new year Word Searches

March 2026 Wordsearch 2026-02-18

20 Items: a light gentle windthe state of floweringa brief period of rainmoderate heat in the airdirect light from the sunto begin growing from a seeda colored segment of a flowera new shoot growing from a seeda field of grass and wildflowerssweet liquid produced by flowersprecipitation in the form of raina plant embryo capable of growing...

A Spring Word Search 2026-02-20

25 Items: A baby duckA newbie treeA spring hobbyRed Breasted BirdA colorful insectMarch 20th EquinoxHow a Tulip startsA story of Kafka fameA Day to celebrate treesShowers bring May flowersA classic yellow raincoatA thatched home for birdsFirst signs of plant growthPink or White blooming treeThe first prankish day in AprilThe warming up from ice and snow...

Buscar Word Search 2026-03-18

53 Items: capnewcoatsuitboththisthattobuystorebootssocksshirtskirtjeanspantsdressshoesmaybepricethesethoseblousejacketshortstoweartocostsomuchtoentert-shirtsweaterswimsuitexcusemeLet'sgo!thousandtolookforsweatshirttwohundredsixhundredsalespersonfourhundredfivehundredninehundredthreehundredsevenhundredeighthundredclothingstoreHowcanIhelpyou?tobecorrect/right...

Matt and Grace's Love Story 2025-02-04

17 Items: Matt's specialty homemade dishThe couple's beloved furry companionMatt's new title for outdoor cookingSchool where Grace is pursuing her MBAWhere their story began on a muddy dayEssential morning ritual for the coupleProfession shared by both Grace and MattWhere Grace and Matt moved to live togetherFavorite game to play with Dakota at the park...

Nursing Shortage Word Search 2023-12-01

4 Items: Support What is one reason new graduate nurses are leaving the workforce?Delegation What is one way we can help support nurses regards to staffing ratios?Telehealth What is one of the technology advancements that is helping to decrease nursing shortage?...

Clean & Connect Word Search 2025-09-17

5 Items: The careful use and protection of natural resources to prevent depletionA community of living things interacting with each other and their environmentAnything that is discarded or no longer useful, often a byproduct of human activityThe process of turning used materials into new products instead of throwing them away...

POSTIES 0311 Big Read 2024-02-26

6 Items: another word for rubbishthe opposite of simple and easy to understanda food that is used with other foods to cook a disha piece of electrical equipment that keeps food cold so it stays freshused to describe items that can be processed and used again to create new products...

Adjectives 2022-06-04

23 Items: square, roundwarm, cool, hotold, young, newMexican, Peruviantall, massive, hugered, orange, yellowwooden, glass, metalHis father died. He isAnother word for joyfulthree, ten, a few, severaldelicious, charming, cleanA man that is 6 feet tall isThe country home was very...The man was 3 feet tall. He isShe is only 3 years old. She is...

Editing 1 101025 2025-10-13

13 Items: A specific type of ground or land.A very brief, quick look at something.(Of water) cloudy, muddy, or not clear.Not mapped or explored; unknown and new.The difference or contrast between things.An animal's natural mood or way of acting.By mistake or accident; without intending to.VALUE The obvious or apparent meaning or worth....

When I was Puerto Rican 2024-10-01

7 Items: sullen and ill- tempered; gloomy or in a bad mood.to voluntarily cease to keep or claim; to give up or surrenderin its original condition; unspoiled; clean and fresh as if newnot logically connected; unclear or difficult to understand; lacking cohesionnot expressing or revealing commitment to a definite opinion or course of action....

The battle of the Confederates/Ahzab 2024-09-26

15 Items: Who gave the idea to dig the trench?How many fighters were in the Muslim army?This battle is also called the ‘Battle of ___.’Where did the Battle of the Confederates occur?What defensive measure was used by the Muslims?How many fighters were in the confederate army?What natural event helped disrupt the enemy camp?...

health and safety 2023-02-27

15 Items: warm cover on a bedvery quickly, without waitingtaking air in and out of your bodysheets,covers.that you put on a bedto cover something with cloth or paperthe possibility of being hurt or killedto leave a place because it is not safepeople who come to help you very quicklydoing something when someone talks to you...

Global history l word search (whole year review)-word search for labs 2025-05-30

6 Items: catlionzebrahippoelephantMan's best friend

Online Activities 2026-04-22

8 Items: To open your email and read or send messages.To listen to music online without downloading it.To use your phone, computer, or console for fun games.To buy things on websites or apps instead of in a store.To spend time on apps like Instagram, TikTok, or Facebook.To see short or long clips online, like on YouTube or TikTok....

