTURNOVERBACKBOARDBACKCOURTBREAKAWAYFASTBREAKISOLATIONPERIMETERTRAVELINGBASKETBALLBOUNCEPASSDOUBLETEAMOUTLETPASSPOINTGUARDSTRONGSIDE...

Unit 2 2025-12-23

51 Items: (n) a thingvery or a lotliving, not deadbut, even thougha trip in a planefind something newwhat you talk aboutno sound; very quietbefore; up to a timethe planet we live onsomething that happensasleep to start sleepingbeing safe, not in dangerhappening now, right awaylike to seem like somethingwhen two people get married(somebody) know tell someone...

Week 8 Thursday 2023-10-06

25 Items: course of studyTo buy somethingMario's occupationWorthy of attentionwritten communicationto support with evidenceHappens at the same frequencyBelonging to a particular personFirst in the order of importancea math sentence with an equal signA number that is not a whole numbersharing an edge or boundary; touchingConvert waste into a reusable material...

Chapter 2 Review Word Search 2023-11-10

25 Items: to approveto prohibit tradeanother word for lawsHe wrote Common SenseFirst US Vice PresidentFather of the ConstitutionThe ____-fifths compromiseword for political disorder"no taxation without ________"___________ or Great CompromiseHe wrote the Declaration of IndependenceThe NJ Plan wanted these to hold the power...

Run It Back 2025-10-09

30 Items: Aka OJ.The metro.Worn by legs.Pancake maker.Cheese selector.ASH'S x ________Hola! in English.Hello! in Spanish.The capital of Spain.The opposite of walk.It's lonely at the top.A classic pancake topping._____________ to your cup!!How pancakes should be served.Bean juice that keeps you awake.Flies by when you're having fun....

Thanks Giving 2025 2025-11-19

188 Items: AteDayEatGodHamJamNapNewPieTexBakeBuckBunsCokeColdCookCornDeerDineDishFallFishFordGiftGiveHomeHugsKrisLeafLoveMealMeatOvenPansPotsSailSaltSnowTreeAaronAcornAppleBasteBeansBingoBreadCanoeCarveCiderCritzDavidEarthFeastGraceGravyLunchMacysMaizeMimziPecanQuailRoastRollsSaladSauceServeSweetTasteTastyTexasTobinTonysWorldAutumnBanditChurchCowBoyDinner...

My 2026-01-04

196 Items: CarBusBedPenBagBoxCupTeaIceSunSkyDogCatCowPigArtRunCrySadRedBigHotNewOldBadFunPearPlumLimeBikeBoatShipRoadHomeRoomDoorLampBookForkFoodRiceMilkSaltCakeSnowRainMoonStarWindLakeSandRockTreeLeafParkBirdFishGoatLionBearFrogDeerMathSongGamePlayWalkJumpSwimReadDrawMakeHelpCalmBabyNameBluePinkFastSlowColdGoodEasyHardAppleGrapeMangoPeachLemonMelonBerryTrain...

sentance battle 2026-04-28

190 Items: agosoinonattoheitweanmanboypenbagboxcupbedkeyeggdogcatcoweatrunsayseebighotsadbadnewolddaynowonetwofewallandtoonowbutyoushethegirlbabydoorbooklamphomeparkcityshoproadroomricemeatfishmilkcakesoupbirdfishlionduckbearcomewalktalklookfindmaketakegiveplayworkreadopentallfastslowcoldgoodeasyhardlatemorelessmanysomenoneideaweakalsothenfromwithovernextthey...

WW1 vocab 2025-02-05

28 Items: Theory of general Relativitylongest-serving U.S. presidentThird Realm" or "Third Empire"aims to revolutionise human experiencePowers Germany, Japan, and Italystaying out of the affairs of other countries.German philosopher, essayist, and cultural critic.the first nonstop solo flight across the Atlantic Ocean...

TS2 Training Day 3 2022-10-25

12 Items: Credit limit less than $5kThis status does not effect card usageWhat screen would you use to cancel a card requestWhat is the screen name to maintain account hold codesWhat type of card has a credit limit of $5k or greaterWhat screen would you use to request a replacement cardWhat is the screen name to maintain account processing type indicator...

