atoms and molecules Word Searches

Mr. Dunbar's Class Word Search 2025-10-23

27 Items: In67PutTheBagRatAndDebtNookTimeChuckThiefThoseFriesCandyChuckPlaceBillowDunbarCookedMarblesTeacherLock-InStutterEmergencyCrash-OutSuspicious

Pom Pom The Elf 2025-12-09

28 Items: redtomandsnowtreejackbookforkboysgreenshanejamescostapompomcrayonburgerbananahannahcormacdanielorangethomaspicklematildachristmasinniskeenspaghettihotchocolate

Ancient China Vocabulary 2025-02-18

26 Items: to make the sameable to live foreverpassed along from parent to childto improve the quality of somethingto come into possession of somethinga large group of family members and friendsan official who watches others for correct behaviora Chinese philosophy that emphasizes proper behaviora violent action in opposition of a government or law...

Nezuko Word Search 2025-08-07

18 Items: What Demon Slayers wield?The secret stash of gossip.A community that stans hard.Queen Bee of North Shore High?What’s today’s special occasion?What do you receive on birthdays?Who delivers missions to slayers?Regina’s signature Wednesday color.The clique that rules the cafeteria.The bulletproof boys, K-pop legends?...

Authority Word Search 2024-11-13

33 Items: Ads,FeesBias,Spam,Plan,Scam,Scam,Scam,Scam,Breach,Cookie,Scheme,Upgrade,Pricing,Costing,Shopping,Consumer,Patterns,Matching,Zuckering,Code Scam,and Switch,Continuity,Influencer,Consumerism,Gamification,Misdirection,and Dump Scam,Identity Theft,Authentication (2FA)Comparison Prevention,Trade Commission (FTC),Marketing Company (MLM),

Ava's word search. 2024-05-16

15 Items: is wateris treesmade of coalclouds and fogabsorbing energyreleasing energyis rocks and soilkeeps you on landMoon is barely visiblegreat luck and authoritysecond smallest in our solor system.Gibbous is coming after the Full MoonCrescent Moon has less than half of the moon still visible.Eclipse is when Sun casts light on the moon to make a shadow....

Boxingday Word Search 2025-12-15

10 Items: - to rest and enjoy a calm time.- being nice and caring to people.- a container used to hold presents.- people you love and spend time with.- words said to show you are grateful.- something given to make someone happy.- to give part of what you have to others.- to give support or do something for someone....

Ice cream flavors 2024-09-21

18 Items: chipMintcakeroaddoughpecanCherryCoffeebutterBananaVanillaBrownieCaramelCoconutChocolateand creamStrawberryButterscotch

Pichwai Word Search 2023-05-12

20 Items: The old name of Nathdwara was ___.Deccani or Golconda style of Pichwais originated in _____.A day at Shreenathji ki Haveli is divided into ____ darshans.He was an ardent devotee of Shrinathji and a devotional philosopher.Every Pichwai painting relates to a specific celebration of a ______....

Vocabulary 2025-01-31

20 Items: NewDealCoalitionGovernmentGerman-born American theoretical physicista severe global economic downturn from 1929 to 1939.Austrian neurologist and the founder of psychoanalysisautobiographical manifesto by Nazi Party leader Adolf Hitlermaking concessions to an aggressive foreign power in order to avoid war...

Stage 3 A -->F 2025-04-22

31 Items: to pull towardsa very light metalwhat a place is likea young butterfly or mothan animal soon after birthsoak up or take on a liquidstopped from passing throughorganising things into groupsone intake of air by the lungsone push of blood from your heartanimals which eat other living thingswhat your body needs to make you move...

Sip if You Can’t Find the Word 2025-06-22

36 Items: - Where you are right now- People legally required to attend- Sugary bribe to keep guests seated- The person who planned 97% of this- Korean sushi’s less dramatic cousin- Allegedly why you're all here today- His job title—yes, it’s both somehow- A legally binding roommate agreement- That anime card game he still watches...