Fourth 2025-04-17

34 Items: cams sportisaiah's lastAhmed nicknameMiguel nickameJett raises...Girble wears...johnny just gotDavid last nameguillermos aliastroy's twin nameJett school clubDavid's team matelogo david hoodieThree letter nameJack black yells..Chews football teamJohnny just got....Mauricio's nicknamexzavier's main sportAbram listens to....New student in class...

Thin Word Search 2025-05-09

149 Items: newpieinnwaydiebaythinbushsoakweardealmonkfacebiteplugselfcasequitmaskbellhelpsizeroofcropkillsavebombcarehangmovefearbarklovevainmazemildfroggaspfadefirsttradequeenplaceabuseshellswinggaffeslumpdancetermsgiantwoundbuildblamelearnsiegetwistdelaymanagepublicstrollnotionremaintoppleimportminutepleasedangerpacketthroneseriesexceedcattledefinevoyage...

CHAPTER 1 2026-05-06

25 Items: - Self-centered thinking- Group-centered thinking- Beliefs accepted without proof- False or misleading information- Consistent and coherent reasoning- Unbiased and equitable evaluation- Desire to learn and ask questions- Following group opinions or norms- Freedom from errors or distortions- Focusing on important aspects only...

Top Customer 2025-09-19

7 Items: Who has a list of top customers for the branch?It is our job to ___ ___ ___ for our top customers!When does the bank add new qualifying top customers?What fees are automatically waived for top customers?Where can the top customer identifcation be found in Premier Navigator?When does the bank drop customers who no longer qualify as a top customer?...

Immigration and demographics 2025-03-04

21 Items: Legal membership in a country.Official count of a population.A society with many cultural groups.Population growth through birth rate.Official permission to enter a country.Emigration of educated or skilled workers.A person forced to flee their home country.Moving to a new country to live permanently.Leaving one’s home country to live elsewhere....

Immigration and demographics 2025-03-04

21 Items: Legal membership in a country.Official count of a population.A society with many cultural groups.Population growth through birth rate.Official permission to enter a country.Emigration of educated or skilled workers.A person forced to flee their home country.Moving to a new country to live permanently.Leaving one’s home country to live elsewhere....

SAUL’S CONVERSION 2023-04-04

1 Item: MEANS THAT ANYONE WHO BELONGS TO CHRIST HAS BECOME A NEW PERSON THE OLD LIFE IS GONE A NEW LIFE HAS BEGUN CORINTHIANS

Constructive & Destructive Forces 2024-01-23

14 Items: Wide, flat areaLiquid, molten rockMound or ridge of sandDeep crack in the Earth's crustSudden movement of Earth's crust.A deep valley with high, steep sidesA physical feature on Earth's surfaceLand that rises high above the groundMass of land that forms at the mouth of a riverOpening in Earth's crust where magma can rise up...

From the Garden to the Cross 2025-04-01

9 Items: JUDAS (The man who betrayed Jesus with a kiss.)LOVE (The reason Jesus willingly bore suffering.)HOPE (A quality that sustains believers in dark times.)WATCH (What the disciples were urged to do while Jesus prayed)SACRIFICE (The ultimate act of sacrifice given by Jesus on the cross.)...

The basics + numbers 0-31 + calendar 2026-01-30

17 Items: 87-72=...The ninth monthThis word means "years"the first day of the weekThe first month of the yearThe amount of hours in a dayThe first day of the weekendthis season comes before "otoño"We use this word to say thousand in SpanishA way to greet someone after 12pm but before dinner timeAfter this number, all numbers up to 99 have three words...

unit 7 2024-05-01

14 Items: increase demand for waterused to extract substancesone strategy to deforestationused to remove natural gas and petroleumground sinking down into open spaces belowlow population density areas outside the citycities fall apart as people migrate to the suburbsthreats include soil erosion, soil compaction, etc....

Vocab 11 2024-02-16

12 Items: After running 3 miles water is ____.It would be ____ to question her actions.I would love to stay but i don't want____.The new brand _____ all of its competitors.in Order to ______ form a more perfect Union.To ____ i got this answer right i looked it up.Sally's boyfriend didn't dare cross over Sally's ____....

Carotid Word Search 2025-11-20

12 Items: sweating excessivelyawareness and response, awakeCardiopulmonary Resuscitationblue skin discoloration resulting from decreased oxygena device that can deliver electrical current to the heart,: any person between the age of one year and before pubertyadministering an electrical shock to the heart to restore heartbeat...