Country Capitals 2025-04-20

192 Items: BakuSuvaRomeRigaCityMaleCityOsloLimaDohaApiaTownJubaBernDiliLoméKyivVilaKabulDhakaMinskLaPazSofiaPraiaQuitoCairoParisAccraDelhiTokyoAmmanVaduzRabatAbujaDakarSeoulTunisHanoiTiranaLuandaViennaNassauManamaGitegaOttawaBanguiBogotáMoroniZagrebHavanaPragueRoseauMalaboAsmaraBanjulBerlinAthensBissauTehranDublinBeirutMaseruBamakoMajuroMonacoMaputoNiamey...

BSFDE S 70 2025-11-12

20 Items: A global streaming company exampleAdapting a product to fit a local marketA company that operates in multiple countriesThe main technological driver of globalizationA major benefit of globalization for consumersA positive impact of globalization on educationtrade Global business cooperation between regions...

Year 3 wordsearch 2023-04-27

1 Item: photographer musician beautiful shells purple lifeguard dentists volleyball summer armchair bookcase windsurfing gymnastics crisps flour omelette noodles cheeseburger museum

Patriot Day Word Search 2025-09-10

30 Items: Which building was taller?(2 words)The 9/11 Memorial has _____ memorial pools.September 11 is known as a Day of _________.The 9/11 Memorial pools are ____ _____ deep.The name of the location struck on 9/11.(3 words)The city where the one non-military plane flew to on 9/11.The length of time the fires at Ground Zero burned.(2 words)...

Latin 10-12 Review 2025-04-14

61 Items: wenogodyouournewyesgiftfirenamecavelikealsohorseflameenemyangernightqueenstormcrueltheredangerforestto sendto moveto killto showso greatto buildto fightsuddenlytogetherright handto consumeto destroygrief, painyour, yoursyour, yoursto do, makeimmediatelykeen, fierceand not, norbrave, strongto put, placeto desire, wantfortunate, happy...

Nadine & Shaun 2026-04-06

28 Items: Who is the better cook?Who is the "messy" one?The formal "I do" event?The name of the Best Man?word they use most often?What the Bride walks down?The location of the proposal?The month of their first date?The name of the Maid of Honour?The colour theme of the wedding?What they like to drink together?The stone on the engagement ring?...

Mr. Kaiser's Georgia Studies Review 2026-04-29

20 Items: Elected President in 1860Trustee who founded SavannahGeneral who Marched to the SeaThe only president from GeorgiaUsed the New Deal to create jobsThe bomber plant in Marietta during WWIIJewish man who was lynched by a Marietta mobThe period of rebuilding following the Civil WarA type of WWII ship built in Savannah & Brunswick...

TC Jan Review Word Search 2026-01-28

12 Items: TC's new scheduling tech (2 words)Should be rounding during the shift (2 words)Beginning Feb 22 TC will begin staffing a (2 words)only urgency verbiage still used by TC and ASL (1 word)ASL will no longer be completing these to SLC (3 words)Staff use this to mark themselves off on TC updates (1 word)...

Search N' FInd 2026-01-13

12 Items: Quality of being trusted or believableAn argument that supports the opposing viewpointDetails from texts that are specific and observableThe struggle between two opposing forces in a story.the spoken conversation between characters in a story or playA sudden realization or insight that offers a new perspective...

The Great Depression 2025-01-10

22 Items: (CCC) gave unemployed people unskilled jobs.Successful in material terms; flourishing financially.The condition of having paid work; a job or profession.act gave drastic new powers to labor unions, causing another economic collapse.40,000 World War I veterans who marched to Washington DC for money promised to them....

Ramadan 2026-02-10

27 Items: The pre-dawn meal eaten before the fast begins for the day.Voluntary acts of charity and kindness done to help others.The new crescent moon that marks the beginning and end of the month.The Arabic word for fasting, which is one of the Five Pillars of Islam.The meal eaten at sunset to break the fast, often started by eating dates....