Space Exploration People 2025-11-19

24 Items: First woman to travel into space.First American to orbit the Earth.First human to perform a spacewalk.First person to walk on the Moon during Apollo 11.First human to travel into space and orbit the Earth.Flight director who led the successful rescue of Apollo 13.First American woman in space and advocate for science education....

Murder Mystery 2025-10-30

8 Items: MurderMaywoodMysteryWho did it?Moves you up and downWanna smoke a ______?Also moves you up and downI was smoking on the ______

OBOB Titles #1 2025-11-10

16 Items: odderhatchetsquished______________ Langston______________ The Stars______________ Like Click______________ With ButterThe ______________ LibraryThe ______________ of EmberThe ______________ Dollar Race______________ Dog and Owl Head______________ Out and Back AgainThe ______________ of Emily WindsnapThe ______________ Garden on 81st Street...

CE2 Days-Seasons 2025-09-16

20 Items: The day after Sunday:_______________It has 12 months:______________________The day before Thursday:________________There are four in a month:___________________School ends in this month:____________________The first day of the weekend:__________________There are seven in a week:_____________________There are twelve in a year:_____________________...

Budgetdraft Word Search 2023-02-25

25 Items: cooking placeplace to showerbuilding supportunderground roomsafety on the stairthe face of buildingcost data used to designthe width of a rung is calleda loong pasage in the buildingthe height of a rung is calledis the topmost room of a buildingis where the entry of light and ventilationthe lowest part of the base of an architectural column...

Foot Pathologies - 2025 2025-10-16

25 Items: Also known as 'bunion'Also known as 'pump bumps'Also known as Tailor's bunionAnomalous fusion of two or more tarsal bonesAbnormally flattened medial longitudinal archInflammation along the entire ball of the footThis is rupture of the Posterior Tibial TendonResults in heel pain first thing in the morning...

Departmentstore Word Search 2025-06-29

14 Items: A field where corn is grown.A place where people go to eat meals.Having existed for a long time; not new.A piece of land planted with fruit trees.A place where films are shown on a large screen.Not existing before; recently made or discovered.A building offering lodging and other services to travelers....

Conifer Vocab II -- Forestry 2024-06-03

25 Items: The slender, pointed leaf of a coniferous tree.Small pores on plant surfaces, regulating gas exchange.The green pigment in plants responsible for photosynthesis.The inner, older wood of a tree, providing structural support.Trees that shed their leaves annually, in contrast to conifers.The protective outer covering of a tree, composed of dead cells....

FFA Creed Paragraph #1 2025-04-14

15 Items: wordsyearsenjoyFormerpromiseStruggleI-believeFaith-BornAgriculturebetter-daysgenerationsbetter-waysbetter-thingspresent-and-pastDeeds-Achievements

Outdoor Games & Sports 2025-06-15

15 Items: TagSoccerCroquetBaseballKickballDodgeballJump-ropeHula-hoopBadmintonVolleyballBasketballRelay-raceLawn-dartsHide-and-seekCapture-the-flag

Antonio word search 2024-01-16

13 Items: hitneed a glove for.is somthing that you fell.is water in freezeing form.something you do during baseallesomeone is close to getting you out.an activity that you need to do to stay fitsomething you need to do during baseball to getsomething you need to do while playing baseballis something you feel when it is cold out side....

№4 Research and present common first aid procedures 2025-11-27

15 Items: Break in a boneInjury caused by heatStops severe bleedingHeartbeat measurementBlocked airway emergencyDamage to skin or tissueLoss of blood from an injuryLack of blood flow to organsKeep injured limb from movingHarmful invasion of pathogensMust be kept clear to breatheRestores breathing and heartbeatUsed to cover and protect a wound...

Voices Am History Word Find Topic 11-19 2024-10-07

11 Items: ,behave.,mournful.,stealing.,open and honest.,asking urgently.,fearful apprehension.,Free from disturbance.,Instructing or urging.,travel across or through.,pierce and cask to draw liquid.,sudden attack or violent expression.

Stage 3 A -->F 2025-04-22

31 Items: to pull towardsa very light metalwhat a place is likea young butterfly or mothan animal soon after birthsoak up or take on a liquidstopped from passing throughorganising things into groupsone intake of air by the lungsone push of blood from your heartanimals which eat other living thingswhat your body needs to make you move...