Mia.H's word search 2023-12-18

17 Items: the little bearthe larger bearproviding own lightlight bouncing off other sourcea person who study and explore the spaceasterisms recognizable patterns of starsmeteorite fragment that reaches the groundway the galaxy that includes the Solar Systemicy body that releases gases as it orbits the sunis a celestial body that is in orbit around the Sun...

Mia.H's word search 2023-12-18

17 Items: the little bearthe larger bearproviding own lightlight bouncing off other sourcea person who study and explore the spaceasterisms recognizable patterns of starsmeteorite fragment that reaches the groundway the galaxy that includes the Solar Systemicy body that releases gases as it orbits the sunis a celestial body that is in orbit around the Sun...

Week 4 2024-09-09

9 Items: plan of the bookthe message the story is tellingthe place were the story takes placethe conclusion and ending of the conflicta sheltered state or stage of being or growthhe elongated wormlike larva of a butterfly or moththe situation between the Antagonist and Protagonist...

Hair 2025-10-21

9 Items: hair only found on new born babiesthe pigment found in hair and skin.the first stage of the hair growth cyclethe final stage of the hair growth cyclethe middle phase of the hair growth cyclescale like cells found on the outer layer of the hairthe base of the hair follicle and produces germ cells for the hair....

Understanding Plate Tectonics 2026-02-13

12 Items: – What forms when plates pull apart on land?– What process forms new crust at mid-ocean ridges?– What supercontinent existed millions of years ago?– Who first proposed the theory of continental drift?– What kind of rock records Earth’s magnetic field reversals?– What percentage of earthquakes occur along plate boundaries?...

Apps & Websites 2026-04-17

18 Items: PinterestNew version X.Started By Nagi.Make docs on google.Where this was made.Old version Twitter.Bureau of meteorology.The ultimate Email app.An apple texting platform.Took Over Mojang Minecraft.A facetime app from google.A red screen with a face in it. Forum.Uses meta and is a social media platform.A forum that has a chubby orange fish icon....

Loversky Word Search 2025-05-01

9 Items: Favorite Movie: "I am Iron-Man"Favorite Song: "Sing Along! ___ ___, Take Me home"Favorite Color: like from the cookie monster to the skyFavorite Subject: reading and writing to understand our worldFavorite Book: A book where a wardrobe leads you to a new worldFavorite Drink: A refreshing and essential drink most people love...

Dividends vs. Buybacks 2025-10-12

10 Items: A buyback is also known as a _______.What is the current tax on stock buybacks?Repurchases can be deferred as __________.Buybacks _____ the number of shares outstanding.Dividends are taxed as ________ in the year received.25% of this metric is the cap on the amount of repurchases (it’s an acronym)....

Vocabulary 8 2025-01-23

12 Items: Mrs. Jaggers is very _______.The driven young man _______ to greatness.The girl had the _________ after her cat died.The old lady began to _______ due to dementia.Snail mail ads are sometimes addressed to ________.The class came to a _______ about the theme of the prom.The man was a _______; he ate the entire pie on his own!...

IT'S CORN 2025-10-18

12 Items: The small seed part of a corn cob.The science and practice of farming.The layer of earth where plants grow.The tall, sturdy stem of the corn plant.A person who grows crops or raises animals.The center part of the corn where kernels grow.The process that helps corn plants make new seeds.The process by which plants make food from sunlight....

welcome to post student life 2025-09-04

16 Items: Liquid motivation for 8 a.m. classesOne person works, everyone gets credit.When sleep and sanity file for divorce.When 12 months just isn’t enough stress.That one-page drama of your entire life.The only social media you update monthly.The mysterious force deciding your future.Where “Can you hear me?” is the new hello....

The Gettysburg Address 2025-09-10

16 Items: ___________ in liberty__________ and 7 years ago.a new ___________, conceived in libertywe cannot consecrate, we cannot __________Now we are ___________ in a great civil warto be dedicated here to the ___________ workthat these dead shall not have died in _________we can not ________, we can not hallow this ground....

Places Around Town Word Search 2026-02-12

16 Items: The place where journalists workThe place where you can exerciseThe place that has mass every sundayThe place where football players playThe place where you see dinosaur bonesThe place where you can buy fresh breadThe place that has shops and restaurantsThe place where you fill your car's tankThe place where you can read lots of books...

