new year Word Searches

Black History Month Word Search 2026-03-02

20 Items: Invented the gas maskAn activist and film makerFirst African-American airmenSaid the speech "I have a dream"First person to use a synthesizerCalculated the path for Apollo 11Wrote her first poem at 14 years oldMade the Chicago Defender news paperSecond black women hired by Naval BaseFirst African-American Secretary of State...

Elder Scrolls (For The Love Of My Life) 2026-04-12

30 Items: Goddess of LoveHas VigilantiesGoddess of BeautyCapital of RacismGrayBeards House?Dragon God of TimeWorld Eater DragonThe wretched AbyssHero God of mankindHousecarl of whiterunWrong Gate at the GatesThe Consummate politicianDeadric Prince Of MadnessCalls the Blue Palace HomeDaedric Prince Of the huntEmperor that is assassinated...

Invasive Species Word Search 2025-11-24

16 Items: To shake quickly back and forth.So scary or gross it makes you shiver.To watch or check carefully over time.Needs to be done right away, no waiting!A person you work with or do projects with.An animal that hunts and eats other animals.Very mean or likely to hurt someone or something.To stop something from happening before it starts....

Earth and Space 2025-03-13

21 Items: The red planetThe Jewel of the SkyThe planet we live onTo light something upThis planet is a dwarf planetThis means the moon is growingWhat we see in the sky at nightThis means the moon is shrinkingA group of stars creating a shapeThis planet is closest to the SunThis planet has a tilt of 90 degreesThis planet is furthest from the sun...

Fly High 2 - Lesson 1-20 2026-05-05

165 Items: upcatdogfoxredonetwosixtenbagpencarmumdadboyspyoldnewlegarmeareyebigsadbusflyrunbedeggbeargoatlionnestbluegreypinkfourfiveninebookballdollcardcakebabygirlkingkitebiketoysslowfastbodyheadwinghandfeetnosehairduckswanshopsingjumphighrideswimskipwalkdeskmilkfishsoupapplehippojellyqueensnaketigerwhalezebragreenblackbrownwhitethreeseveneightspellchair...

Geography Unit Word Search 2026-01-13

22 Items: Which Great Lake is the warmest and shallowest of the five?Which Great Lake is the largest freshwater lake by surface area?Which major river flows from Minnesota south to the Gulf of Mexico?Which river flows through Virginia and empties into the Chesapeake Bay?Which mountain range runs from Canada to New Mexico in the western United States?...

Spelling Test 3 2022-09-23

28 Items: against slaveryhostile; unkindunfit to be eatenthe act of going awayto repeat or say againone who is not a memberbefore recorded historythat which is not nuclearoccurring twice in a yearto stop or prevent an actionapart from one's choice or willto go do, come down, fall, or sinkof the highest degree or importanceextending across the Atlantic Ocean...

Olivia Word Search 2024-03-12

199 Items: trewinwonshugyanitoshwifewildwoolwordyardyearelseheldideasuitsurewearyelltylershaneahmadcarolshanaarifapryorgracejavonjamesjasonjudahjonahwomanworldwouldwritewrongboardbuildbuiltenjoyfieldfifthgroupheavyknownlaughninthoceanprizequiteradioraisescaresincethrewtiredtriedtrulyuntilvisitwholewhosewomenwroteyoungamongpieceoliviatakeyabryantfadyaaaminah...

Factors Influencing Selling Techniques Today! 2023-11-23

14 Items: criteriadirectly or indirectlyshare and new product development.The name, logo and attributes of a business.The amount that consumers are asked to pay for a product.The way that a product makes its way from producer to consumerThe goals set by a business to increase sales, brand awareness,...

POSTIES 0407 BIG READ 2025-03-07

6 Items: the ability to seeto get used to a new situation by changing the way you behave and think_____ is a way for people who cannot see well to read by feeling raised dots.the process of helping somebody to return to a normal life after they have been very ill...

S2U7 Vocab Practice 2026-01-28

61 Items: whennearlazyto goneverundergrosswhileto seealwaysbehindshowermirrortoiletwe wereall dayyou wereat timesentranceto stalkto bullythey wereevery dayevery dayto botherevery yearfrequentlyfrequentlymany timesreflectionI/he/she wasevery Mondayevery Fridayevery Sundayall the timehe/she threwwe used to goevery Tuesdayso many timesseveral timesI/he/she knew...

