new year Word Searches

Megan and Chris 2024-11-17

24 Items: What is Chris' hobby?Where was Megan's first job?What is Chris' favorite food?What was their college mascot?What town did Megan grow up in?What instrument does Chris play?What color are the groom's eyes?What month did they get engaged?Where did David and Eileen meet?What is Megan's favorite tv show?Where is the couple honeymooning?...

Golf 2025-09-14

20 Items: Left-handed golfer nicknamed “Lefty”Charismatic golfer nicknamed “The King”German golfer who won the 2014 U.S. OpenSouth African who won the Masters in 2008Golfer who won a record 82 PGA Tour eventsScottish course known as the “Home of Golf”Won the 1997 Masters by 12 strokes at age 21South African golfer Gary who won nine majors...

Choice Word Search 2024-11-11

19 Items: an apartment buildinghow heavy something isstories, poems and playsdepartment that sells productspersuade someone to by somethingunit of measuring liquid in Europeopportunity to decide between optionsowned/ used by someone else before meworried that something bad will happenunit of measuring liquid in the UK and US...

SIMPLE PAST 2023-08-31

15 Items: We _____ the movie last week.She _____ 24 years old in 2015.The kids _____ to school by bus.They _____ the teacher to speak slow.The athlete _____ 5 miles in 24 minutes!I remember I _____ about animals in class.Mr. Johnson _____ a cat, but it died in March.My roommate _____ all the cookies in our house....

All about the Lab Word Search 2025-04-08

15 Items: AlarmingThe name of our labThe platform we analyze raw data onThe last master mix that is made is_Name of the folder .txt files go into_ process has Molecular Inversion ProbesAn equipment that fluctuates temperaturesCompare these on the tubes and worksheetsThe machine needed to spin down a plate is a _SOP version of the document we use for Analysis...

ss 2026-02-24

20 Items: taking away the right to votean entrepreneur that created the Atlanta Mutual Insurance Companyraised the morale of the Georgia Patriots gave them needed suppliescreated to keep the races separate in the South after Reconstructionleader of the Populist Party in GA, known for the Rural Free Delivery Bill...

CCR Word Search for Extra Credit 2025-05-01

11 Items: Central bank of the United States:Current secretary of the treasury:Current chair (leader) of the Federal Reserve:A government-issued bond that lasts for 30 years:A government-issued bond that lasts for 1 year max:A government-issued bond that lasts for 2-10 years max:If a bond you buy is rated AAA, then this is that bond's:...

ROCKS! 2026-01-07

7 Items: this type of melted rock is found inside the Earth.a type of rock formed by compacted and cemented sedimenta type of rock formed directly from cooled magma or lava.this type of melted rock is found on the outside of the Earth.this type of crust, or tectonic plate,is found beneath the ocean!...

Minnesota 2023-01-24

30 Items: hockey teambiggest lakebaseball teamnot saint paulthe state birdthe metro areaa northern citythe state flowerthe capitol citythe biggest rivera delicious burgerthe real state birdwe get a lot of thiswe got a lot of thesesport you play on icewhere the mayo clinic isour men's basketball teama saying to express dismayour women's basketball team...

ORIGINAL 2023-02-21

1 Item: genuine, true, innovative, unique, creative, unconventional, fresh, new, inventive

V5 1-16 2025-10-30

17 Items: – not afraid; brave.– easy to reach, enter, or use.– taken away by force; kidnapped.– not able to bend or change easily.– told or taught how to do something.– taking away an amount; subtraction.– a person who gathers and shares news.– rude or unkind behavior toward someone.– not being accepted or being turned down....

95 Word Search 2024-10-09

15 Items: vll had 6 wivesguess about someone or somethinghunt took place from about 1450 to 1750parallel lines covering to a single pointdistinctive among 16th-century reform movementswas a period in history between 14th and 16th centuryitalian renaissance sculptor paunter architect and poetan Italian painter and architect of the high renaissance....

year 6 2025-10-17

1 Item: existence, language, parliament, suspicious, ceiling, foreign, legibly, preferred, symbol, criticise, ghastly, neighbour, programme, temperature,especially, hesitation, official, soldier, thoughtful

The Word Search 2025-04-19

6 Items: the introduction of harmful substances or products into the environment.the presence of harmful substances in the environment, making it unsafe or unclean.the protection and careful management of natural resources to prevent their depletion.the process of converting waste materials into new materials and objects to reduce waste....

