health and wellness Word Searches

shapes and geometry 2025-07-09

15 Items: OvalStarArrowHeartCircleSquareHexagonOctagonPyramidRhombusCrescentPentagonTriangleRectangleTrapezoid

Colors and Shades 2025-07-09

15 Items: RedBluePinkGrayGoldCyanGreenBrownBlackWhiteBeigeYellowPurpleOrangeSilver

Wine and Cheese 2025-07-10

15 Items: PinoAgedBrieGoatRoseFetaPinotGoudaGruyereCabernetManchegoParmesanRieslingRacletteChardonnay

Calendar and Time 2025-07-11

15 Items: YearClockMondaySeasonMinuteSecondJanuaryTuesdayMorningWeekendFebruaryMidnightCalendarLeapYearAfternoon

Tools and Equipment 2025-07-11

15 Items: SawNailBoltDrillLevelClampHammerWrenchPliersChiselLadderSocketMeasureToolboxScrewdriver

Goals and Habits 2025-07-12

15 Items: TimeFocusHabitRewardEffortResultRoutineSchedulePracticePatienceProgressMilestoneMotivationDisciplineConsistency

Outerwear and Seasons 2025-07-12

15 Items: HatCoatScarfBootsJacketGlovesShortsSeasonSweaterT-shirtRaincoatUmbrellaFlipflopsSnowbootsSunglasses

Feelings and Emotions 2025-07-13

15 Items: SadShyCalmHappyAngryTiredBraveProudSillyScaredLonelyExcitedWorriedConfusedSurprised

Science and Tech 2025-07-22

15 Items: LabDNARobotMagnetGravityPhysicsBiologyTestTubeChemicalChemistryAstronomyExperimentMicroscopeSolarPowerElectricity

FOODS AND DRINKS 2025-08-09

15 Items: TEAMILKRICEPIZZASATAYBREADJUICEWATERNOODLECOFFEEMEATBALLFRIEDRICEFRIEDFISHSPAGHETTIFRIEDCHICKEN

US History Unit 7 terms 2023-02-28

11 Items: Who won the 1912 presidential election?Where was the canal built in 1904 located?The panic caused by the fear of communism's spreadpowers Which alliance was the Ottoman Empire a part of during WWI?Which act was passed in order to strengthen the Sherman Anti-Trust Act?The mass migration of African Americans away from the Southern United States...

Fashion Wardrobe review 2025-04-30

7 Items: planWardrobeevaluateinventoryaccessoriesof priorityand match wardrobe

valentine's day article 2023-01-18

14 Items: There is no way of knowing for sure...if Valentine _______ at all.People did not always relate love with _______ in pre-Christian Roman society.The Romans were not all too thrilled by the spread of _________ for various reasons.The day has been named after one or more ______ of the early Christian era named Valentine or Valentinus....

Module 14 Lesson 3 Vocabulary 2025-04-04

5 Items: a story that often provides a moral lessonthe leader of one of the most famous slave rebellionspassing down stories, poems, and songs by word of mouthmen hired by farmers and planters to oversee and direct the work of slaves on plantations...

LA 2023-10-25

21 Items: Poor balance and coordination:________Involuntary, uncontrolled movement:__________This type of spina bifida is the most severe:________Pre-, peri- or post-natal brain hypoxia:________ ________Velocity-dependent resistance to passive stretch:________Joint stiffness and deformity as a result of fetal akinesia...

Photo Word Search 2023-11-09

13 Items: lightto put togethera gas produced by photosynthesisan organism that makes its own foodan organism that can produce its own fooda specialized structure within a living cellan organelle in which photosynthesis takes placea green pigment within the chloroplast that absorbs light energya gas that green plants absorb that is required for photosynthesis...