Happy Easter! 2026-03-30

25 Items: devotionAnother word for "a win"Jesus was buried in a ____.Another name for God's WordSinging is a way to ____ God.The fourth month of the year."Christian" means "little ____"If you are not guilty, you are ____.Jesus was placed in a tomb for ____.Two ____ were posted outside Jesus' tomb.Jesus died to give us ____ life with Him....

Sukkah Word Search 2023-09-21

19 Items: schach must grow from thisschach must be _ from the groundschach can't become spiritually _animal _ can't be used for schachThe sukkah must be at least 10 _ tallThese must be put up before the sechachThe sukkah can't be higher than 20 _ tallThis must be put on the sukkah every yearThe sukkah must be at least _ tefachim wide...

Bible Random Word Search 2025-04-25

38 Items: the lastthe firstUriah’s wifedaddy synonymrunaway slaveIshmael’s father12 sent out onesIshmael’s motherJacob’ s new namewrestled with GodJew’s ruling bodyold name was Abrambirthplace of JESUSJew who ruled Egyptname hanged to PaulJew who ruled BabylonMary’s son of thunderrunaway slave’s ownercalled out David’s sinfirst king of the Jews...

Pathophysiology Terms 2026-01-21

20 Items: present at birthcause of a diseaseobjective evidence of a diseasesubjective evidence of a diseasecompilation of signs and symptomsprospect of recovery from a diseasestudy of the structure of cells/tissuesthe nature and cause of a health probleman acute increase of severity in a diseasethe origination and development of a disease...

Alpha Word Search 2026-03-25

180 Items: PCSSEAFLYNEWREDECHOGOLFKILOLIMAMIKEPAPAXRAYZULUCAMOGEARHULLSHIPTECHBASEBLUECAREHOMEKIDSLOVEARMYCREWHEROALPHABRAVODELTAHOTELINDIAOSCARROMEOTANGOWHISKASVABBOOTSCODESDRILLDRONEEAGLEHONORPLANESERVEVALORAPRILAWAREBLOOMGREENHEARTPRIDEROOTSUNITYWORLDCADETCADRECHIEFCORPSFLEETMAJORJULIETQUEBECSIERRAVICTORYANKEEATEASEDEFENDDOGTAGHELMETMENTALMORALSSALUTE...

Alpha Word Search 2026-03-27

180 Items: ATPCSSEAFLYNEWREDECHOGOLFKILOLIMAMIKEPAPAXRAYZULUCAMOHULLGEAREASEBASECAREHOMEBLUELOVEARMYNAVYCREWHEROALPHABRAVODELTAHOTELINDIAOSCARROMEOTANGOWHISKHONORVALORBOOTSDRONEPLANEASVABEAGLESERVEDRILLCODESAPRILWORLDUNITYAWAREGREENHEARTROOTSBLOOMHEARTPRIDEMAJORCADRECORPSCADETFLEETCHIEFJULIETQUEBECSIERRAVICTORYANKEEMENTALMORALSDOGTAGHELMETSALUTEDEFENDHANGAR...

CROSS SELL WORD SEARCH 2024-07-10

15 Items: MAKE YOUR MONEY WORK FOR YOUTURN MISPLACED CARDS ON AND OFFCHILDREN AND TEENS UP TO 17 YEARS OLDYOU CAN SEND UP TO $1000 TO ANOTHER MEMBEREARN 1.5 POINTS FOR EVERY 1$ THAT YOU SPENDPLAN YOUR NEXT TRIP WITH AFFORDABLE PAYMENTSFIND GECU LOCATIONS AND HOURS OR ATMS CLOSEST TO YOUFOR NEW OR USED VEHICLES TO GET YOU WHERE YOU NEED TO GO...

The Manhattan Project 2026-03-11

15 Items: – The radioactive element used in the "Fat Man" bomb.– The radioactive element used in the "Little Boy" bomb.– The energy and particles released by nuclear reactions.– Refers to the type of bomb developed during the project.– The process of splitting atoms to release enormous energy.– The site in Washington state where plutonium was produced....

manhattan project 2026-03-12

15 Items: – The radioactive element used in the "Fat Man" bomb.– The radioactive element used in the "Little Boy" bomb.– The energy and particles released by nuclear reactions.– Refers to the type of bomb developed during the project.– The process of splitting atoms to release enormous energy.– The site in Washington state where plutonium was produced....