Waybill Word Search 2023-01-18

19 Items: Storage/Flip questionsInvoice sent to customerCompany goods are sent toUser ID & password issuesAble to perform all functionsDerived from the customer’s BOLCompany that sends goods by railTerms which indicate when payment is duePays authorized invoices and print invoicesFor any invoices that are scheduled to pay to AOW....

words 2024-05-06

1 Item: pupil morning afternoon desk chair eleven twelve please window bird present know new kite help again

Unit 8 word search 2024-11-07

19 Items: Think of Maui, the demi-god lolAn android is like a human in its...If something is legible, you can ... it.To adapt is to ... into a new environment.People often ... if miracles can really happen.Doing a vocal exercise helps to exercise your...If you get a question correct, then you got it...Metaphors can often ... the meaning of a sentence....

Holidays Around the USA 2023-12-08

15 Items: A cookie made with molasses and ginger.A festive song or hymn sung at Christmas.A Spanish phrase meaning “Happy Christmas.”A grouchy spoilsport who doesn’t enjoy Christmas.A nine-branched candelabrum used during Hanukkah.A small, decorative sphere hung from a Christmas tree.A candle holder for the seven candles lit during Kwanzaa....

Sacred Scripture 2025-08-22

19 Items: – Trust and belief in God.– A follower or student of Jesus.– Being saved from sin through Jesus.– Following God’s will and commands faithfully.– God making Himself and His truth known to humanity.– Beliefs and practices passed down through the Church.– Compassion and kindness shown, even when not deserved....

Truthinsavingsact Word Search 2023-11-30

15 Items: People before _______.Be an effective _______.You should not be eating or ______ gum while assisting customersAnyone entering the bank is either a customer or a _________ customer.Annual Percentage Yield should always be expressed to ____ decimal placesA percentage rate reflecting the total amount of interest paid on an account....

YEAR 6 HOMEWORK 2025-03-25

1 Item: opportunity weather microscale survive module experienced sequence absence adequate compulsory documentary impact stationary dispatch switch pressure rigours

Chapter 18 to 21 2024-09-26

12 Items: Who is the founder of Liga FilipinaTo whom did Rizal dedicate El FilibusterismoThe place he described as an ideal setting for romanceNumber of years it took Rizal to finish El FilibusterismoWhere was Rizal busy writing his second novel, El FilibusterismoWhere did Rizal lost a locket that contains Leonor Rivera's image...

Rosa/Ruby Bridges Vocabulary 2024-02-09

12 Items: I _______ my seat at the concert.Ms. Sampson painted the room in ______ colors.The cat thought he was ______ to another treat.The students _____ out the words in this word search.The goalie had to ________ where the ball was going to go.Frederick Douglass was an ______, he fought to end slavery....

Fiveyears Word Search 2026-04-28

15 Items: Baby is the size of a grape in the wombMost important time for baby developmentMost important milestone of month 12 after being bornCountry with highest birth rate per day ( hint: in Asia )Thing baby begins with ( hint: the most basic unit of life )About 80% of babies are born with this ( hint: A certain mark )...

Our Universe 2024-12-13

18 Items: Where Nuclear Fusion beginsWhere stars are first formedWhat galaxies are classified by90% of all stars are in this stageAt the top middle/right of an HR DiagramOval shaped galaxy with mostly old starsExtremely bright explosion of a high mass starThe absolute last stage of an average mass starUnit of measurement for long distances in space...

Year 2 words 2024-09-11

1 Item: again, any, bath, beautiful, because, behind, both, break, busy

Year 5 Spellings 2025-06-27

1 Item: appreciate, attached, available, average, awkward, bargain, bruise, category, cemetery, vegetable, vehicle, yacht, accommodate, accompany, according, achieve, aggressive, amateur, ancient

Year 4 HASS 2026-03-22

1 Item: Australia, first, fleet, England, industrial, revolution, machines, rural, mapping, sailing, significant, Dutch, colony, stealing,

Geoscience Processes 2025-06-11

8 Items: soil and rock, are worn awaygiant waves caused by earthquakes or volcanic eruptions under the seasudden ground shaking caused by movement along faults in the Earth's crusta natural phenomenon or a series of events that occur within the Earth's systems...