Entrepreneurship 2025-08-19

14 Items: A bad workerA company carBusiness loanAuntie AnniesNike paying their taxesWalmart and Target make a dealMcdonalds selling burgers to a customerA bakery has a budget of $5,000 to run a businessStarbucks advertises a buy one, get one free couponA clothing store tracks monthly sales growth to track success...

Online Activities 2025-10-30

8 Items: email To open your email and read or send messages.music To listen to music online without downloading it.games To use your phone, computer, or console for fun games.online To buy things on websites or apps instead of in a store.videos To see short or long clips online, like on YouTube or TikTok....

Recap Unit 9 2024-11-11

19 Items: an apartment buildinghow heavy something isstories, poems and playsdepartment that sells productspersuade someone to by somethingunit of measuring liquid in Europeopportunity to decide between optionsowned/ used by someone else before meworried that something bad will happenunit of measuring liquid in the UK and US...

Essenty Spring Launch 2025-09-03

1 Item: launching under essenty this spring the best thing to ever happen this year selling out quickly

John Cabot 2023-02-15

16 Items: John's last nameThe name of his first shipCabot's first name at birthThe name of John Cabot's sonThe country John Cabot was born inCabot was an expert sailor and _____The country he had actually landed onHe was given the name the great _____Sebastian sailed down the ________ to CanadaThe country John Cabot moved to when he was 40...

Science 10B T3.1 SPACE 2025-09-04

16 Items: A push or pull (5)A negatively charged particle (8)A positively charged particle (6)Two or more atoms joined together (8)A rocky object that orbits the Sun (8)The smallest particle of an element (4)A large body that moves around a star (6)How fast a chemical reaction happens (12)The ability to do work or cause change (6)...

Unit 2.3 - Recruitment, selection and training of employees 2024-11-14

19 Items: employess will usually work 35 hours or more a week.to the point where applications arrive to the business.Occurs by watching a more experienced worker doing the jobis the process from identifying that the business needs to employemployments is often considerd to be between 1 and 30-35 hours a week...

Vocab 7 2023-11-16

12 Items: I got a ___ to search this house.I felt _____ about running the mile.The amount of money they owe is too ________.After she was sick she was ____ from everythingThe little was able to be _____ by the evil witch.After i dropped my phone it was ___ and not workingThe kind begged for his life or he _____ for his life....

EARTH'S RESOURCES 2025-10-09

12 Items: -the careful use of resources.fuel -any hydrocarbon used as a source of energy.warming -the unnatural warming of the lower atmosphere.resources -something that takes millions of years to form.-partly decomposed organic material that is used as fertilizer.power power that falling water generates to produce electricity....

Dialogue: Word Search 2023-10-04

6 Items: ‘Chef’ and ‘Cook’ both words mean someone who prepares food.clause what do you mean when you wrote: “You got home and.”When a teacher and student are talking about his or her homework.A country with no laws and people can do what they want to do whenever they want to....

Dialogue Word Search 2023-10-05

6 Items: What do you mean when you wrote: “You got home and.”‘Chef’ and ‘Cook’ both words mean someone who prepares food.When a teacher and student are talking about his or her homework.A new classmate is very positive and seems to want to help people.A country with no laws and people can do what they want to do whenever they want to....

POSTIES 0127 BIG READ 2024-12-27

6 Items: Oyster shells are mostly made of _____.to make new objects out of waste materialused to describe someone who is slow to act because they feel uncertainBefore the oysters can be sent to Green Island Cement, the hotel staff must _____ and store them.a grey powder used in building which is mixed with water and sand or stones to make a hard substance...

Vietnam Word Search 2025-12-10

23 Items: Capital city in North Vietnam.The Vietnamese lunar New Year.People killed in a conflict or event.Freedom from disturbance; tranquility.Capital city in South Vietnam and was renamed in 1976.Old name for Vietnam when it was a French colonial territory.A person who has been captured and imprisoned by the enemy in war....

Vocab 7 2023-11-16

12 Items: I got a ___ to search this house.I felt _____ about running the mile.The amount of money they owe is too ________.After she was sick she was ____ from everythingThe little was able to be _____ by the evil witch.After i dropped my phone it was ___ and not workingThe kind begged for his life or he _____ for his life....