Personal Financial Planning 2023-10-17

23 Items: The assets a person ownsPerson who depends on another personLong-term insurance with a savings elementShort-term insurance with no savings elementPayments made by a corporation to its stockholdersThe increase in the value or usefulness of an assetThe decrease in the value of usefulness of an asset...

Welcome to the Team 2025-06-26

23 Items: This person has published a book. (5 letters)I ride a Nija 650 sport Motocycle. (11 letters)Currently training for a Half-Ironman. (7 letters)The office's biggest Ottawa Charge fan! (4 letters)A transplant from the Northwest Territories. (7 letters)Went on a 7-day jungle safari in the Serengeti. (6 letters)...

Landmark HTN Trials 2026-02-22

13 Items: In high-CV-risk patients without diabetes, an SBP target < 120 vs < 140 reduced major CV events and all-cause mortalityBenazepril–amlodipine was superior to benazepril–hydrochlorothiazide in reducing CV events in patients with high-risk HTN...

08 2025-08-16

15 Items: a footrest for the riderThe part where the rider sitsSmall footrests for the rider or passengerA device for slowing or stopping a motorcycleFootrests mounted on the bike frame for supportA backrest bar for passenger comfort and supporta term used for the first ride of the new seasonFoot controls used to operate brakes or gear shifts...

Balboa 2025-09-09

15 Items: There is a _________ between right and wrong."Under the weather" is an example of ________."Her smile was a mile wide" is an example of __________."He's as healthy as a horse" is an example of a ________."His mind screeched to a halt" is an example of _________.His new white kicks were ________, with no scuffs on them....

Communism Word Search 2023-12-13

15 Items: 9/11 was an act of _________.Making a law better than it was prior.The Soviet Union had a _________ economy.Occurs when the economy begins to decline.A country that is considered superior to others.This is a type of warfare used in the Vietnam war.A popular political idea associated with Democrats....

Getting away 2023-12-09

20 Items: feeling calm,quietsomething that is very oldbeing the only one of its kindwhen a place has lots of peopleto go on a difficult journey on footsolid substances such as wood,plasticsomething that makes you feel relaxedsomething that makes you feel excitedunusual and often from another countryto become larger and rounder than normal...

Mattot Massei 5.0 2025-07-20

20 Items: SaltHaShem’s footstoolThe place where Aaron died.Who can annul a women’s vow?Where is The Holy Ones throne?The Holy One looks for the _____.What is never quenched in Gehenna?He spoke to the heads of the tribesWhere did Israel begin their journeys?Hpw many cities of refuge were appointed?This tribe requested land East of the Jordan....

CLIMATE 2025-11-20

20 Items: – What climate is the coldest on Earth?– What climate is found at the highest peaks?– What word describes rain, snow, sleet, or hail?– What describes average weather over a long time?– What is changing worldwide due to human activity?– What word means the amount of moisture in the air?– What climate is hot, dry, and has very little rain?...

Units 6-9 2026-02-24

20 Items: Main cause of civil war, supplies, and international aid.A union strategy to restrict the south of itsAdmendment that gave African Americans equal rights.Admendment that gave All males, colored or not, voting rights.Admendment that officially freed all slaves in the United states...

fetertre 2023-08-24

7 Items: Legally recognised partnersAny transaction or occurrence that results in a tax consequence.It is specifically excluded from the definitions of ‘goods’ and ‘services’.Permanent transfer or disposal of business assets where input tax credit has been availed on such assets....

9.The 1950s saw the emergence of a new youth culture, as teenagers became a distinct demographic group with their own music, fashion, and attitudes. 2023-03-04

20 Items: souldoowopmotownthetwistbillhaleydickclarkalanfreedchuckberryfatsdominobuddyhollyedsullivanrockandrolltheplattersthecoastersstaxrecordselvispresleylittlerichardjerryleelewisrhythmandbluesamericanbandstand

AAA list - how many can you remember? 2025-12-14

15 Items: autumn road trip next year?another winter on-water activitya big walk we want to scrapbook abouta safe place to think about your dad inour first attempt was derailed by a stormone of many wholesome activities to do at an orchardhow you know winter is coming to somerset, apparentlywe love a dance and a sing along and a chance to dress up...