Good Government 2023-10-10

11 Items: Rajah of Sarawak.Land directly under the Sultan.An organisation that rules a nation.A state ruled or headed by a monarch.The first british resident to Brunei.One of the Wazirs that is incharge of trade.Agreement not to lease any of remaining territories to foreign powers.Land granted by the Sultan to members of the Royal Family and the nobles....

easy ways to improve heart health 2023-01-25

10 Items: heartfibrestrokeanxietydiseasetiddlessproutsunsaltedprotectiveexamination

Of Mice and Men language and Themes 2025-07-03

15 Items: FateHopeDreamPowerDreamsFreedomAmericanViolenceIsolationPrejudiceInjusticeLonelinessFriendshipMarginalisedVulnerability

8th grade Andrew Henry 2024-05-17

15 Items: To increase speeda positively chargedneutrally charged atomThe weight of an objecta negatively charged atom.An element with a symbol of HWhen an object turns 360 degrees.a compound that can be seperated.A compound that isn't seperatable.: Charged particles that create energy.A compound made from hydrogen and oxygen...

About Jonathan 2025-01-06

15 Items: Favorite colorFavorite fruit.Favorite seasonThis is how old I amMy favorite Hoilday.My favorite sports team.This is what grade I'm inMy favorite movie about baseball.My favorite character from angry birds.My favorite sport. The field is a diamond.My favorite animal, I have one named Austin.My favorite show on nickelodeon about a sea creature....

Biotechnology Research and Development Careers 2023-05-05

7 Items: Protein that acts like a catalyst in the cella biotechnology research and development careera biotechnology research and development careerequipment specialist a biotechnology research and development careerPatterns of inheritance and develop methods to influence genetic information...

Bay Model 2024-07-06

11 Items: A problem solverThe creation of new ideasA mixture of salt and fresh waterThe proper use of natures resourcesThe protection of nature from damageThe system of rivers, lakes, and baysThe ocean that the SF bay drains intoThe body of water where rivers meet the seaThe wetlands where rivers flow into the bayAnimals or plants that came from another area...

Building Relationships 2023-10-24

18 Items: A characteristic of the product or service, such as the interest rate or the term.Explicitly choosing not to do something, such as to not receive bank product literature.One seller’s portion of the total sales of a product, usually measured as a percentage of deposits....

Knights and Samurai 2014-03-09

15 Items: pagehaikujapansquirekatanadaimyoknightssamuraiwarriorenglandjoustingchivalrychainmailtournamentmiddleages

Rocks and Minerals 2014-04-22

15 Items: rockheatcavemagmamineraligneouscrystalerosionpressurefieldtripmetamorphicsedimentarybirthstonesstalactitesstalagmites

IT and Computers 2015-02-21

15 Items: lanchipappswifimousephoneremotedesktopwebpagekeyboardcomputerspeakersconsolestelevisionmotherboard

Temperature and Heat 2019-10-03

15 Items: heatmassjouleenergydegreescalorieconductorinsulatorradiationconvectionconductiontemperaturethermometerspecificheatthermalenergy

HERBS AND SPICES 2020-02-11

15 Items: BASILCLOVECUMINGINGERFENNELSESAMEOREGANOSAFFRONCARDAMOMCILANTROCINNAMONLAVENDERTURMERICASAFOETIDAPEPPERMINT

DRINKS AND BEVERAGES 2020-02-18

15 Items: TEASODAMILKJUICEATOLEWATERCOFFEEICEDTEALEMONADESMOOTHIEGREENTEAMILKSHAKECOLDCOFFEECOCONUTMILKHOTCHOCOLATE

Reward and Punishment 2020-06-05

15 Items: firesavegrowjudgefeastrewardpunishcomingwisdomreturnweddingpreparedfaithfuldiligentincentive

jordyn and mandie 2021-01-11

15 Items: catdogcowliongoatbirdzebrahipposnakehorsedairysheeptigerturtleelephant

Food and Diet 2022-05-29

15 Items: nutssaltseedssugargrainspulsesobesityunhealthyoverweightsugarydrinksunhealthyfatsgoodnutritionundernutritionsustainablehealthydietfreshfruitandvegetables