The American Revolution 2023-10-11

9 Items: freedom from being controlled by someone elsea disagreement or fight between two or more groupsa sudden and complete change in government or social orderagreements or partnerships between different groups or countriescomplaints or problems that are considered to be unjust or unfair...

REFUGEE MENTAL HEALTH 2024-10-08

6 Items: The global organization focused on protecting refugeesSupport that focuses on emotional, psychological, and social well-beingA term for people forced to flee their country due to conflict or persecutionA psychological coping mechanism where someone avoids thinking about traumatic events...

Unit 7 vocab practice 2024-05-03

14 Items: The ___ fireworks lit up the sky.The sudden change of plans ___ me.Cleaning up my neighborhood is ___.The old house had a ___ appearance.I took medicine to help ___ my headache.I put a lid on my water so nobody could ___ it.During war, the invading armies would ___ towns.When we moved into our new house, it was very___....

Forgotten, Word Search 2024-02-02

1 Item: committed, sobbing, quizzed, shipping, recreation, foundation, collection, tradition, ambition, New Jersey, New Mexico, admire, chaotic, museum, practical, prior, proceed, revised, visible, compliment, condemn, defective, deity, emblem, excel, improvise,

Islamyat Word Search 2025-11-20

20 Items: Muttalib Restored the well of Zam ZamNumber of men who migrated to AbyssiniaNumber of women who migrated to Abyssinia“Paradise lies at the ____ of the mother.”Number of Muslims who migrated to AbyssiniaEmbraced Islam in the sixth year of prophethoodEmbraced Islam in the sixth year of prophethoodNaufal Khadijah was a rich widow from this clan...

Matter unit 1 5th grade 2024-08-27

9 Items: how hot or cold something isbe able to be dissolved in a liquidanything that has mass takes up spacethe amount of space something takes upmatter in which a substance does not have a Divine shape or volumestate of matter in which a substance has a Divine shape and divine volume...

NMSI World Environment Day 2024 2024-05-09

10 Items: The process by which fertile land becomes desert.This country is aiming to plant 20 million trees annually.These events are responsible for 60% of worldwide crop loss.The multi-national body who have led world environment day since 1974.Soil fertility has reduced by 60% due to land degradation in this country....

Pinchas 5.0 2025-07-13

16 Items: What tribe was Zimri from?Tzelofchad had how many daughters?What was poured with each offering?Which tribe had no land inheritance?Who did Moses appoint to succeed him?The central figure of this Torah portion.What stopped the plague among the Israelites?Which holiday includes fasting and atonement?What holiday includes the blowing of the Shofar?...

A+ Unit 7 2025-05-12

18 Items: – I feed my cat every morning.– Let’s sort the toys by color.– The books are on the top shelf.– She wants a career as a doctor.– The school play was a big event.– Water is a basic need for everyone.– Let’s set up the chairs for the party.– We used teamwork to finish the puzzle.– He helps care for the classroom plants....

Main types of ecosystems in Mexico with their local characteristics and examples 2025-11-10

10 Items: Low jungles of the Pacific coast (Chiapas, Oaxaca, Jalisco).Mesoamerican Reef (Mexican Caribbean); Veracruz Reef (Gulf of Mexico).Sonoran Desert (Son. /Baja Cal.); Matorral del Valle de Tehuacán (Puebla).lentic bodies; they connect diverse ecosystems, crucial for nutrient cycles....

January 20, 2026 2026-01-20

10 Items: the opposite of creditsa polygon with four angles and four sides.quarters of a plane divided by an x and y axisplane shapes having three or more straight sides.the surface area of the bottom (or top) face of a 3D shape.a fraction expressed as a number out of 100 followed by the % symbol....

Vocab 7 2023-11-16

12 Items: I got a ___ to search this house.I felt _____ about running the mile.The amount of money they owe is too ________.After she was sick she was ____ from everythingThe little was able to be _____ by the evil witch.After i dropped my phone it was ___ and not workingThe kind begged for his life or he _____ for his life....