Animal Farm Chapter 10 2025-04-02

19 Items: The farm was more… (128)Who visited the farm? (134)Animal Farm’s “new” name (138)The windmill was used for this (128)How many commandments are there? (133)What did Napoleon carry with him? (132)Died in another part of the country (127)Clover was two years past _______ age (127)Clover saw a pig walking on his what? (131)...

European Age of Exploration 2024-08-12

10 Items: What was the name of the reconquest of Hispaniola?What nation discovered a new route to India and China?What were southern cities of Spain in terms of religion?What was the name of the trade route from Asia to Europe?What land was known for the large amount of spices produced?What city fell to the Ottoman Empire and cut off the silk road trade?...

Vocuabulary Unit 1 Focus 2025-12-11

10 Items: ... but A and C only are connected...There is a... connection between points A and B...A sign that says “…” warns you not to enter a place.Tom can’t cook so he eats junk food. Not all the time but …With some people … is difficult because they just won’t listen.I was … to water my friend’s plants, but I forgot, and they all died…...

Climate 2025-11-20

20 Items: What climate is the coldest on Earth?What climate is found at the highest peaks?What word describes rain, snow, sleet, or hail?What describes average weather over a long time?What is changing worldwide due to human activity?What word means the amount of moisture in the air?What climate is hot, dry, and has very little rain?...

4B 0519 2023-05-18

25 Items: The three biggest ________ are at Giza._____________ were kings in ancient Egypt.A ________________ is a person who puts out fires.Sardines, pike and cod live in the sea. They are _______ fish.Honeybees are social insects and they live together in a _______.The baby ______ down when his mother picked him up from the cradle....

Sustainability 2025-09-26

15 Items: The act of using goods, energy, or food.Bringing nature back to a healthy state.The variety of animals and plants in nature.Harmful materials in the air, water, or land.Fair treatment for all people and the planet.When people have the same rights and opportunities.Things we use from nature, like water, trees, and oil....

Staten Island AA Trivia Wordsearch 2025-10-21

12 Items: AA started on Staten Island in what year?Staten Island had its first ______ in 1983.In 1995, SIGS sponsored the first ______ Marathon.Staten Island had a Post Office Box for what kind of work?Staten Island General Service was formed in the Early ______.The second AA clubhouse on Staten Island was called the _____ Club....

Budget Word Search 2023-01-17

27 Items: Using envelopes to budgetLabor marker for free-lancersThe opposite of fixed expensesCost the same amount each monthDivide your income into three categoriesA spending plan based on income and expensesThe amount of money needed to cover basic expensesThe cost required for something; the money spent on something...

Cardiac Rehab Word Search 2023-02-23

15 Items: cessation To stop smokingweight in pounds divided by heightRisk Factors risk factor YOU can changeattack obstruction of blood flow to heartmonitoring continuous monitoring of a patient's EKGWhat you will experience in our cardiac rehab departmenttype of chest pain caused by reduced blood flow to the heart...

Burberry 2024-07-26

15 Items: Who is the new CEO?where are Burberry bags made?The peg bag is made from what?How should a bag be stored in SB?What closure does the snip bag have?Which bag is inspired by a child’s toy?Where are Burberry cashmere scarves made?What tones are used in the AU24 collection?What is one of the AU24 seasonal micro prints?...

Legendary Sports and Athletes 2024-09-20

15 Items: Golf legend, won 15 major championships.Brazilian soccer star, won three World Cups.NFL quarterback with seven Super Bowl victories.Tennis champion with 23 Grand Slam singles titlesSwimmer with the most Olympic gold medals in history.Gymnastics superstar with multiple Olympic gold medals.First African American to play in Major League Baseball....