Witches and Warlocks 2022-10-04

15 Items: haghextoadwandbroompocusmagicspellwitchcacklepotionwarlockcauldronwitchcraftincantation

Cain and Abel 2022-10-23

15 Items: godcainabellambsheepfarmerfruitskilledmarkedjealousbrothersshepherdsacrificevegetablespunishment

Sports and Fitness 2023-02-25

15 Items: yogapesasboxeoesquíbailecorrerbéisbolvoleibolnatacióngimnasiaciclismopatinajeescaladamarcialesentrenamiento

Woods and Shrubs 2023-03-10

15 Items: teakchikujamunguavamangomullaichampaavocadobluelotusjackfruitredgingercannonballcoconutpalmpomegranateyellowbells

Weather and Climate 2023-05-12

15 Items: Warm water currentchange in moister contentmeasures the air pressuremeasures the speed of windwarm air that rises rapidlyusually brings precipitationmeasures the direction of blowing windthe weight of air pushing down on earthmeasures the amount of heat in the atmospherewhen the boundary between two air masses stalls...

History and Sports 2023-05-12

15 Items: shuaihardingkerriganpoliticsreligionchastainbuzkashiworldcupojsimpsonjeremylindreamteamtigerwoodskerristrugtransgenderparalympics

Hare and Hyena 2023-05-29

15 Items: criesboundseizefamineshowedscarcesupplerubbishshoutedutteringcreaturespectacledeceitfulrepulsiveunsuspecting

colours and things 2023-08-04

15 Items: kidbagbeetreeballbikehousegrassappleflowerbananaseagullfrisbeeballoonskateboard

Strength and Gentleness 2023-10-04

15 Items: patientjealousinflatetrafficoffencedelightbelievefailureshelterbraggingblessinghonestlycelebrateconsistentlyachievements

ROMEO AND JULIET 2013-12-17

15 Items: ROMEONURSEPARISJULIETTYBALTESCALUSBENVOLIOMERCUTIOPETRUCHIOBALTHASAARLORDCAPULETLADYCAPULETLORDMONTAGUELADYMONTAGUEFRIARLAWRENCE

look and fun 2023-10-31

15 Items: peartmathmusicmondayfridaysundaytuesdayscienceSTUDIESchineseenglishthursdaysaturdaywednesday

Fruit and Vegtables 2023-11-29

15 Items: pearkiwigrapeonionappleorangecarrottomatopepperpotatolettucecabbagecucumberstrawberryblueberries

Law and Order 2024-01-02

15 Items: lawcrimealibiproofpolicemurderweaponsuspectmysteryrobberywitnessevidencepropertydetectiveinvestigate

Power and Conflict 2024-02-10

15 Items: Dem tell mePaper that lets the lightHalf a league, half a leagueHer father embarked at sunriseThree days before Armistice SundayI wander thro' each charter'd streetOn another occasion, we get sent outIn his dark room he is finally aloneI met a traveller from an antique landOne summer evening (led by her) I found...

Me and you 2024-02-16

15 Items: pastalegosairbnbsummercrumblalabamatopgolfsnapchatfacetimeblanketsassateagueharrypottertexasroadhousedaveandbustersprettylittleliars

Waves and Sound 2024-03-01

15 Items: wavessoundcresthertzpitchsonarperioddecibelloudnessfrequencyamplitudewavelengthultrasoundinfrasoundmillisecond

earth and space 2024-05-16

15 Items: closet to the sunthe planet we live onwe landed on it in 1969when water terns to a soldthe only planet that has waterthe eighth planet from the sunwhen water sticks to a surfacebiggest planet in the solar systemwhen we breath and it be comes waterhas the most ring in the Solar systemUranus is a very cold and windy world...