Chapter 25 Vocabulary 2025-01-28

15 Items: native to a regionnot mapped; unknownto take advantage ofthe established customs of a peoplea property of land usually with a large housethe extension of a nation’s power over other landsa governor who ruled as a representative of a monarchto send a product or service for sale to another country...

Groundhog 2026-01-17

7 Items: A last name no one would wish upon anyoneGrace's role in New York City Ballet's production of The NutcrackerMay you have a hint of spring in your step on this most under-celebrated holiday.The witty Cole Porter musical we are all looking forward to watching Lydia co-star in this March...

Module1: Introduction to pathology/Skeletal system 2023-12-20

18 Items: The primary site of ossificationThe most common form of arthritisA generalized decrease in cell sizeA generalized increase in cell sizeHaving more than one illness at the same timeAn abnormal change occurring in mature cells.The forward slippage of one vertebra on anotherA specific cancellous bone located in the skull...

The Universe 2025-05-01

10 Items: A baby starThe path an object takes as it moves around another object.A big group of stars, gas, and dust held together by gravity.A cloud of gas and dust in space where new stars can be born.A change in light that shows an object in space is moving away from us.A tool that helps us see faraway objects in space by making them look bigger....

City Word Search 2025-04-14

1 Item: Year provides service, volunteering, community, education, youth, schools, support, mentoring, tutoring, development, skills, experience, growth, impact, opportunities, leadership, teamwork, communication, collaboration, students, learning, engagement, Am

All things Cases 2024-05-15

10 Items: Secondary case reason and where quotes are createdSecondary case reason and where ESS proposals are createdResolution used if you created 3 new print listings in KGENThis primary and secondary case reason should rarely ever be usedThis field should have the issue, CUID Business Name and initials...

Earth's Systems and Cycles 2026-04-13

10 Items: a source of energy that is not depleted by usematerials and substances found in nature such as woodthe process of changing energy from one form to another to preform workthe introduction of harmful substances or energy into the natural environmentof a natural resource or source of energy that is not capable of being replenished...

Earth and Space Science 2023-03-20

16 Items: a medium-sized star in our solar systemTrue or False-The sun orbits the Earth.the way in which the Earth slants on its axisThis planet is made of gas and has a very long orbit.Earth’s closest star and the center of our Solar SystemThe 4 planets that have long orbits and are made of mostly gas...

Types of Fraud 2026-03-23

9 Items: Altered payee and/or amounts on bank checksFraudsters change the amounts and payee on a stolen checkFraudsters open new accounts and use starter checks to intentionally commit fraudFraudsters deceive people into revealing sensitive information or installing malware...

Neuron Word Search 2025-09-17

14 Items: Basic nerve cell that transmits electrical and chemical signals.A neurotransmitter linked to reward, motivation, and movement control.Fatty insulating sheath around some axons that speeds neural conduction.— A neurotransmitter involved in muscle activation, attention, and memory....

AP Biology Unit 7 Review Word Search 2026-04-15

14 Items: The study of heredity, genetic variation, and DNA.Formation of a new species due to geographic isolationThe study of evolutionary relationships between organismsAn organisms ability to survive and produce viable offspringDifferences in characteristics among individuals within a species...

wordsearch 2025-06-14

1 Item: sweet, real, true, kind, safe, warm, new, calm, wild, deep, bold, pure, hot, full, soft, free, cool, easy, rich, open, strong, whole, big, good, fast, slow, close, close, sure, rare,fun, sweet, real, true, kind, safe, warm, new, calm, wild, deep, bold, pu

Review activity - vocabulary 2025-05-26

18 Items: Not used a lot or enoughA set of ideas you have about someoneSomething you own that has value if soldTo move money from one account to anotherControlling someone to your own advantageSomething that can make you a lot of moneyLearn about the writers, novels and poetryI need to ____ some cash from the the ATM....

PhT 100 Word Search 1 (Spring 2024) 2024-05-09

17 Items: To grind to a smooth substance with moisture.The basic unit of weight in the apothecary system.The dating of any medication that has a short shelf life.The liquid in which another substance is being dissolved.The determination of the covererage an insured is entitled.Complete destruction of organisms after they leave the body....