11.The 1950s saw the rise of consumer culture in the United States, as Americans began to embrace a new era of abundance and materialism. 2023-03-04

20 Items: ibmpepsifordismcocacolakelloggsbrandnamesadvertisingconsumerismcreditcardsassemblylineshoppingmallspopularbrandsgeneralmotorsmassproductionappliancestoresgeneralelectricinstallmentplansdepartmentstorespostwarprosperityplannedobsolescence

Mouse Word Search 2026-02-06

1 Item: mole cookie bird snail mail summer winter spring fall seed frog toad lizard kite friend year letter calendar Squirrel turtle hibernate

OurDay Work Search 2022-08-29

1 Item: The name of the new ERP system that is being implemented at MUSC

0817 Let's do it ! 2022-08-16

18 Items: Baguettes are from ________.definition: very smooth, not bumpyIn the past, bad ____ lied to people.May I have some _____ cookies, please?We should _________ our homework soon.Betty never lies. She is very _______.That's why "a baker's ______" means 13!This necklace is worth a lot of _______.definition: to move something around an area...

19th Century History 2023-03-14

18 Items: to legally voidthe right to votethe idea of withdrawing,system of underground routesexpansion of the united states in size.an individual who wanted to end slaverynative americans forced from their landsemployment based on friendship and loyaltythe way of getting territory through living or by force...

Ecclesiastes 1-6 2026-04-22

18 Items: exploreAll is ____ 1:2Do not be _____ with your mouth5:2therefore let your words be _____.5:2who can have _____ outside of Him?2:25there is nothing _____ under the sun 1:9there is no______ of earlier things 1:11the _____ will lift up his companion4:10He has also set _____ in their heart 3:11He will make do with them like a _____6:12...

Homeroom 204 people: It is important that you know each of your classmates by name. You will address classmates by their correct names this year. 2024-08-24

26 Items: ZOELEOLIAMJOSEKHLOEAKIRACYRUSBRIANLIBNYYIANNAMAGGIEDANIELJULIANJAYDENAUBREYELIANABENICIOCRISTELJANELLEWILLIAMJOHANNAJAYLANIVERONICAREYMUNDOADONISJESUSZYSZCZYNSKI

Bed Word Search 2025-11-10

17 Items: – Technical name for the nail.– Half-moon shape at base of the nail.– Area where new nail cells form and grow.folds – Skin that surrounds the nail plate.groove – Slit or furrow along the nail sides.– Dead, colorless skin attached to nail plate.edge – Nail part that extends past the fingertip.– Fibrous tissue connecting bones or holding organs....

Fry words 2023-12-11

1 Item: Over Just Sound Name Take Sentence Only Man Little Think Work New Know Back Live Years Place Sentence Just Sound Little our Name Only Think Work Over Know Place Live Man Back New Take Years

Unit 8: Toxicity and Wastes 2024-04-25

18 Items: diseases that are caused by pathogensmostly chemical and construction wastediseases that aren't caused by pathogenschemicals are magnified through food weban increase in death rate over a large areachemicals in the body that build up overtimepathogen causes rapid increase in local death ratetype of infectious disease that is newly discovered...

Unit 8: Toxicity and Wastes 2024-04-25

18 Items: diseases that are caused by pathogensmostly chemical and construction wastediseases that aren't caused by pathogenschemicals are magnified through food weban increase in death rate over a large areachemicals in the body that build up overtimepathogen causes rapid increase in local death ratetype of infectious disease that is newly discovered...

BBB4M Unit #1 Review 2026-03-09

18 Items: Sends goods or services to another country.Are taxes or duties put on imported products or services.Is the amount of worth that is added to a product at each stage of processing.Brings products or services into a country, for use by another business or for resale....

Chemistry Chapter 1 2025-11-13

14 Items: The change from gas to liquidA change that forms a new substanceAnything that has mass and occupies spaceThe process in which a liquid changes into a solidThe process in which a liquid changes into a vaporan example of a substance that undergoes sublimationThe temperature at which a solid changes into a liquid...

Branding Wordsearch 2025-10-24

14 Items: funnestest class LOLtry-hard funny not so funnywonk wonk wonk classroom funnyrelationship with a distribution partnerconsumer’s commitment to continue using a brandme cant wait to go home and i bet you too classsomeone who is interested, involved and engaged in the eventpractice of using a successful brand name to launch a new or modified product...

Space 2023-03-09

14 Items: the biggest asteroid is namedhow many lightyears across is the milky waythe name of the largest volcano in our solar systemThe Hertzsprung-Russel Diagram of stars (see other)the element inside the tank that exploded the Apollo 13rounded to the nearest hour, how long is a day on jupiter...