Blatant Word Search 2024-10-20

10 Items: ( the way someone see something)(creating news using photographs)(done openly and don't care about it)( a claim to make a different point than a earlier claim)(a story written or told on someones account about an event)( assert that something is what is true without using evidence)( using someones name or something they mode with out authorized...

Departments, Disputes, and Fee 2025-03-26

13 Items: Handles charged off debtsAny dispute needs this to be submittedTransfer here when the statement has 2 due dates.Late fees are % of your monthly mortgage payment.Transfer here when 3 or more months behind on paymentsTransfer here if they need help with an insurance policyTransfer here when lender placed insurance needs to be removed...

ASU Well-being Word Search 2025-02-27

8 Items: Humana's well-being program is called?In March, we focus our wellbeing on this.How many VTO hours do full-time associates receive?April will kick-off Humana's largest belonging event, the 100-day....What provides quarterly metrics and updates on Humana's well-being initiatives?...

Benefits Word Search 2025-05-01

10 Items: Who is our Vision providerWho is our 401K/403B provider?Where can I find a list of my benefits? (abbreviation)How many days does a New Hire have to enroll in Benefits?Who is our Dental provider? ____ Cross Blue Shield of TexasWho is our USRC/SHC Employee Assistance Program (EAP) with.Who would receive my life insurance benefit once I pass away?...

Fall (in) Love 2025-10-31

1 Item: woody halloween october pumpkin, thirtyfirst disneyland festivities date one year surprise costumes loveofmylife spooky bestfriend

0816 Here we go ! 2022-08-16

20 Items: The gas helps the dough ____.These CDs are round and _______.This bread ____ looks very soft.Be careful around the hot ______.These chips are really _________.You can _____ butter on your bread.Water is ________ in the red kettle.Artists ________ beautiful paintings.He sat down in the ______ of the room.You can _____ one and two to make three....

Feelings- Adjetivos-Animals 2023-03-02

20 Items: Its night so it isSpanish word for dog.Its winter so the outside isThe opposite of entertainingThe fact wasn't true so it wasA feeling when someone is cryingThis is a good neighborhood so it isHe is mad, another feeling word for madEveryone is so---of her accomplishmentsA feeling,she is scared around new people...

Vocabulary for Test 2023-05-16

25 Items: an egg or sperma form of a genea fertilized eggrequires one parentpart of a chromosomethe inherited allelessperm and egg combinethe study of geneticsa difference in a traita family tree for a traitan inherited characteristica change to genetic materiala type of asexual reproductionthe process that makes body cellsstructure made of DNA and protein...

My favorite things! *Can you find them all??* 2026-04-17

32 Items: :3XboxSaltLionsTajinTakisDecoraRobloxZOOBLEFloridaKidcoreSALAMI👹👺WeirdcoreDreamcoreHalloweenDr. PepperAnaDraws YTCats KittensDandys WorldSpicy ThingsPaper DragonsRamen NoodlesAce Of Clay YTCookies And CreamEvan And Katelyn YTGangle *MY BABY😭😭😭*Bake Squad On NetflixIs It Cake? On NetflixNew Mexico *Ahh.. I miss my home land😔😞😣🥀🥀*...

Switcheroo Word Search 2024-04-13

24 Items: Bertle _____Aussie cowboy hatOne main characterWhite trunked treesJool's mum's recipeAn inhospitable regionThe station competitionHayley's New York hobbyThe other main characterOne of the station ownersThe nickname given to HayleyChantelle got fired from hereSlugger's favourite lunch foodHis girlfriend nicknamed him this...

fans 2024-09-10

160 Items: gohimybinbeebusbuncupcandendindigeareyeendfunfanfogfadgodhueheyiceinkivyjimjamjoykitmapnodnewnotnapnagnetowloiloptawedballboonbabybackcoolcoldcampDeepdirtdeskdatedoordivedockfacefrogfeedgamegirlgoalgoldgluegoathoophookhandheadheelheapideainchiranjailjustjacklogomeltmilknamenestnicenotenailnetsbloomblissbirdsbelowchaireagereagleeruptexertglovegoose...

July Wordsearch 2025-05-03

20 Items: A cooking device used outdoors.gear Equipment for outdoor adventures.A popular cold drink served at picnics.Activity involving visiting new places.Eyewear to protect eyes from sun glare.Footwear commonly worn during hot days.Moist air, often high during the summer.A central theme of national celebrations.Handheld fireworks used during celebrations....