7th Grade Extra Credit Word Search 2026-03-09

18 Items: EndlesslyNot active or in useA widespread diseaseTo move back or away fromTo include as a necessary stepFriendly, lively, and enjoyableHaving a good outcome; favorableDoubtful; of unlikely authenticityTo explode; to break out with forcePitifully sad and abandoned or lonelyExtremely important; vital in resolving something...

madison 2023-01-25

2 Items: new cast motorcycle overseas quick-witted stomacheache bulletin boarduproar home run headache top-secret teammate wheelchair light bulb well-know throughout life preserver barefoot part-time warehouse overboard post office outspoken up-to-date

January 20, 2026 2026-01-20

11 Items: Ratiothe opposite of creditsa polygon with four angles and four sides.quarters of a plane divided by an x and y axisplane shapes having three or more straight sides.a fraction expressed as a number out of 100 followed by the % symbol.of the Base the surface area of the bottom (or top) face of a 3D shape....

Your name's fine. Just your name. (Audrey) 2025-04-23

10 Items: The pilgrims were a specific group of?Who published the new testament in Greek?Who was from what is now the Czech Republic?What war ended with the signing of Westphalia?Who called for reform just to divorce his wife?Who was from England and translated the Bible into English?...

Love and Relationships 2025-02-13

15 Items: ‘Porphyria ____ me’ – Porphyria’s Lover‘The ____ had given their all’ – Winter Swans‘They ____ to me from the other bank’ – Eden Rock‘Nothing in the world is ____’ – Love’s Philosophy‘More like a ____ little fay’ – The Farmer’s Bride‘Pale grew thy cheek and ____’ – When We Two Parted‘And breathe within thy ____ a new air’ – Sonnet 29...

WHI.1 Vocabulary Practice 2025-05-24

15 Items: more than necessary ________________________way of life of a society _____________________skilled craftspeople __________________________also known as the New Stone Age ______________________________also known as the Old Stone Age ______________________________way of life characterized by little movement _______________________________...

LFW- HR POLICY WORD SEARCH 2023-05-18

10 Items: one of the value of LFWExpenses expenses that cannot be reimbursedMandatory three month every new hire has to serveWhat needs to be checked for accurate paid days dataMonth Tenure of notice period an employee has to serveOff leave that has to be utilised within 1 month’s spanMinimum no. of hours an employee has to give to call it a half day...

Voca 4000 Lesson 11 & 12 Review 2025-10-20

15 Items: to go away (le***)to take place; occur (ha****)a problem or trouble (mat***)having little strength or power (we**)a community of people as a whole (pub***)to come to or reach a certain place (arr***)as much or as many as needed or required (en****)all the members of a community or group (soc****)the ability to manage someone or something (co****)...

Final Review 2025-12-17

17 Items: Variations of a trait.A part of a nucleotide.The site of translation.A change in the DNA sequence.Having two different alleles.Made by a chain of amino acidsType of cells produced by meiosis.The process of new species forming.A group of the same species in an area.When the last member of a species dies.A structure that no longer has a function....

NMSI World Environment Day 2024 2024-06-04

10 Items: The process by which fertile land becomes desert.This country is aiming to plant 20 million trees annually.These events are responsible for 60% of worldwide crop loss.The multi-national body who have led world environment day since 1974.Soil fertility has reduced by 60% due to land degradation in this country....

WHI.1 Vocabulary Practice 2025-05-25

15 Items: more than necessary ___________________skilled craftspeople __________________way of life of a society ____________________also known as the New Stone Age ____________________also known as the Old Stone Age _________________________way of life characterized by little movement _________________...

Unit 10 Cell Growth and Division Review 2026-04-01

15 Items: Programmed cell deathstructure that creates spindle fibersGenetic information packaged into bundlesPart of Cell Division where the nucleus dividesthe splitting of one cell into two daughter cellsDevelopemental stage where cell differentiation beginsstructures are involved in moving chromosomes during mitosis...

Mohican People Unit 3 Word Search 2024-10-25

10 Items: Introduced to the Americas by EuropeansDisease that killed many Mohicans brought by EuropeansRiver where the Mohicans originally lived to the west ofCreated after Henry Hudson arrived in the Mohican CommunityWhere the Mohicans moved after conflicts in the early 1700sWho declared the land where the Mohicans lived by "right of discovery"...

Environmental Policy and Global Challenges 2025-04-14

10 Items: Emissions : The release of harmful gases or pollutants into the atmosphere.Sustainability : Meeting present needs without compromising future generations.Ecosystem : A community of living organisms interacting with their environment.Conservation : The protection and preservation of natural resources and ecosystems....

Cotton 2025-10-18

10 Items: The process of crossing threads to make fabric.A large farm where cotton and other crops are grown.Twisting cotton fibers together to make yarn or thread.The time when farmers collect ripe cotton from the fields.A fabric or cloth made by weaving or knitting cotton fibers.The cleaned cotton fibers that are ready to be spun into thread....