Queen Wordsearch 2024-12-19

13 Items: BassistDrummerGuitaristFirst Track On JazzFirst Track On The WorksThe Lead Singer And PianistPlayed Freddie In DocumentaryFirst Track On Sheer Heart AttackLast Album Before Freddie's DeathContains "Under Pressure" ft. David BowieMost Famous Song And Title Of DocumentaryConcert In London And Philadelphia In 1985...

Mr Jensen 2025-12-01

16 Items: He sees Clint’s talentHe has a gift for drummingHe cares about his studentsHe doesn’t always talk to othersHe can make music from his tappingHe is worried about being punishedHe makes students feel comfortableHe notices things other teachers missHe thinks carefully about how to helpHe gives positive feedback and support...

Parts of a Cell Word Search- By Roylee Jones 2024-09-23

12 Items: The rough highway.The smooth highway.Tiny protein makers.Makes food using sunlight.The powerhouse of the cell.Barrier surrounding the cell.The control center of the cell.Breaks down waste and recycles.Jelly-like fluid inside the cell.The cells highway that transports.Storage bins that hold water and nutrients....

Some Te Reo from "The Whale Rider" 2023-08-21

20 Items: skynamecallthistribewomangroundremainlistenchildrengenealogygreenstonewater monsterlife principlename for ancestorguardian of the seaMannish (in a woman)the polynesian name for easter islandback water and Nanny Flowers's ancestorstar antares and also Kahu's mother's name

Happy Birthday Avalyn! 12/19 2025-12-12

12 Items: artBookMathSushichinapurpledrawingcapybaracoloringYears Eveand craftsDemon Hunters

Dorcas Shows Kindness 2024-04-14

16 Items: Dorcas' other nameThe place where Dorcas livedAnother word for coats (Acts 9:39)The things that Dorcas did (Acts 9:36)The name of the man God used to heal DorcasThe name of the city where Peter was stayingWhat Dorcas showed to others by sewing clothingThe women that Dorcas made clothing for (Acts 9:39)...

CVA Review Game 2024-01-05

16 Items: Pertaining to the heartAnything that makes a substance unusable for its intended purpose.Section Delivery of fetus by incision through the abdominal wall and uterine wall.Pertaining to the cranium or the head end of the body, or anterior end of the body.A light proof housing for X-ray film, containing front and back intensifying screens....

Breed Word Search 2024-01-05

16 Items: Pertaining to the heartAnything that makes a substance unusable for its intended purpose.Section Delivery of fetus by incision through the abdominal wall and uterine wall.Pertaining to the cranium or the head end of the body, or anterior end of the body.A light proof housing for X-ray film, containing front and back intensifying screens....

UNIT 12 2023-12-15

12 Items: devouring.eating only plants.able to be influenced.rhythmic rise and fallseizing everything, greedy.able to be noticed or felt.feeding on both animals and plants.giving total attention to, captivated.hidden or secret, done without notice.an idea important to a system of beliefssomething or someone injured, killed, or eliminated....

Unit 18 2024-03-06

12 Items: aware.meaning the same as.subcategory or subgroup.etiquette, and/or fashion.official system of naming.not revealing one’s identity.in name only, not completely true.relating to the process of thought.disguised as someone other than oneself.one well-traveled and knowledgeable aboutuse of trickery and false logic in arguments....

Math 8th Grade Word Search (By Abdul Wassay) 2025-10-07

15 Items: the higher and bigger numberthe smallest and lowest numberdescribes the steepness and direction of a line on graphdescribes the steepness and direction of a line on a grapha comparison between two values or expressions that are not equala value that, when multiplied by itself, produces the original number...

Personality adjectives 2022-10-04

16 Items: bad-temperedtalks a lot isa very tidy personis always on time ismakes people laugh isisn't afraid of dangerbad mannered, impolitelikes to give presents isalways tells the truth isis always there for you isis open and nice to othersdoesn’t like to do any work isfriendly and socially confidentthinks good things will happen is...