Back to School 2025-08-03

20 Items: The adult who teaches the class.Schoolwork you take home to finish.The room where you learn at school.A tool used for writing or drawing.A book with blank pages for writing.A table where students sit and work.A child or person who goes to school.The solution or response to a question.Looking at words and understanding them....

traditions and culture 2025-11-03

10 Items: to represent somethinga group of people who sing togethera large meal, typically a celebratory one.something that a group of people usually domusic in the traditional style of a country or communitythe point from which something starts; the cause of somethingto come together, or bring people together, in one place to form a group...

Feelings- Adjetivos-Animals 2023-03-02

20 Items: Its night so it isSpanish word for dog.Its winter so the outside isThe opposite of entertainingThe fact wasn't true so it wasA feeling when someone is cryingThis is a good neighborhood so it isHe is mad, another feeling word for madEveryone is so---of her accomplishmentsA feeling,she is scared around new people...

just about every word 2023-10-01

158 Items: ashiifinnoonupandantbigbutbedbancatcanendelffryfanfatforgetgodhowlowmommannapnewpanpadvetwetyesyumbendbandboatboltcastcasecopydowndumbdoneeasyfirefoodgamegoodhelphandhoophosehowliowajumpjunejulylionlesslumpmoonmissmalemallnoonoverohioridereadstepslamsongsendtimetestundowordwhatwildxrayyarnyoyozoneaprilblamecrapecloneflamefloorfryergummygoosehello...

No Place Like Home 2025-04-29

22 Items: purple Texas wildflowerThe beach we frequentedMy ______ is back in TexasRicky's favorite University- Music festival abbreviationCity where all the yuppies live- Town where Ricky's dad residesFunny name for the collie at A&MExtravagant decor for prom girlsTexas team with pointy head-thingsThe best grocery store in the world...

Echo Word Search 2025-08-09

25 Items: "Sicko Mode" rapper?Kanye West’s new name?"Peaches" singer (2021)?SpongeBob’s best friend?Who is Batman's alter ego?Tony Stark’s superhero name?Who sings “Blinding Lights”?Meme frog known for being sad?Most-used app for viral dances?Who runs fast in the DC universe?GOAT soccer player, Messi or ___?Green Jedi Master from Star Wars?...

Word Search, Geography and Places of Rome 2025-12-31

18 Items: The river where Rome began.The peninsula shaped like a boot.City later renamed by Constantine.Modern name for much of ancient Gaul.Continent where Carthage was located.City where Jesus was said to be born.The sea surrounded by many Roman lands.“New Rome,” capital of the Eastern Empire.Mountains Hannibal crossed to invade Italy....

Spelling/Vocabulary word search puzzle 2022-11-10

15 Items: not alivebring to lifestrong disliking.a small, yellow birdrelating to metaphysics.an animal that feeds on flesh.the form and size of a persons bodythe rebirth of a soul in a new body.a traveling amusement show or circus.a person qualified to practice medicine.relating to the body as opposed to the mind....

Project Management 2024-10-03

15 Items: Moving from the old to the new."a push in the right direction".8-Step Project Management Theory.Going against the flow of change.Run according to law or regulations.Carrying out change within a business.Kotter and Nudge are 2 examples of this.The process or activity of running a business.Competition to your business is referred to as......

Tide Terms 2024-01-20

13 Items: the zone between high and low tidewe ____ through the two tidal bulgesterm for when celestial bodies line upgravitation of this is main cause of the tidesthe changing water levels experienced on earththe tide pattern when the sun earth moon are in syzygythe tide pattern when the sun moon and earth are at right angles...

The Electoral College 2024-10-21

15 Items: ________ DC has 3 electoral votes.This state has 40 electoral votes.Indiana has how many electoral votes?Symbol of the Republican party (animal)Symbol of the Democratic party (animal)This state has the most electoral votes.This southern state has 8 electoral votes.This southern state has 30 electoral votes....

Calvin and Maya 2024-09-02

20 Items: Maya’s favorite hobbyCalvin’s favorite hobbyMaya’s favorite food that Calvin cooksCalvin’s favorite baked good Maya makesCalvin and Maya’s next travel destinationMonth of the year that Calvin and Maya metRoom in BHS where Calvin and Maya first metCalvin and Maya’s favorite local restaurantCalvin and Maya’s favorite food to eat together...