July word seach 2023-07-05

13 Items: Name of the L&D newsletterPresident of ICAST (Last name)ICAST was founded in this stateYou might get some great "cooking" tips watching herThe Learning Management System (LMS) we use - called ___1Selected ICAST as the multifamily program implementer in DCOnly ICAST employee in New Jersey (First name) as of 6/30/23...

Week 12 2023-05-17

15 Items: Another word for _________________ is new.I would love a ______________ pokemon doll!He _______________ the cookies for the party.Crabs and lobsters are ______________________.Their form of ____________________ is dancing.A cat in a tree writes _______________ for me.The water was too ______________ so I got sick....

Unit 7 Vocabulary 2026-02-19

15 Items: Same structures used in different waysFertilized egg/early developing organismWhen a species is no longer present on earthStudy of early stages of development in embryosDifferent structures used for similar functionsNewly adapted/evolved traits used on a cladogramTwo closely related species evolve together over time...

IDPE 2026 Annual Conference Wordsearch 2026-03-24

15 Items: Toucan's Workshop (3 words)'_____ in all it's forms' - Affixius workshop'Regular giving: Setting __________ that work'Leadership forum: 'Bringing you _____ on board'Alumni relations forum focused on engaging (___-_)'Identifying and engaging your future ___________)Day of the week you can attend all of these sessions?...

Angel Word Search 2024-05-08

1 Item: peace, God, romance, proposal, Bible, Jesus, engagement, abundance, freedom, health, dating, enlightenment, growth, dating, create, new, courage, faith, opportunities, second chance, new job, healing, faith, moving, building, entrepreneur, school, lessons

Angel Word Search 2024-05-08

1 Item: peace, God, romance, proposal, Bible, Jesus, engagement, abundance, freedom, health, dating, enlightenment, growth, dating, create, new, courage, faith, opportunities, second chance, new job, healing, faith, moving, building, entrepreneur, school, lessons

Plate Tectonics Vocabulary 2026-01-07

17 Items: Plates move apartThe outmost layer of the EarthPlates collide or smash togetherThe innermost layer of the EarthPlates side-slip past each otherThe third outmost layer of the EarthThe second outmost layer of the EarthThe longest chain of underwater mountainsWaves that spread through Earth's interiorThe downward movement of a plate into the mantle...

Jobs! 2026-04-09

17 Items: A person who works on a boatA professional sports playerSomeone who works for the newsA person who can fix your toiletA person who works in the militarySomeone who works putting out firesA person who shows you around a new cityA person you see when you want legal helpSomeone who constructs houses, schools, etc....

Encuentra las palabras 2025-08-08

1 Item: steeet Food, cheese, bacon, Wings, sabor paralelo, New York, caprichosa, cariñosa

Life Cycles 2025-11-11

11 Items: The adult bird that lays eggsA young plant that has just started to growThe larva stage of a butterfly that eats leavesThe first stage in the life cycle of many animalsThe stage when a caterpillar changes inside a cocoonThe young stage of a chicken that hatches from an eggThe adult amphibian that can live on land and in water...

A Job Defined: Fashion Buyer 2026-02-23

11 Items: knowledge of a productentering of data into a systemproducts being sold at a particular storebusiness which sells a particular type of productamount of money allowed to spend at a particular timeamount of products and merchandise on-hand at any given timename on a product to help it stand out against the competition...

Angel Word Search 2024-05-08

1 Item: peace, God, romance, proposal, Bible, Jesus, engagement, abundance, freedom, health, dating, enlightenment, growth, dating, create, new, courage, faith, opportunities, second chance, new job, healing, faith, moving, building, entrepreneur, school, lessons

08 2025-08-16

15 Items: a footresta footrest for the riderThe part where the rider sitsSmall footrests for the rider or passengerA device for slowing or stopping a motorcycleFootrests mounted on the bike frame for supportA backrest bar for passenger comfort and supporta term used for the first ride of the new seasonFoot controls used to operate brakes or gear shifts...

Lilo 1 2025-11-17

14 Items: – Unable to be destroyed or damaged.– Likely to cause harm, injury, or damage.– Caught or arrested by authorities; captured.– An extremely cruel, violent, or shocking act.– Impossible to stop or prevent from continuing.– Not allowed by law; against the rules or regulations.– A statement or situation indicating the possibility of harm or danger....