Social Studies 2026-02-24

23 Items: Amendment Made Slavery IllegalCommitted by a juvenile that would not be a criminal offense as an adult.Amendment Intended to give all male citizens the right to vote no matter their skin color.involves the breaking of a law set up by the government. Two types include misdemeanors and felonies....

A+Unit 8 2025-05-19

18 Items: –We can trade our toys for fun.–I like to relax by reading a book.–She is not only smart but also kind.–I will be done with my homework soon.–This cake is so delicious, I want more!–We walked one kilometer to get to the park.-We poured condensed milk on the shaved ice.–Long ago, people came to colonize new lands....

The Age of Exploration 2023-11-15

12 Items: A settlement of peole living in a new territoryA leader in the spanish conquest of the AmericasA person mixed with African and European descentThe slave trade route from Africa to the AmericasA large plot of land to grow sugar,cotton,and vanillaA person of mixed European and Native American descent...

Boom or Bust 2025-04-02

12 Items: right to votegave women the right to votedark thick liquid commonly called oil.A sudden, extensive, or notable, disaster or event.A town undergoing rapid growth due to sudden prosperityindependent oil operators who searched for new oil fieldsAn economic principle which says that prices change when supply or demand changes...

Topic 7 Part 2 2026-02-12

14 Items: deliverance from sinto see in the best possible lighta person who wanted to end slaverythe protection of natural resourcesthe views held by people, in generalthe campaign against alcohol consumptiona person who cannot pay money he or she owespeople who have a certain concern or belief in common...

Patterns of Earth & Sky 2026-01-30

14 Items: To move around another object in spaceA dark shape made when an object blocks lightThe brightest star seen in the night sky from EarthA large, bright star found in the constellation OrionA scientist who studies stars, planets, and other objects in spaceA tool that uses the position of the Sun and a shadow to tell time...

Revelation Word Search 2025-06-29

1 Item: Times, Kingdom, New Covenant, Abomination, Sixth Seal, Trumpets, Bowls, Theif In The Night, Bridegroom

Madagascar 2025-07-08

1 Item: marty gloria Melman penguins leemers zoo zookeepers king Julian rainforest Africa New York madagascar

1st grade spelling 2026-01-29

1 Item: nail, train, rain, tail, boat, float, coat, load, one, would, could, new, were, come

Famous places around the world 2024-07-19

12 Items: - Home to the pyramids of Giza and Sphinx.- Known for its Opera House and harbor bridge.- Famous for its canals, gondolas, and St. Mark's Square.de Janeiro - Famous for its carnival and Copacabana Beach.- Known for its ancient history, Colosseum, and Vatican City.- Known as the City of Lights and famous for the Eiffel Tower....

End-of-School Word Search 2026-04-29

17 Items: eat, hydrate, and sleep ____.hopeful and confident about the future.a sequence of actions regularly followed.an opportunity to test or develop your skills.able to adjust to new situations or challenges.persistent in pursuing a goal despite obstacles.to provide a reason or incentive to act or work.actively participating in your learning process....

Persuade Word Search 2026-03-26

8 Items: Exact and accurateA person that you have met but do not know wellA standard by which you judge, decide about, or deal with somethingShort and clear, expressing what needs to be said without unnecessary wordsTo make someone do or believe something by giving them a good reason to do it...

Unit 4: Spelling Quiz 3 2022-12-16

30 Items: an advantagepeacefulnessunintentionalto make worseaccountabilityentirely; completelyfeelings of sympathyimpenetrable by lightat every time; foreverone of the United Statesto accept as true or realone half of a school yearthe quality of being calmright fine; satisfactory; goodone who is sent out on a missionthe principle of life; vigor; energy...

Unit 13 Word Search 2026-01-31

29 Items: a five-pointed stara shape with four sidesa shape with five sidesa shape with three sidesa period of three monthslikely to argue or fightoccurring every five yearshappening four times a yeara vehicle with three wheelsa solid shape with five facesmade in three identical copiesa musical scale with five notesan animal that walks on four legs...

Plant Diversity 2025-11-11

13 Items: The part of a plant that makes foodThe part of a plant that holds the seedsplant A plant that does not produce flowersplant A plant that produces flowers and seedsThe part of a plant that can grow into a new plantA tall plant with a thick, woody stem called a trunkA tiny non-flowering plant that grows in damp places...