Easter Word Search 2025-03-31

20 Items: Time off workSeason in which Easter fallscompany who makes the Crème EggWhat most Easter Eggs are made fromSpring flower famously from AmsterdamSmall yellow bird that’s newly hatchedDay of the week you get your Easter EggYellow spring flower associated with WalesTraditional roast meat eaten on Easter Sunday...

Super Soft Spring Soiree 2026-04-09

25 Items: The Easter ____The current season"Let's go fly a ____""Somewhere over the..."Marissa's birthday month"April showers bring May..."Week long break from classesA holiday of jokes and pranksAnother phrase for Sakura TreesA day that celebrates our planetGame that the Rumble Ponies playGoing to the park and eating foodHorse with colorful horn on its head...

new settlers 2026-03-24

1 Item: r

New start 2022-11-11

1 Item: exercitiufizic apa soare temperanta aer recreere incredereindumnezeu

New, Word Search 2026-04-04

1 Item: FRUIT, CLUE, FAULT, SAW, CAUGHT, MONTH, AGAIN, HOUR

A+ Unit 9 2025-05-29

17 Items: – Not fun or interesting.– About health or doctors.– Feeling scared or worried.– To show something clearly.– Has something as a part of it.– Programs you watch on television.– Wanting to know or learn something.– Someone getting help from a doctor.– When someone or something stops living.– Being alive or the time a person is alive....

A+ Unit 9 2025-05-29

17 Items: – Not fun or interesting.– About health or doctors.– Feeling scared or worried.– To show something clearly.– Has something as a part of it.– Programs you watch on television.– Wanting to know or learn something.– Someone getting help from a doctor.– When someone or something stops living.– Being alive or the time a person is alive....

New beginnings 2025-12-11

1 Item: positivehabits, routines, personalgrowth, health, meditation, yoga, hobby, gratitude, selfcompassion, organized, financialclarity, socialactivities, volunteer, goals, january, accomplishments, reading, environment, relationships

Guymontag Word Search 2022-08-19

20 Items: The first fireman.The author of the book.What they call earbuds.Mildred Montag's nicknameThe main character of the book.Montag has these hidden in his vent.Mildred's "family" can be found here.Clarisse says that she is 17 and _____.The captain of Montag's fire department.This smells like a perfume to Guy Montag....

Dublin Word Search 2025-06-17

29 Items: Epic ___ DayOur couple’s nameLynda’s dream jobOur favourite teamOur go to take outName of our Big BuddyName of Shawn’s droneWhere does Shawn workCity we got engaged inMonth of our first dateName of our flower girlName of our first danceWhere we had our first dateShawn’s favourite instrumentSport Lynda played growing upWhere Shawn went to university...

Love Story 2025-11-22

20 Items: Who introduced us?Tim's minecraft nameSasha's minecraft nameWhat year did we meet?What is our anniversary month?What month did we meet in-person?What game did you help me download?What will be the name of our first cat?What is the name of our first Stardew child?What game did I give you a coupon to cash in?...

I must betray you 2026-03-16

21 Items: What is Cristian’s last name?What item functions as money?What city does Cristian live in?What is Cristian’s older sister’s name?In what country does the novel take place?In what year does most of the story occur?What type of government controlled Romania?What is the first name of the main character?What is the name of the girl Cristian admires?...

MARVEL CINEMATIC UNIVERSE FILMS WORD SEARCH 2024-05-22

37 Items: THORBLADEANT-MANIRON MANETERNALSBLACK WIDOWTHE MARVELSTHE AVENGERSTHUNDERBOLTSBLACK PANTHERDOCTOR STRANGETHOR: RAGNAROKCAPTAIN MARVELAVENGERS: ENDGAMETHE FANTASTIC FOURTHE INCREDIBLE HULKTHOR: THE DARK WORLDANT-MAN AND THE WASPAVERGERS: SECRET WARSSPIDER-MAN: HOMECOMINGAVENGERS: INFINITY WARTHOR: LOVE AND THUNDERDEADPOOL AND WOLVERINE...

DNA Replication & Protein Synthesis 2024-10-06

22 Items: start codonReplicate AAGBackbone of DNA & RNAWhat does GCU code for?What does UAA code for?The process of making mRNACytosine binds with _______The process of making proteinsProteins are a made of _______Transcribe the DNA code: GATGCACTAThe process in which DNA is replicatedUnlike DNA, mRNA can _____ the nucleus...