Esthetic Modalities 2024-08-19

16 Items: Normal Dry Skin, Increases MoistureRestore PH Balance, Soothes IrritationCell Turnover, Resurfacing, Less InvasiveDetoxifies and Purifies, Rebuilds TextureMilk Derived, Brightens Dull Skin, Most GentleAntiaging, Improves Elasticity, Stimulates CollagenGood for Sensitive Skin, Cool, Soothing & Hydrating...

FTFC Word Search 2024-02-08

8 Items: BSN Treat Customer Fairly Charter (TCF) can be found in the Bank's ______As BSN staff, we need to uphold high standards of ______, integrity and professionalism in all dealings with financial consumers.One of BSN's promise in delivering fair treamtement to our customers is to ensure that customers are provided with fair and ________ terms...

Job Description 2025-10-02

8 Items: Helps sick animals __________.Sings songs for people ____________.Cooks food in a restaurant ____________.Helps sick people get better ___________.Helps students learn at school ______________.Helps doctors and takes care of people _________.Brings food and drinks in a restaurant _________.Helps people and keeps the city safe _____________.

¿como te llamas? 2025-08-19

13 Items: nameLikewise.(Sr.) Mr.Hello; Hi.(Sra.)Mrs.My name is…And you? (fam.)It’s a pleasure.And you? (form.)Charmed. Delighted.What’s your name? (fam.)What’s your name? (form.)The pleasure is all mine.

Rosa/Ruby Bridges Vocabulary 2024-02-09

12 Items: I _______ my seat at the concert.Ms. Sampson painted the room in ______ colors.The cat thought he was ______ to another treat.The students _____ out the words in this word search.The goalie had to ________ where the ball was going to go.Frederick Douglass was an ______, he fought to end slavery....

Vocab 1.1 2024-09-06

16 Items: A brief, indirect referencethe universal message or big ideaof View the type of narration usedappeals to our five physical sensesRepresenting a thing or idea as a personthe main problem or struggle within a storyAn expression that must be learned as a whole.the sequence of events that take place in a story...

animals 2025-03-06

31 Items: fatfastswimsfliesfelineannoyinghas a shella black-birdlarge mammalcollects nutslargest mammaltallest animalscale and fastblack and whitecomes in a prideorange and blackreproduces a lotMan's best friendhunts in the wateranother black-birdlargest land mammalsmall savannah mammalan amphibian with lumpshas a 9 billion population...

Holly Jolly Week 2023 Word Search! 2023-12-13

16 Items: North pole employees2023 BRR Word of the Year"Furnishing Life's Best ____"The Grinch's canine companionRed and White striped holiday candyFestive red plant, a holiday favoritewarm and cozy garment for chilly daysfestive decoration often hung on a treeFall fruit often found in sauce or juiceFestive drink with eggs, milk, and spices...

AI Vocabulary 2025-04-29

37 Items: The data used to train an AI model.Data that is defined and searchable.A type of neural network architecture used in many LLMs.The input text given to an AI model to guide its output.A specific type of LLM that uses a transformer architecture.How computers can gain understanding through images and videos....

Health and Safety 2013-10-09

32 Items: terdoerestartossegripeajudarmédicodoentesentircabeçaroubadopolíciasocorrobarrigavómitosgrávidahospitalfarmáciaacidenteprecisargargantatonturasasmáticocardíacoalérgicocarteiradiabéticoambulânciapassaportedocumentosatropeladodor-de-cabeça

people and places 2013-06-04

22 Items: NewYorkJapanEgyptChileItalyChinaIdahoBrazilCanadaPolandGreeceBelizeMexicoLincolnMadisonJacksonAmericaIrelandGermanyWashingtonRutherford

Joshua and Judges 2014-02-27

54 Items: AicordrestMoabGazaRuthMaraObedEhudBaalflaxtentAchanRiverRahabEglonBarakhoneyNaomifoxesJesusDavidCalebJordanJoshuaJudgesstonesSiseraManoahSamsonriddleMahlonChristOthnielCaptainscarletbondageDeborahTimnathShamgarChilionTimnathmemorialidolatrystrengthBethlehemElimelechBabylonianCanaanitesGibeonitesIsraelitesrepentanceMidianitesdeliverance