Griffith Observatory Glossary 2023-11-14

20 Items: a fluid state of matterthe study of space & everything in itthe layer of gas that surrounds Earththe 6th element & chemical basis for lifea place for observing & studying objects in spacea pure substance containing only one type of atoma celestial body of gas that generates light & heata zone around a star where temperatures are just right...

Technological Innovations of the 21st Century 2025-04-14

10 Items: CLEANENERGY : Energy that is produced using renewable and non-polluting sources.GENETICEDITING : The manipulation of an organism’s DNA to achieve desired traits.VIRTUALREALITY : A simulated environment that can mimic or completely alter reality.INNOVATE : To introduce new ideas, methods, or devices to improve or advance a field....

U2-1 2025-08-02

10 Items: The way that someone or something looks.To express the sense of words or text in another language.Elaborate or decorative; or, to feel a desire or liking for.To cause (someone) to believe firmly in the truth of something.A person who is in charge of a department, organization, or film....

Taxes & Investing 2024-12-12

13 Items: cash or currencyimpose a tax, fee, or finetax, tax imposed on the sale of goods and servicesloan that the bond purchaser, makes to the bond issuersomething that a person or company owes, usually a sum of moneytax or duty to be paid on a particular class of imports or exportsincome taxes, levied by federal and state governments on business profits...

Executive branch 2025-04-23

17 Items: The spread of a secretCovering of a wrongdoingHighest-ranking diplomatic officerlead staff member of an administrationWritten directive, signed by the president,Process of electing president & vice presidentResponsible for the day-to-day management of the governmentOversees the performance of federal agencies, and administers...

Fleet Farm Word Search! 2025-07-20

17 Items: Where we work.Each zone has one of their own.The city our store is located in.The color most associated with us.We sell these in the Garden Center.Auto has a large selection of this.We have our own brand with Eileen's.Our biggest promotional event every winter.You can get this exclusively at our C-Stores....

Journals, Documentation Standards, and NOAs 2026-01-28

8 Items: The amount of time to convert notices to Large Print and Data CD.Form provided to customer after completing a telephonic signature.One of four standard options for alternate formats provided by DHCS.This is required to document all customer contacts and all case actions in CalSAWS....

Pathways to Excellence Knowledge Word Check! 2025-01-31

10 Items: Strategy in place to address physical fatiguePromoting a Culture of Interprofessional decision makingMethod to involve direct care nurses in hiring decisionsAward received by nurses promoting a culture of staff recognitionSurvey that allows staff to provide input into wellbeing initatives...

Unit 4: Spelling Quiz 3 2023-01-04

30 Items: an advantagepeacefulnessunintentionalto make worseaccountabilityentirely; completelyfeelings of sympathyimpenetrable by lightat every time; foreverone of the United Statesto accept as true or realone half of a school yearthe quality of being calmright fine; satisfactory; goodone who is sent out on a missionthe principle of life; vigor; energy...

Sip & Search 2025-09-18

29 Items: Who is older?Bride’s Last Name?Groom’s middle name?Who is the flower girl?Who is the maid of honor?Who said I love you first?What does the Bride collect?Who was the wedding planner?Who made the bridal flowers?Bride’s favorite football team?Who played cupid for the couple?What school did the couple go to?What is the Bride’s favorite color...

Precision in Academic Vocabulary 2025-04-14

10 Items: EVALUATE : To assess the value, quality, or significance of something.SYNTHESIZE : To combine different ideas or information to form a new whole.ANALYZE : To examine something in detail to understand its structure and meaning.FORMULATE : To create or develop a clear and systematic plan, theory, or solution....

Lesson 11: Do Now 2026-05-05

10 Items: A white European personA Māori chief or leaderThe Māori concept of balance or revengeThe last name of Edward Gibbon and his brother WilliamHow many articles are included in 'Te Tiriti o Waitangi'A formal agreement between two groups, such as the one signed at Waitangi in 1840...

Re’eh 5.0 2025-08-16

20 Items: Yeshua said, “I am the bread of _______.”This festival recalls leaving Egypt in haste.Yeshua said the bread He gives is His ______.What kind of birds are specifically forbidden?In the Shemittah year, what is to be released?This festival is also called the Feast of Weeks.What food did the fathers eat in the wilderness?...