Funny Ham Radio 2024-11-19

25 Items: "More power!""Beep boop beep.""How strong am I?""Is this thing on?"Wart (power supply)"Ham radio in space!""Hopefully it's low!""I need more spectrum!"Load (not the operator!)"Chasing those rare ones.""Who can talk the fastest?""Gotta keep the noise down.""My other antenna is a dish.""Just chatting with friends.""Sounds like a blender in here."...

Unit 6 Vocab Puzzle 2 2026-03-26

20 Items: trainingA test given after training endsA test given before training beginsA standard used to measure training successAssigning tasks and responsibility to othersPrograms designed to build leadership skillsPrograms designed to improve management skillsEfforts to improve the organization as a wholeFalse statements that damage someone’s reputation...

My Favorite Things! *Can you find them all??* 2026-04-17

32 Items: :3XboxSaltLionsTajinTakisDecoraRobloxZOOBLEFloridaKidcoreSALAMI👹👺WeirdcoreDreamcoreHalloweenDr. PepperAnaDraws YTCats KittensDandys WorldSpicy ThingsPaper DragonsRamen NoodlesAce Of Clay YTCookies And CreamEvan And Katelyn YTGangle *MY BABY😭😭😭*Bake Squad On NetflixIs It Cake? On NetflixNew Mexico *Ahh.. I miss my home land😔😞😣🥀🥀*...

IIM And LD Module 2023-09-29

26 Items: Where we put notes in the module.The tab you go to to open a new claimWe find documents in the module here.In claim documents S stands for _____.In claim documents P stands for _____.In claim documents U stands for _____.We typically search for claims using the ____.We send the procedure packet on the _________ tab....

Películas clásicas icónicas de los años 70, 80, y 90 2024-09-13

15 Items: friendly alien wants to phone homeGiant shark terrorizes Amity IslandHenry Hill’s rise and fall in the mafiaDinosaurs run wild in a modern theme parkMafia family drama led by Don Vito CorleoneUnderdog boxer rises to fame in PhiladelphiaA priest battles evil to save a possessed girlA time-traveling cyborg is sent to kill Sarah Connor...

Week 17 Thursday 2024-02-04

25 Items: PersonTo excludeA group of alliesIn a joyous mannnerAn arm, leg or wingCareful or cautiousOpposite of backwardTo show or point outSharp-edged utensilsThe right to use powerAble to do many things wellWanting what someone else hasCompeting for a better positionThe first person to create somethingTo rub fat on a surface while cooking...

Golf 2025-09-14

20 Items: Left-handed golfer nicknamed “Lefty”Charismatic golfer nicknamed “The King”German golfer who won the 2014 U.S. OpenSouth African who won the Masters in 2008Golfer who won a record 82 PGA Tour eventsScottish course known as the “Home of Golf”Won the 1997 Masters by 12 strokes at age 21South African golfer Gary who won nine majors...

Hogwarts Magic! 2025-10-13

20 Items: Hagrid's scary pet nameWas killed on Halloween 1981Most haunted place in EnglandWas reopened on Halloween 1992sacrificed herself on HalloweenWho was the Death Day Party for?The creature studied on page 394Needed to be saved on Halloween 1991Attacked the Fat Lady on Halloween 1993This character was petrified on Halloween...

AMAZING 2018-02-20

156 Items: heyhaydaybaymaytaypaywaynayfaycaykayjaywonwintinbinminlinpinfinrinsinzinvinyinvancanmandanlanpantanranyansanwanjanboytoyhoyjoypoyloyroywoymoynoyvoycoyzoysoykidbidfidpidridsidwidcidzidfornownewnottontennetwetfewdewpewtwofanboypoddottotpotmotnotlotyothotjotgotfotrotwotzotcotvotsotwipdiplipsiptipripviphipcapgaphaplapmapnapvaprapyapwapsapbundungunguy...

F6 Module 3,3a 2023-11-20

44 Items: (n) uba(n) õlg(n) mask(n) rütm(n) pähkel(n) kostüümellu ärkamavaimustuses(adi) kuldne(adj) tüdinud(adj)pettunud(adj) ovaalnetänavarongkäik(n) toit, roog(v) valmistamahiilgav, särav;(n) ahv, pärdik(adj) üllatunudtraditsioonilineparaad, rongkäikmuistne; antiikne(adj)kurb; õnnetu(n) orkester, bändpidulik tähistaminegigantne, hiiglaslik...

Earth Structure Word Search 2024-04-24

20 Items: study of rock layersmolten rock above Earthmolten rock below Earthmovement of rock overtimesmaller particles of rockbreakdown of rock overtimehottest part of Earth's layersettlement of rock in a new locationpart of Earth's layer that we step onrock formed by the cooling of lava/magmarock formed from compaction of sediments...