Anne Word Search 2026-03-23

20 Items: shares a room with Anne.The main character's father.The main character's mother.The name of Peter Van Daan's cat.The 13 year old who wrote the diary.Hostility towards the Jewish people.Mr. & Mrs. Van Daan's son. Owns a cat.Anne spills milk on this person's fur coat.The thing Anne is writing in while she is in hiding....

Ixion & Asclepius 2026-01-07

29 Items: Chiron's fatherAsclepius' motherKing of the LapithThe place Asclepius livedOne of Asclepius' daughtersMother of the first centaursThe one kind and wise centaurThe location of Chiron's caveHow many children Asclepius hadApollo's son he brought to ChrionThe type of people Asclepius helpedWild and savage, half men half horse...

The skeletal system 2025-10-01

18 Items: This is the long shaft of a bone.This bone is located in the upper legThis is the side-to-side curve of your spine.metacarpals are which classification of bone?The sternum is an example of this type of boneThis is the single large bone of the upper armThis is the main core or axis of the skeleton.This is the process of creating new bone growth....

Find these words fastest and receive a prize!! Find them second fastest and receive a "prize" to enjoy for 1 year. NOG FEST, BLANKET MAKING, RADIO BUILD, BT STEREO BUILD, THANKSGIVING FOOD DRIVE, THREE FOOT TRAC II, NEW MOON MULTI USE 2025-12-19

7 Items: NOGFESTRADIOBUILDBTSTEREOBUILDBLANKETMAKINGTHREEFOOTTRACIINEWMOONMULTIUSETHANKSGIVINGFOODDRIVE

Math Wordfind 2024-11-19

48 Items: 0x6=15÷3=2x2x280÷8=44÷4=10÷10=18-16=19-13=400÷107 days__x4=12__x6=24__x3=213x__=27365 daysdouble 15double 25ten years100 yearshalf of 24half of 40360 degrees3 sided shape4 sided shapecompass pointmeasures lengthmeasures weightthe shape of a diceanother name for minusanother name for totalanother name for timesangle less than 90 degrees...

Invisibleaudience Word Search 2024-10-18

11 Items: VPNincludes our emotional, psychological, and social well-beinga hacking method that uses trial and error to crack passwordsthe pursuit of an intentional and healthy relationship with technologysecurity or authentication credentials that are used to access the Software...

Diwali word search 2025-10-20

11 Items: I am a synonym to the festival of of lights. (Hindi)I’m a tiny sun in a clay bowl, sipping oil to keep my glow. (Hindi)Bells and blooms at sunrise door—hands together, hearts adore. (Hindi)I crack, I pop, I paint the sky. Cover your ears when I fly. (English)laddu, barfi, gulab jamun, ras malai etc. A treat for everyone. (Hindi)...

Context Clue 2025-11-14

14 Items: Billy DESCENDED the stairs into his basementThe boat sailed gently on the the TRANQUIL lakePeter was ENVIOUS of his brother's cool new bikeMs. Chen ADMONISHED her students to finish their workJason was in a SOMBER mood when he heard the bad newsThe man's large hat and sunglasses CONCEALED his face...

Summative Review: U7 Insurance 2026-01-20

23 Items: A situation involving exposure to danger, harm, or lossPercentage of healthcare expenses a health insurance plan will payThe maximum amount an insurance company will pay if you file a claimAuto insurance that protects you against costs to repair your own vehicle after a crash...

Classroom Procedures 2025-08-21

20 Items: Mr. Andrew has one of theseWhen you miss a day of schoolThe one material for the classThe Middle Ages in European historyUsing someone else's work as your own.What you get for doing work in the class.A way to reach Mr. Andrew with any questionsSomething that should not be out during classA topic we will be covering in our Japan Unit....

Toldot 2025-11-23

27 Items: Jacob is sent to ______ .Esau was born looking how?Isaac loved which son more?The well was named _______ .This Hebrew letter is silent.Who had two nations in her womb?A second well was named ______ .He was appearing to wear a ___ _____ .A third well was named _____ _______ .At forty Easu took a wife named ______ ....