Rocks and Minerals 2014-04-22

31 Items: icecoallavaclaywindrocksmagmaventsshalechalkstreaklusterhaliteigneousvolcanofissurecalcitegravitymineralssilstonecrystalsbasalticobsidianfractureextrusiveintrusivesandstonesedimentaryevaporationconglomerateprecipitation

Symbolism and Allusion  2014-02-03

46 Items: anortoeyeforeyetheHolylambLastRuthStyxAtlasGrailGrailIsaacJacobJonahMoseshorseJudasIsaacDanielSupperMedusasatyrssphinxUtopiaTrojanJezebelNemesisnirvanaOdysseyPandoraphoenixPyrrhusSolomonLazarusAbrahamAchillesMinotaurWaterlooIscariotslaughterPrometheusCrucifixion

Romeo and Juliet 2014-02-07

20 Items: LoveRomeoExilePeterAbramNurseFriarParisDeathJulietTybaltPrinceVeronaMantuaPoliceTragedyCapuletMontagueBenvolioBalthasar

Nationalism and Imperialism 2014-04-01

24 Items: IndiaChinaEgyptFranceLessepsOpiumWarSunYixianYoungTurksImperialismNationalismMuhammadAliTradesurplusProtectorateKingLeopoldIIBoxerUprisingCharlesDarwinBalanceoftradeSepoyRebellionArmenianGenocideCivicNationalismTaipingRebellionEthnicNationalismSpheresofInfluenceBritishEastIndiaCompany

Scope and Standards 2014-08-18

20 Items: NurseethicsHealthOutcomequalityPlanningresearchresourceDiagnosiseducationStandardsAssessmentEvaluationleadershipUtilizationProfessionalCollaborationenvironmentalcommunicationImplementation

Herbs and Spices 2015-04-17

20 Items: DILLMINTSAGEBASILTHYMECUMINCHIVESFENNELGINGERNUTMEGCLOVESPARSLEYOREGANOSAFFRONTARRAGONCINNAMONALLSPICECORIANDERLIQUORICESTARANISE

Romeo and Juliet 2015-05-11

34 Items: LoveFeudPlayFateRomeoParisNurseAbramPeterItalyMasksJulietTybaltVeronaChorusPoisonCapuletEscalusSampsonGregoryTragedyWeddingMontagueMercutioBenvolioPrologueRosalineBalthasarFriarJohnApothecaryLadyCapuletFriarLawenceLadyMontagueWilliamShakespeare

Romeo and Juliet 2015-10-18

20 Items: doffaddleambledowdybawdywaddledriveljocundtrudgegarishnuptialbraggartparamourpoulticeprolixityarbitratepropagatedistraughteffeminatesententious

Food and drink 2015-10-26

20 Items: hamjameggsbeefmilkpeaspearsbreadapplescrispscheesechickenorangesbananascarrotstomatoespotatoesbiscuitsice-creamcornflakes

Food and drinks 2015-09-11

26 Items: winesoupeggscokemilkwaterchipssteakbaconjuicetomatocheesefruitswhiskychickengoulashcerealssandwichomeletteporridgechampagneroastbeefcroissantmarmeladespaghettivegetables

Engineers and Inventors 2015-05-22

20 Items: BellWattBenzTeslaNobelBoyleWoolfEdisonBrunelBramahSaveryBabbageSiemensNasmythMurdochBessemerMaudslayWilkinsonStephensonTrevithick

FRIENDSHIP AND TEAMWORK 2015-05-24

21 Items: FUNPLAYTALKCALLGOODPALSTRUSTHAPPYSHARETIMESLOVINGJOYFULGIVINGFRIENDSHONESTYHEPLFULLOYALTYCONFIDETEAMWORKCLOSENESSCOMPAINIONS