Volleyball 2025-09-14

20 Items: A serve that lands untouched for a pointMen’s team that won the 1976 Olympic gold medalThe men’s net height in volleyball is 2.43 metersDefensive move at the net to stop an opponent’s spikeNation that dominated women’s volleyball in the 1990sCity and year where volleyball made its Olympic debutPlayer responsible for attacking the ball over the net...

commerce find a word 2024-10-17

16 Items: items of valuebest teacher in the worldvery safe and secure sharesa tax on the profit of a companya part ownership of a public companyvalue of an asset increases over timeacceptable to society’s current standardsall the investments owned by an individualplace where shares in public companies are bought and sold...

Taylor's Word Search 2023-11-26

1 Item: ceremony, bulldog, reveille, MIT, trumpet song, mean girls suck, new friends are awesome, gas chamber, covid,new car, Christmas, Portdawg, San Antonio, Marching, drill, sleep, ice cream, dress blues, coffee, family, I miss my phone, accomplished, proud, F

New Year's Resolutions 2023-12-14

1 Item: Auld Lang Syne, Smash plates, Dress in Dots, Lucky grapes, Wear white, open doors and windows, carry empty suitcase, burn scarecrow, polar bear plunge, make some noise, fireworks, drop whipped cream, Times Square ball drop, light sparklers, midnight kiss,

Age of Discovery 2025-12-09

1 Item: Columbus, New World, exploration, slave trade, discovery, gold, plantation, old world, tobacco, disease, Magellan, columbiaexchange,

Chapter 2 - Age of Exploration - myWorld Social Studies 2023-01-26

16 Items: great harma conquerorto travel completely aroundan instrument used in navigationa person who buys and sells goodsa settlement far away from the country that rules ita group of nations or peoples ruled by a single authoritythe process of charting a course for a ship or an aircraftan organized group of people taking a journey for a purpose...

Loss Drafts Module 2023-09-21

16 Items: _____Authorizations last 24 hours.The tab you go to to open a new claimIn claim documents S stands for _____.In claim documents P stands for _____.In claim documents U stands for _____.We base the timeframe on the ______ date.We typically search for claims using the ____.Where we leave notes on the claim about the call....

1 Year Aniversary 2026-04-25

1 Item: Where did we first meet

Women of UPS (March, 2023) 2023-02-24

13 Items: EVP & Chief Corporate Affairs and Sustainability OfficerFirst woman package car driver, beginning in 1943, Los AngelesBoard of Director - President and CEO of Lumen Technologies, Inc.UPS’s first woman pilot, joining the newly founded airline in 1988Board of Director - Group President, Pfizer Biopharmaceuticals Group...

Vocabulary Text Smart 1 Station2 2026-03-09

10 Items: BildThe white keys of old pianos were often made from ...After walking in the sun, I was so ... that water never looked so good.My little sister thinks she’s a ________ because she has 200 followers.The doctor told me to take my ________ twice a day so I can feel better.Polar bears will become ... in a couple of years: There are only a few left....

[Autumn] September 23, 2025 [Vocab Worksheet] 2025-09-23

30 Items: Bonus sectionUnder a spell; magical.Dark, shadowy, or obscureFear of the number thirteen.A ghost or haunting presence.A form of literary expression.Strange, mysterious, unsettling.An illusion or ghostlike figure.To enchant or cast a spell over.Mysterious or hidden in meaning.Horrifyingly shocking or dreadful.An unexpected or ghostly appearance....

Juliana 2025-04-23

11 Items: Started a group called the JesuitsWrote institutes of the Christian ReligionBurned at stake as a heretic hint (born in Bohemium)who revived the old idea of the divine right of kingsPublished a new Latin and Greek version to Nee Testament______ people were dead after wars between Catholics and Protestants...

Thin Word Search 2025-05-09

200 Items: newpieinnwaydiebayegothinbushsoakweardealmonkfacebiteplugselfcasequitmaskbellhelpsizeroofcropkillsavebombcarehangmovefearbarklovevainmazemildfroggaspfadesellmeatfearfoolsandwillglowstirtickfirsttradequeenplaceabuseshellswinggaffeslumpdancetermsgianttrainwoundbuildblamelearnsiegetwistdelayawarestriptiredsleepdeterqueueswipemanagepublicstrollnotion...