8th Grade Final Review 2025-12-12

36 Items: felt as heattop of a wavehow energy movesbottom of a wavecauses earthquakesbaseline for a waveknown as the red planetused of medical imagingoutermost layer of a starcauses seafloor spreadingpush or pull of an objectprocess of changing positiondevice that takes in signalsamount of matter in an objectdevice that sends out signals...

3B 0725 2022-07-23

39 Items: unsafea rocka truckon all sidesthink of againcovered with snowcautious in one’s actionsto get pleasure from somethingthe process of doing somethinga bird that loves stealing thingsto produce leaves to begin to grownot containing any things or peopleone of the four periods of the yearto take something without permission of the owner...

Lesson 14: The Constitution Vocabulary Words 2024-02-21

11 Items: The branch that makes laws.The branch that carries out, or executes, lawsThe document that describes how the U.S. government works.An agreement in which each side gives up some of what it wants.The branch that interprets laws and settles disagreements about them....

Bo 6.0 2026-01-25

28 Items: …. And _______ ______. “What was the eighth plague?“It is Adonai’s ________. “The lamb is to be _________.The ninth plague was _______.You eat it with loins ______.It is to be eaten with “ ________ …“Not a_____ of His shall be broken.”You are to eat ______ for seven days.This plague lasted for ________ _____....

TCI Lesson 42 Word Search 2026-03-23

23 Items: Michigan’s state fish:People over the age of 65:What we are all waiting for:The Boston Red Sox play here:The “Father of the Constitution”:This replaces small independent farmers:This policy ended federal aid to tribes:The most majestic bird in the entire world:This comprised one-third of a family's total budget:...

Evening Word Search 2023-10-11

1 Item: starry Peace Singing happiness Shepherd bells Kings Jingle new Song Harmony glory Portal Belen Jesus Gifts virgin Angel Redemption

Pathophysiology Word Search 2025-09-07

20 Items: Something you can see or measureHow often a disease causes deathCause behind why a disease startsWhen a disease suddenly gets worseYou are born with it, doesn’t develop overtimeWhen symptoms get better or disappear for a whileShape,Structure, or Appearance of cells or tissuesDiscovery of what disease or condition someone has...

Weather 2026-01-25

30 Items: flat cloudlumpy cloudwispy cloudoften has a namestones from abovebrief stronger windShakespearian stormwelcome to Bristol!a destructive spiralclockwise wind systemmeasures how hot it isa taste of Siberia in Britain*** on the Tyne, and elsewherewind, but gentler than a breezeinstrument to measure wind speedwind, but stronger than a breeze...

Accountability Word Search 2026-02-26

22 Items: Abuse of public office for private gain.Acting fairly and without political bias.Political independence of civil servants.Strong commitment to public service duties.Ability to act independently and proactively.To simplify procedures to increase efficiency.To adapt policies or services to specific needs....

Metals 2026-02-25

16 Items: A list of all the elements (8,5)The test for hydrogen gas (5,4,1,3)The word for the corrosion of iron (7)How we extract very reactive metals (12)How we extract very unreactive metals (4,3,3)How we extract fairly reactive metals (4,3,6)Word that means can be drawn out into wires (7)What is made when a metal reacts with oxygen (5,5)...

Office Word Search 2023-10-17

36 Items: desmondO_S _ _ _ _ _ _ORV example _ _ _80+ _ _ _ _ _ _ _H_A _ _ _ _ _ _ _R_PDO _ _ _ _ _ _New driver _ _ _ _ _ _Not sober _ _ _ _ _ _ _ _MM _ _ _ _ _ _ _ _ _ _ _ _ _Annual report by REO _ _ _ _ _VRU example _ _ _ _ _ _ _ _ _ _What we call a road _ _ _ _ _ _ _Form of stunt driving _ _ _ _ _ ________, move over _ _ _ _ _ _ _ _...