Culinary and Hospitality 2016-01-13

45 Items: tipfoodhostmenurestChefsmileguestbrandchainneedshotelsethicstravelsafetysafetyservicemannersempathyqualitytourismsupportmanagergreeterhonestyrespecthostesscustomerbeverageattitudepositiveapprovalshoppingefficientfranchisesolutionseyecontactenthusiasmappearancerecreationsanitationpersonalityhospitalitysatisfactionexpectations

Rocks and Minerals 2016-01-15

20 Items: basaltpumicezirconemeraldjadeitekunzitezoisitedolomitefluoritehematitenephriteobsidianxenolithcarnelianmalachitesandstonevulcanitetourmalinealexandritelabradorite

Chantal and Norbert  2016-02-05

33 Items: ramushugizaphahisisamonkhumthotibiskattegederguderneithnilensebekhorusmumiersvingsanubisfaraoersakofagnephtysmesterssekhmetthot-abenofretetesmykkerkenpyrarmiderarkæologergravkammertutankamonhieroglyffer

Birds and Mammals 2016-02-10

27 Items: LiftCropGlandGuanoBrainThrustMolarsMammalsPreeningPlacentaFollicleIncisorsEndothermOmnivoresMonotremeMarsupialPlacentalPremolarsCarnivoresHerbivoresSpinalcordCanineteethDownfeathersMammaryglandsUmbilicalcordContourfeathersGestationperiod

Pups and Things 2016-04-29

33 Items: LABPUGBEDSFOODTOYSBONESBRUSHGATESHUSKYLEASHTOWELWATERBEAGLECOLLARKENNELMUZZLETREATSHARNESSNAMETAGPITBULLSHAMPOODOGBOWLSMEDICINEDACHSHUNDPOTTYBAGSVETVISITSBASSETHOUNDDENTALCHEWSGOLDENDOODLENAILCLIPPERSTRAININGPADSCLOTHES(OPT.)GERMANSHEPERD

States and capitals  2016-05-10

28 Items: OhioTexasMaineIdahoAlbanyAugustAustinOregonArizonanewyorkFloridaWyomingGeorgiaJacksonPhoenixIndianaSantaFeMarylandOklahomaMichiganWashingtonCaliforniacharlestonTallahasseeWashingtonDCIndianapolisNorthCarolinasouthcarolina

toys and money 2016-05-12

20 Items: carballdollbikegamebearlorryteddymoneypoundpennyracingcastleinlineskatesmountaincomputerspaceshiphelicopterbasketball

Food and drinks  2016-05-13

37 Items: FishcakecokesushisaladcandypastahoneytacosPepsichipsjellybreadCherrygrapesapplesbagelsspinachorangesSnapplecookiesicecreamhotfudgecucumberCheerioslemonadebrowniesmeatballssprinkleshamburgerwatermelonapplejuicefruitpunchsweetpotatoorangejuicecheeseburgerstrawberries

Places and Spaces 2016-05-13

21 Items: topubpostleftcafenextbusyrightquietofficecinemabakerycollegestationbetweenstraightoppositesupermarketopeningtimesclsoingtimesneighbourhood

Technology and Design 2016-06-23

42 Items: sawnonoakfilewoodgluenailfusedrillapronrulerrulesclampscrewboardHammerdesignpencilsafetysoldergogglesproductdrawingprojectplasticcircuitacrylicferrousferrousvarnishworkshopplanningbuildingtemplatesolderingsandpaperfinishingscrewdrivercountersunkspecificationmanufacturingthermoplastic

Herbs and Spices 2016-08-02

46 Items: RUEDILLMACEMINTBASILCAROBCLOVEONIONSUMACTHYMEBORAGECAPERSCARAWACHIVESCICELYFENNELGARLICGINGERHYSSOPLOVAGENUTMEGPEPPERSAVORYWASABIANNATASCHERVILOREGANOPAPRIKAPARSLEYSAFFRONTARAGONVANILLAAllSPICEANGELICACARDAMOMCILANTROCINNAMONLAVENDERLICORICEMARJORAMROSEMARYTUMERICACORIANDERFENUGREEKNASTURTIUMPEPPERMINT