September 21st 2024 2024-07-02

20 Items: The officiant's name?What soroity was Taylor in?What month did George Propose?What is Taylor's new last name?Who was Taylor's only Prom date?what is Taylor's first degree in?What is Taylor's favorite animal?What is the couple's favorite sport?Who was George's favorite Prom date?What sport did Taylor do in college?...

the scourge made in psd 2025-05-20

35 Items: chainsdiseaseconfessstarvingto scarecurse worda hospitalto put downdellas fatherlong windy pathfeel bitternessbusy and crowdedno pity or mercyto commit or helpani's best friendhard piece of skinto heavily destroyhanging in the airable to catch firea guard of a prisonto try and break freevisible or vulnerablebetter than or greater...

Ghost word search 2025-12-19

20 Items: Ghost's real name?The persons mom diedGhost enemy at school?Main characters nicknameWhat is the team called?The boss of the track teamThe only girl on the team?What Ghost does for Coach?Who's store does Ghost go to?What Ghost wants to do one dayWhat is Ghost and his friends?He is now what on the track team?What did Ghos's dad try to use on them?...

Fun trivia about the birthday girl 2026-02-04

21 Items: Alma materFavorite movieHer Dad’s nicknameCity where she grew upHer animal hobby as a kidHer Mom’s “grandparent” nameHer Dad’s “grandparent” nameHer favorite alcoholic drinkWhat city did she work in FL?Her favorite non-alcoholic drinkHer favorite cable movie channelWhere did she first live with Ted?Her 3 siblings' names concatenated...

SPRING 2026-03-13

165 Items: AIRBEEBUDBUGDEWDYEEGGHAYMAYNEWOAKSKYWETANTSBABYDIRTDUCKFARMFERNFROGGIFTGROWHUNTIRISJUMPKITELAMBLEAFLILYLIMEMELTNESTPINKPLUMPONDROOTROSESEEDSTEMTHAWTWIGWARMWINDYARDAPRILARBORBERRYBLOOMBLUSHBOOTSBUNNYCANDYCHICKCHIRPCLOUDDAISYEARTHFAITHFEASTFIELDFRESHGRASSGREENHATCHHONEYLILACMARCHPETALPEACHPEEPSPEONYPOPPYROBINSNAILSTORMSUGARTULIPVIVIDAZALEABASKET...

My Favorite Things! *Can you find them all??* 2026-04-17

35 Items: :3XboxSaltBlotLionsTajinTakisDecoraRobloxZOOBLEShellyFloridaKidcoreShrimpoSALAMI👹👺WeirdcoreDreamcoreHalloweenDr. PepperAnaDraws YTCats KittensDandys WorldSpicy ThingsPaper DragonsRamen NoodlesAce Of Clay YTCookies And CreamEvan And Katelyn YTGangle *MY BABY😭😭😭*Bake Squad On NetflixIs It Cake? On NetflixNew Mexico *Ahh.. I miss my home land😔😞😣🥀🥀*...

Cajon Valley Transportation 2025-03-27

11 Items: How many times can you take your BTW test?How long is your medical exam good for? (Years)You must be ____ years old to drive a school bus.______ are very slippery after the first rainfall.On your renewal year what training must you receive?How many first aid units would you need for 17-42 passengers?...

Space II 2023-03-09

23 Items: a moonless planetthe solstice on june 21another moonless planetthe name of pluto's moonmain gas in Mars' atmospherethe brightest star in TaurusFirst american woman in spaceWord meaning "around the sun"a moon feature named CopernicusThe liquid in the ocean of TritonWhat is the star nearest to the sunthe constellation for the star Vega...

Megan and Chris 2024-11-17

24 Items: What is Chris' hobby?Where was Megan's first job?What is Chris' favorite food?What was their college mascot?What town did Megan grow up in?What instrument does Chris play?What color are the groom's eyes?What month did they get engaged?Where did David and Eileen meet?What is Megan's favorite tv show?Where is the couple honeymooning?...

Golf 2025-09-14

20 Items: Left-handed golfer nicknamed “Lefty”Charismatic golfer nicknamed “The King”German golfer who won the 2014 U.S. OpenSouth African who won the Masters in 2008Golfer who won a record 82 PGA Tour eventsScottish course known as the “Home of Golf”Won the 1997 Masters by 12 strokes at age 21South African golfer Gary who won nine majors...