Pathophysiology Word Search 2025-01-25

20 Items: The cause(s) of a diseaseHow the disease process evolvesThe physiology of altered healthA compilation of signs and symptomsThe functional effects of a diseasePresent at, and usually before, birthA manifestation that is noted by an observerThe death-producing characteristics of a diseaseAggravation of symptoms and severity of the disease...

A Search for Us 2025-02-19

30 Items: how we metyou make me soa dog and a drugmy favorite candysomething we losta superior toppingmy seat in the caryour favorite sportMad Jack’s sandwicha couple hobby for usvessel for whipped creamyour least favorite fruitmy favorite sport to watchto save your poor dry facemy recurring injury locationwe’ve watched three of these...

T1S6 Spelling Word Search 2025-02-24

20 Items: veryvery serious or badTo push someone gentlyThe quality of being on timeCompletely soaked with waterTo give approval for somethingThe entrance hall of a buildingThe act of coming up with new ideasA chance that something might happenThe state of being extremely necessaryA feeling of sadness and disappointment...

Test 2025-05-12

207 Items: webeitbyatofmytryoldageourhottooperusedayoutrednewsixyetsetn'ttwoveryfillknowcasefindstopareapassbodygirlfundgoodmorerulewiderisklongwhatmainsamefromteamfourroomitempagefilmtrippoorthatnearrichlastoncetreebanktimenonehavethisboardshortlargemoviewhosesouthagentthesecleararguecloseofferstoreamongtrialpriceleastagainleaveunderreadywouldphonesoundserve...

Semantics Word Search 2026-01-15

25 Items: nebulous- Vague or ill-definedumbrage- Offense or resentmentacerbic- Sharp or biting in tonekerfuffle- A noisy disturbance or fussbefuddle- To confuse or puzzle someoneatonement- Making amends for wrongdoingsemantics- The study of meaning in languagecountenance- Facial expression or appearanceastute- Having keen insight or sharp judgment...

Classification of Matter 2026-01-31

20 Items: the smallest unit of an element.the amount of matter in an object.two or more atoms bonded together.the amount of space an object takes up.anything that has mass and takes up space.Change a change that forms a new substancea process where a liquid changes into a gas.the substance that is dissolved in a solution....

Get to the Root of it Unit 16 2026-03-14

29 Items: Eating only meat.A reddish-brown stone.To separate from the body.Relating to abstract ideas.Hostility or strong feeling.Mental calmness or composure.Showing animal-like qualities.The quality of being physical.A scientist who studies physics.The order of meat-eating mammals.The science of matter and energy.An animal that eats other animals....

united 2022-12-08

66 Items: rosesagebiomecamelbridgeantigenacologybiologybiofuelbiotechbiomassparsleyaerologyairplaneaccepterantibodybackbonebiometerbroadwaybrooklynconsumercompounddolphinscardamomlavenderaerospaceanabolismastronomyacidulantbiospherebiologistchinatownchemistryatmosphereabsolutismabsorptionantibioticabsorbancecapitalismcryospherecardiologyaerodynamic...

Spanish 7A 2025-02-24

56 Items: capnewcoatboththatthissuitbootssocksshirtthosetheseskirtjeanspantspricemaybestoredressshoesblousejacketto buytowearshortst-shirtto costto wantsweaterso muchto enterthousandto thinkswimsuitexcuse meto preferLet's go!sweatshirtto look forsalespersontwo hundredsix hundredfour hundrednine hundredfive hundredeight hundredseven hundredthree hundred...

Fairness, Values, Public Policy Review 2025-09-03

27 Items: A ______ began over unfair playtime.A ______ of cheating is unfair grades.It is a ______ choice to stop bullying.Clothing and music show a teen’s ______.______ means everyone can join the game.______ is when teams split by gender only.A ______ need is fair access to computers.We ______ grades to see if marking is fair....

Factors that Influence Product Design (F.U.N. T.E.A.M.S.) 2026-04-01

9 Items: The purpose of a product that makes it fit-for-use for its intentMaterials, tools and processes used in product design and productionThe end consumers of the product for whom and which the product is intendedThe identification of the purpose of a product from research and development...