Health and Medicine 2016-05-23

26 Items: cuteyesoredripnurseslingpillsbloodpainsblackspotsthroatsalinefingercrutchsyringeplasterbandagepatientplasterstomachtabletsmedicineambulancestretcherparamedics

Force and Momentum 2016-05-23

20 Items: masstimeworkforcespeedcrashNewtonenergyrecoilinertiaelasticvelocitydistancemomentumdirectioncollisioninelasticaccelerationdisplacementconservation

WEATHER AND SEASONS 2016-06-21

34 Items: axisheatwindcresttroughdensityequatorequinoxweathersealevelrotationsolsticealtitudebarometerradiationjetstreamatmospherelocalwindsconvectionrevolutionanemometerwavelengthconductionhemispheretemperatureglobalwindsairpressurethermometertroposphereheattransferthermalenergyphotosynthesisgreenhouseeffectelectromagneticwaves

Adam and Eve 2016-04-18

20 Items: EveAdamEdenTreeBiteWiseWorkSnakeFruitNakedCurseAngelGuardGardenHidingBanishDisobeyParadiseForbiddenKnowledge

FOOD AND RESTAURANTS 2016-10-19

54 Items: oilfishcakemilkricebeefsoupmeatnutssaladclamsbreadpastatripefriedjuicedairysaltyfriespizzaentreeapplesbananaorangecheesebutteryogurtgrapestomatoshrimplentilonionsfruitsgrainssweetssnacksdessertcocunutcookiescarrotspepperschickenlettucegrilledmangoesseafoodhealthycalorieportionbeveragebroccolisandwichappetizervegetables

Food and Cooking 2017-01-04

21 Items: lambsugarsaladsteakstalecurrywardencerealsalmonfreezesurgeonbuildercustardsandwichbiscuitsassistantmicrowavebarbecuedvegetarianhairdresserreceptionist

Reflection and Refraction 2017-03-27

25 Items: raydulllensbendshinylightsolarpanelprismcolorangleabsorbenergymirrormediumbouncesurfacerefractreflecttransmitspectrumscatteredincidencerefractionreflection

Motion and Forces 2018-02-07

29 Items: SpeedForceLeverWedgeScrewEnergyPulleyMachineGravityInertiaPositionMomentumFrictionSolarEnergySoundEnergyLawsofMotionPushingForcePullingForceWheelandAxleSimpleMachineInclinedplaneThermalEnergyKineticEnergyBalancedForcesChemicalEnergyPotentialEnergyUnbalancedForcesMechanicalEnergyElectricalEnergy

Flannels and Flapjacks 2017-11-14

20 Items: cowhayherdhowdyrangechapshorselassorodeobroncocowboysaddlecowgirlcountryrancherbandanawranglerflannelsmustacheflapjacks

Brooklyn and Rayeigh 2018-05-16

20 Items: dogseacrabcakegraceemojioceansmileysoccerturtlepaulieaxolotlfriendshamstersoonersrayleighbrooklynoklahomachocolatebasketball

PLACES AND TRANSPORTATIONS 2018-04-16

22 Items: buscarMRTbankparkpostbikeboattaxigluecrabtraingrassplanecleanbakeryofficeprincelibraryscooterhospitalsupermarket

Government and Constitution 2018-04-20

21 Items: senaterepublicjudicialtaxationcongressexecutivepresidentbicameralfederalismfederalistamendmentsprincipleslegislativebillofrightssupremecourtphiladelphiaratificationjudicialreviewantifederalistsgreatcompromisepopularsovreignty

Dogs and Hersheys 2018-03-28

22 Items: feverfunnyaftersilentfemalemomenthappenbetterfollowyellowbottompillownumberwintersisterfingermemberwindowpatternproblemchapterblanket

Evidence and Testifying 2018-03-28

41 Items: DNAClueToolDrugPlancrimePrintTraceSceneGuessRelaxGatherSearchLatentDirectListenAnswerMemoryConfirmDigitalFirearmHazardsProtectWitnessHearsayEvidenceIdentifyFootwearSecurityPreserveIndirectSubpoenaTruthfulTiretrackTestimonyPhotographCoordinateConsistentCommunicateCooperativeClarification