Vowel Team Digraph 2025-04-15

1 Item: clue, crew, fruit, glue, juice, new, threw, true, hue, blew, suit

The Vanderbeeker's of 141st Street 2025-10-01

1 Item: tree, brownstone, Oliver, Hyacinth, Laney, Jessie, Issa, Biederman, Vanderbeeker, New York

The Role of Nurse Residency Programs in Supporting New Graduate Nurses 2025-11-21

4 Items: SafetyBurnoutRetentionCollaboration

Plate Tectonics Wordsearch 2023-02-15

14 Items: The outer layer of the EarthWhen one plate slips below anotherThis continents are in constant ___When this rises and cools, it creates new crustWhen plates push up, it creates this kind of landformType of heat transfer that causes tectonic plates to moveLast name of the scientist who proposed continental drift...

Spelling Test 3 2022-09-23

28 Items: against slaveryhostile; unkindunfit to be eatenthe act of going awayto repeat or say againone who is not a memberbefore recorded historythat which is not nuclearoccurring twice in a yearto stop or prevent an actionapart from one's choice or willto go do, come down, fall, or sinkof the highest degree or importanceextending across the Atlantic Ocean...

Olivia Word Search 2024-03-12

201 Items: trewinwonshugyanitoshwifewildwoolwordyardyearelseheldideasuitsurewearyelltylershaneahmadcarolshanaarifapryorgracejavonjamesjasonjudahjonahwomanworldwouldwritewrongboardbuildbuiltenjoyfieldfifthgroupheavyknownlaughninthoceanprizequiteradioraisescaresincethrewtiredtriedtrulyuntilvisitwe’llwholewhosewomenwroteyoungamongpieceoliviatakeyabryantfadyaa...

6th Grade Final Review 2025-12-12

33 Items: stored energyball on a hillenergy in motionhow energy movesall living thingsstored in nucleusall water on earthcauses earthquakesheating of objectsability to do workspring or rubberbandcurrents in a circuitwaves, voice, speakercar, skateboard, walkingcauses seafloor spreadingpush or pull of an objectprocess of changing position...

SCHOOL 2026-03-24

207 Items: ARTBUSGYMINKMAPPENUSEBANDBELLBOOKDATADESKEDITFACTGAMEGLUELINEMATHPOEMQUIZREADSEATTESTTIMEVERBWALKWORDWORDYEARZEROAPPLEATLASBRAINBREAKCHALKCHAIRCHARTCLASSCLOCKCOLORCUBBYDIGITDRAFTDRILLEARLYESSAYGENREGRADEGRAPHGROUPINDEXJUDGELABELLEARNLUNCHMUSICNOTESPAINTPAPERRULERSHARESTORYSTUDYTABLETHINKTIMERTOPICTRACEVALUEVOICEWRITEANSWERAUTHORBINDERCAMPUSCRAYON...

Organometallic Chemistry Word Search 2023-11-09

11 Items: Precursor to dihalocarbeneTransition metal found in Grubbs' catalystGas byproduct in Grubbs' olefin metathesisTransition metal used in both Heck & SuzukiReactive intermediate in which C has a lone pair, but open octetTransfer of an R group from a main group metal to a transition metal...

ASTRONAUTS 2024-02-08

13 Items: Soviet cosmonaut and the first woman to travel into space.First person to walk on the Moon during the Apollo 11 mission.American astronaut and the first person to fly in space twice.Soviet cosmonaut who became the first person to conduct a spacewalk.American astronaut known for the "Wright brothers" moment on the Moon....

Family Finds 2024-03-12

201 Items: trewinwonshugyanitoshwifewildwoolwordyardyearelseheldideasuitsurewearyelltylershaneahmadcarolshanaarifapryorgracejavonjamesjasonjudahjonahwomanworldwouldwritewrongboardbuildbuiltenjoyfieldfifthgroupheavyknownlaughninthoceanprizequiteradioraisescaresincethrewtiredtriedtrulyuntilvisitwe’llwholewhosewomenwroteyoungamongpieceoliviatakeyabryantfadyaa...

Echo Prea Word Search 2025-08-10

20 Items: The year PREA was signed into lawA person confined in a juvenile facilityA person who has experienced sexual abuseA confidential way for inmates to report abuseKeeping reports and victim identities protectedThe act of notifying staff or authorities of abusePREA standard requiring no tolerance for sexual abuse...