Movie Title Word Search 2025-10-08

10 Items: Count Orlok's alias.Your favorite 90's ghost (animated).Toni Collette was robbed of an Oscar for the crying in this film alone.Brillant young women who is looking for a companion to face this cold cruel world.Fantasy story that involves a girl named Sarah, a Goblin King and a kidnapped baby brother....

MOVIES & TELEVISION 2025-11-07

10 Items: The main ......... was so cruel that I found it difficult to keep watching.I usually switch to the news ......... after dinner to catch up on current events.The new ......... about deep-sea wildlife was both beautiful and incredibly informative.The journey of the explorer was so ......... that I finished the entire book in one weekend....

Unconference 2025 2025-08-05

10 Items: Working together with others to achieve a shared objectiveThe ability of an organization to keep its employees over timeThe process of developing new ideas, methods, or products to improve outcomesThe conduct, behavior, and attitude expected of someone in a professional setting...

Evolution Word Search 2026-04-13

10 Items: characters: newly evolved traits that differ from the ancestral formworld hypothesis: early life forms relied solely on self-replicating RNAprocesses: that lead to the formation of species found in one specific geographical areaselection: intentional breeding of plants or animals by humans to promote desirable traits...

Independent Living 2024-05-23

20 Items: You can talk yourself into these but not outYou need to make _________ after an accident.What you can do to make leftovers into new foodWhat must you do on a regular basis (for food)?The crime of an ID thief is a. fraud b. treasonHow many years it can take to prove you are youWhat you should do if you do not know something...

Pathophysiology Word Search 2025-09-07

20 Items: Something you can see or measureHow often a disease causes deathCause behind why a disease startsWhen a disease suddenly gets worseYou are born with it, doesn’t develop overtimeWhen symptoms get better or disappear for a whileShape,Structure, or Appearance of cells or tissuesDiscovery of what disease or condition someone has...

Mr. Manhart's Word World 2026-01-15

25 Items: nebulous- Vague or ill-definedumbrage- Offense or resentmentacerbic- Sharp or biting in tonekerfuffle- A noisy disturbance or fussbefuddle- To confuse or puzzle someoneatonement- Making amends for wrongdoingsemantics- The study of meaning in languagecountenance- Facial expression or appearanceastute- Having keen insight or sharp judgment...

Mr. Manhart's Word World 2026-01-15

25 Items: nebulous- Vague or ill-definedumbrage- Offense or resentmentacerbic- Sharp or biting in tonekerfuffle- A noisy disturbance or fussbefuddle- To confuse or puzzle someoneatonement- Making amends for wrongdoingsemantics- The study of meaning in languagecountenance- Facial expression or appearanceastute- Having keen insight or sharp judgment...

THE WORDSMITH'S HUNT 2024-11-26

10 Items: Compensation or benefits provided to an employee upon termination of employment.A formal complaint raised by an employee regarding workplace issues or policies.The systematic process of assessing the value or performance of a job or employeeA relationship where a more experienced employee supports and guides a less experienced one...

Book 2 Lesson 4 Part 1 2025-04-09

10 Items: After a short break for lunch, Wally zzz his work.The northern zzz of the country are usually windy and snowy in winterThe robber zzz the bank staff with a gun and made them hand over the money.Two new schools were built to improve the quality of zzz in this remote area....

Animal Adaptations 2024-03-14

16 Items: copying a behavior or appearancemanipulate an object to perform a certain taskmore eyes in a group to watch out for predatorsbehaviors that are inherited rather than learnedpretending to be dead to escape from bodily harmadjustments to internal or external physical structuressolving a problem by repeated, varied attempts until successful...

Pathophysiology, Word Search 2024-09-09

20 Items: something that is subjectivedefects that are present at birththe form and structure of organismsobjective and observed manifestationthe likely outcome or course of a diseasethe increase in severity signs or symptomsthe decreased in severity signs or symptomsthe study of reasons for certain decease phenomena...

History Vocabulary 2025-04-22

20 Items: A man who rules a country.A woman who rules a country.A big fight between two armies.Making something new, like a machine.A big fight between countries or groups.A big change in a country, often with fighting.An agreement between countries to stop fighting.A country or area controlled by another country....