Drugs and Alcohol 2018-11-07

22 Items: drugWeedDrugsDeathAbuseAlcoholGatewaycocaineIllegaltobaccoOpioidsInhalantOverdoseUnhealthymarijuanaSubstanceAddictionNarcoticsDepressionWithdrawalIntoxicatedHallucination

Rooms and furniture 2019-03-02

21 Items: oninbeddesksofalamphallchairtableclockshelfunderwheregardenbehindkitchenbedroombathroomtelephonetelevisionlivingroom

Family and Friends  2019-09-22

26 Items: boymomdadbrosisgirlauntwifedudenieceunclemommydaddybuddysistermotherfathernephewauntiecousinbrotherhusbandboyfriendgirlfriendgrandfathergrandmother

Countries and Nationalities 2019-09-25

40 Items: ChinaEgyptIndiaItalyJapanDutchSpainWalesWelshAfghanBrazilCanadaDanishFranceFrenchGermanIndianIsraelAlgeriaBelgiumBelgianChineseDenmarkEnglandEnglishGermanyIsraeliItalianMoroccoSpanishAlgerianCanadianEgyptianJapaneseMoroccanAustraliaBrazilianAustralianAfghanistanNetherlands

Volume and Capacity 2019-10-24

22 Items: jugcupfullfillmetrelitreemptycubedunitsspacevolumeamountliquidmetriccomparecomparemeasurecapacitykilolitrecentimetreconversionmillilitre

GRIEF AND LOSS 2020-06-03

23 Items: FEARHOPELOSSANGERGUILTSHOCKCHANGEDENIALFAMILYEXPRESSEMOTIONFRIENDSHEALINGILLNESSSUPPORTEXERCISEMEMORIESSPIRITUALACCEPTANCEBARGAININGCOUNSELINGDEPRESSIONFORGIVENESS

Time and Space  2020-07-31

27 Items: MarstimestarshipNASAmoonVenusEarthPlutospacespaceorbitSaturnUranusgalaxyMercuryJupiterNeptunegravitymilkywayasteroiduniverseuniverseastronautmeteoroidblackholesolarsystem

Sports and Hobbies 2020-10-22

36 Items: irverleersolojugarluegoquierohablaralcinelibroslatelemananamegustategustaesfacilquieresaltenisnoquieroalaplayaalfutbolnomegustanotegustaesdificilnoquieresconamigosdecomprasalbeisbolunpartidomegustamastegustamasesaburridounarevistaportelefonovideojuegosesinteresantealfutbolamericano

Ranks and Positions 2020-11-18

31 Items: teamarmydutymajorsquadcadetjrotchonordrillguidonparadecaptaincolonelprivatebrigadecompanyplatoonrespectservicecourageveteransoldiersergeantcorporalselflesscommanderbattalionintegritylieutenantinstructorleadership

Safety and Security  2020-11-04

21 Items: COUNTSTOPSSAFETYTRAUMAVISUALEXIGENTPATDOWNHANDHELDMOVEMENTSEARCHESEMERGENCYFIREDRILLHAZARDOUSPERIMITERCONTRABANDPROHIBITEDVISITATIONCROSSGENDERSUPERVISIONTRANSGENDERMETALDETECTOR

Shadows and Seasons 2020-12-04

25 Items: DaySunAxisFallTiltYearEarthNightOrbitDirectShadowSpringSummerWinterEquatorEquinoxSeasonsIndirectLatitudeRotationSolsticeRevolutionTemperatureSouthernHemisphereNorthernHemisphere

Winter and Names  2021-01-19

28 Items: hihatIzzyAnnasnowcoldNoraSarahscarfDylanRileyReeceMicahbootsSiennaSimonejacketskiingJaydenJovanaMatiasHannahsnowmansnowballfireplacesnowangeliceskatinghotchocolate

Health and safety 2021-03-03

20 Items: heelcalfshinkneelipspalmneckanklethighthumbwristchestelbowbottomtonguethroatfingerstomachforeheadshoulder