6th Grade Final Review 2025-12-12

33 Items: stored energyball on a hillenergy in motionhow energy movesall living thingsstored in nucleusall water on earthcauses earthquakesheating of objectsability to do workspring or rubberbandcurrents in a circuitwaves, voice, speakercar, skateboard, walkingcauses seafloor spreadingpush or pull of an objectprocess of changing position...

128.The film The Seven Year Itch featured the famous scene of Marilyn Monroe standing over a subway grate as her skirt blows up. 2023-03-08

38 Items: filmposeplaysceneskirtstylesmilecharmfamousiconicbeautycinemabreezepleatsallureblowsupactressfashionglamourclassicsidewalkelegancehollywoodmoviestarsexsymbollegendarypinupgirlwhitedresshalterneckfemininitysubwaygratephotographynewyorkcitystreetscenemarilynmonroecheesecakeshotblondebombshellthesevenyearitch

Sustainability 2024-10-09

12 Items: The variety of all living species on the planetMass destruction of forests, often for agricultureKind of energy obtained from the heat inside the earthThe process of reusing waste as raw material for new productsThe ability to do work, often obtained from renewable sourcesThe presence of harmful substances in the air, water, or soil...

Abraham, Lot and Hagar--Genesis 13 and 16 2026-02-21

12 Items: Command given to Hagar regarding her mistress (16:9)Abram's wife who dealt harshly with her servant (16:8)What broke out between Abram’s and Lot’s herders (13:8)Promise made to Hagar regarding her descendants (16:10)The well-watered region Lot chose for himself (13:10,12)The direction Lot traveled to reach his new home (13:10)...

CHOO CHOO! 2025-11-06

88 Items: BHRLRKFLGMRCTUSBFDEMYFNORICSKNDENGRABERNLCWASWILLAKPAKJSPSAVCRNOSCSPTCHIPLOSPIINDWTINEWTOPAKYNOLBOSRTEWORBALBWIALIBRKDETPNTARBMSPWINSTLSEDJANWFHBNCGROFAYSSMSOPFARDVLHASHLDCLAMETNWKTRERATRNOALBBFXNYPYNYSKYCLETOLADMASTPDXSLMHARPHLPGHPVDSPBMEMELPHOSDALPROALXLYHKELALD

Job thingy longer 2025-11-14

171 Items: aIoftoinisitheonasweanifdonoatbeorbyupsomygometheandyouforwasarenotbutallcanhashertwohimseeitsgethisonehadhowoutshewhonowdidwayusemaynewourmantooanydaywhyputoffoldthatwhatwerewhenyoursaidintomoreliketimemakethanbeenlongveryjustmostknowbackmuchalsocamecomeworkwordmustdoespartevenwellwiththeythisfromhavewilleachthemthenmanysomemadeoverdownonlyfind...

Month of November 2025-11-22

20 Items: Name of brideName of groomNew last nameDavid's favorite animeWho crashed the wedding?Who is your ARC Raiders duo?What property did we stay on?What is your current favorite game?What holiday were you given this on?What is broken bone 1? (Starts with C)What is broken bone 2? (Starts with M)"BLANK" by the sea (Fill in the blank)...

Industrial Revolution Word Search 2026-01-21

24 Items: Steel-making processCo-creator of communismBlack rock used for fuelModernized the steam engineFather of modern capitalismUses steam to power machinesCreator of the Spinning JennyAcute contagious viral diseaseBuilding where goods are producedTurns cotton to threat super efficientlyStimulates immunity to a certain disease...

SS Word Search 2026-02-24

21 Items: Against slaveryForbid Settlement WestRemoving One's Right To VoteCoined The Phrase,"New South"Caused by disputes over SlaveryReplublican Abraham Lincoln WonFighting Over Ohio River ValleyReliied on slavery for economicsPeopleAllowed Black People Voting RightsBelieved In Economic Independence For BlacksA Murder Case Resulting In The Death Penalty...

Alpha Word Search 2026-03-12

178 Items: PCSSEAFLYNEWREDECHOGOLFKILOLIMAMIKEPAPAXRAYZULUCAMOGEARSHIPTECHBASEBLUECAREHOMEKIDSARMYCREWHEROALPHABRAVODELTAHOTELINDIAOSCARROMEOTANGOWHISKASVABBOOTSCODESDRILLDRONEEAGLEHONORPLANESERVEVALORAPRILAWAREBLOOMGREENHEARTPRIDEROOTSUNITYWORLDCADETCADRECHIEFCORPSFLEETMAJORJULIETQUEBECSIERRAVICTORYANKEEATEASEDEFENDDOGTAGHELMETMENTALMORALSSALUTEUNIQUEHANGAR...

Amber & Damon 2026-04-08

63 Items: TimIDoPeteOdieIzzyMimiNanaLiamJaceRingWifeGolfKissLoveBrideGroomFamilyDalaneRonnieChapelDrinksMikaylaWeddingIn LawsHusbandPromiseBest ManLifetimeHoneymoonGroomsmenWild OaksPapa GreenCommitmentBridesmaidBrides NameGrooms NameFlower GirlRing BearerDairy QueenPapa GoodallBlue SpringsNew Last NameOld Last NameMaid of Honor...Do Us PartSunday Drives...

Heather's Mortgage Word Search 2022-10-27

20 Items: Fannie MaeFreddie MacWhat is a 1003To buy real propertyThe number of days the lock is effectiveproperty secured to the repayment of the loanThe numeric value issued by the credit bureauFee paid to an appraiser for preparing an reportThe annual cost or fee associated with a serviceThe first individual listed on a loan application...

Giant Wordsearch 2025-02-27

200 Items: FrogFuzzHiveJazzJerkKneeLavaLimeOatsPinkPunkQuipRiffYawnYearYolkZealZeroZestZoneBakedBlitzBrakeBrushCometDeferEerieFaintFrontGatorGrindHobbyKhakiKnackLadleLyricMoodyNinjaNoiseOnionOrganPestoPrizeQuarkSwampTackyThinkThymeTropeVinylWaterYachtYeastAmountBirdieCaringCheesyCicadaDriverEnigmaEraserExhaleFiddleFrenzyGiggleGildedHeraldHiccupHooplaJumble...

7th Grade Final Review 2025-12-16

34 Items: stored energyball on a hillenergy in motionall living thingsstored in nucleusall water on earthcauses earthquakesability to do workheating of objectsspring or rubber bandcurrents in a circuitwaves, voice, speakercauses seafloor spreadingpush or pull of an objectcar, skateboard, airplaneheat transfer through wavesfossil fuels, food, battery...

2423 2024-05-23

174 Items: cambeldomposbohsrsavtpaykpibuypennewluketonysafepicokidsgolfipadbulkoddstagsrateteamsellopensealcodekeysrailagedsizeslimkevinraniafrankjamesrishiluanaanikaethanpricesportsaleslabelvoidsflooralarmbreakcovershiftstoreclosefloatsweepmusicstylerangejordanjelenaoliviahamishreturnpolicyunisextennisbudgetrosterrefundfaultylightssigninoutletreviewmarker...

Hospital Pharmacy Week 2025 2025-10-06

22 Items: Tum,ta tum, tum tumsGeneric name for Prozac.The opposite of formularybrand name of acetaminophenHumulin R is a kind of____?Our Newest automation/robot.common weight loss injectiondifferent brand name for ozempicGives you a jolt- right to the heart.AKA Easybake oven, stuff of nightmares.Tech with most seniority at the Valley....

Team Logistics and Knowledge Check 2025-11-11

20 Items: the “R” of VARKleading the preceptor bucketfirst step in the ADDIE processlearning the orientation bucketleading the “just in time” bucketlevels used for learning evaluationleading “back to basics” and ACLS/BLScreator of experiential learning theoryjumping into EDR with approach expertiseverbs used when writing learning objectives...

Option G: Urban Environments 2026-02-12

20 Items: Capital of France1/nth largest citySmart city in South KoreaEco/Sustainable City in UAEChinese registration systemWhen two or more cities mergeCity that leverages technologyCity centered around an airportOutward expansion of towns and citiesNew York plan to make it more resilientUrban area with population above 10 Million...

Black History Month Word Search 2026-03-02

20 Items: Invented the gas maskAn activist and film makerFirst African-American airmenSaid the speech "I have a dream"First person to use a synthesizerCalculated the path for Apollo 11Wrote her first poem at 14 years oldMade the Chicago Defender news paperSecond black women hired by Naval BaseFirst African-American Secretary of State...