Family and friends 2024-06-24

15 Items: sonauntunclebuddymothersistercousinfriendbrotherdaughterneighborteammateclassmateschoolmategrandfather

CAIN AND ABEL 2024-07-06

15 Items: evegodcainabeladamkillsheepcropsfruitfeildmotherfatherfarmerkeeperbrother

Friends and Love 2024-07-14

15 Items: bondcaretrustloyaltysupportrespectempathykindnesspatienceaffectionfriendshipcommitmentcompanionshipunderstandingcommunication

Skin and Scales 2024-07-31

15 Items: skinroughlayermucusarmordermalscalessmoothglandstexturebarriercoveragedenticlesepidermisprotection

Logic and Sets 2024-09-30

15 Items: UnionInverseArgumentConverseEmptySetConjuctionComplementConjunctionVennDiagramSetEqualityPropositionsImplicationsIntersectionSetCardinalityBooleanOperations

Renaissance and Reformation 2024-10-04

15 Items: PerspectiveHad 6 wiveswho painted the Mona lisaFrench word meaning “rebirth.”Where did the renaissance startwas married to Katharine von BoraWho painted "The school of Athens"aimed to establish freedom of religionthe monumental marble David in Florence;belief about a particular category of people...

Tacos and cookies 2024-12-16

15 Items: 123456789101112131415

Buddhism and Hinduism 2025-01-07

15 Items: the process of being reincarnated or born again.a method for realizing the ultimate nature of reality.a member of the highest Hindu caste, that of the priesthood.ritual objects found in Buddhist and other religious traditions.The spirit or soul survives death and is reborn into a new body, human or non human...

Clothing and Fabrics 2025-01-15

15 Items: VeilSilkBeltWoolSashRobeEmilLinenGirdleCottonSandalsLeatherCamelhairBreastbandEmbroidery

Creativity and Curiosity 2025-03-19

15 Items: VisionUniqueArtisticInspiredOriginalCreativeInventiveIntuitiveIngeniousExpressiveThoughtfulImaginativeResourcefulSpontaneousExperimental

Hope and Humour 2025-03-19

15 Items: HappyFunnySmileJoyfulHopefulPlayfulAmusingBelieveCheerfulLaughingPositiveDreamingOptimisticEncouragingLighthearted

Acids and Bases 2025-03-27

15 Items: ph of 7ph below 7ph above 7ph is in _____ of tensph of a neutral substancewhat we trying to neutralizered cabbage is an example of this- what acids and bases are to skindigital device that tells you the pha kind of indicator we use to test pHwhat color litmus paper turns when an acidwhat color litmus paper turns when an base...

Fractions and Decimals 2025-04-02

15 Items: PartWholeValueDecimalConvertFractionSimplifyAdditiveSubtractNumeratorEquivalentPercentageProportionDenominatorMixedNumber

Emotions and Actions 2025-05-09

15 Items: proudcryingyawningsmilingshakingnervousrelaxedWorriedshoutingfrowninglaughingblushingrelievedsurprisedembarrassed

Needs and Relationships 2025-05-27

15 Items: NeedTrustSafetySupportRespectExpressEmotionsConflictBelongingListeningSelfEsteemReciprocateRelationshipCommunicationSelfActualization

planets and space 2025-06-03

15 Items: SunMarsVenusEarthPlutoOrbitCometSaturnUranusGalaxyMeteorMercuryJupiterNeptuneAsteroid

Food and drinks 2025-06-14

15 Items: sodahoneyfruitsteakpizzasyrupbreadcheesecoffeeyoghurtsandwichomelettesmoothiefried ricevegetables

Inventions and Inventors 2025-06-20

15 Items: BellRadioSteamTeslaCameraEdisonWrightBatteryAirplaneInternetComputerPrintingLightbulbTelephoneTelescope

Recycling and Conservation 2025-07-01

15 Items: WastePaperGlassReuseGreenReduceEnergyPlasticRecyclingPollutionCompostingEnvironmentEco-friendlyConservationSustainability

Countries and Capitals 2025-07-01

15 Items: - Tokyo- Madrid- Ottawa- MoscowItalyRome- Beijing- Canberra- BrasíliaFranceParis- New DelhiUnitedKingdomGermanyBerlin- Mexico CityKorea - Seoul- Buenos Aires

Fruits and Vegetables 2025-07-02

15 Items: CornPeasAppleMangoLemonOnionBananaCarrotTomatoGrapesOrangePotatoCucumberPineappleStrawberry

Herbs and Spices 2025-07-02

15 Items: BayDillMintBasilFennelGarlicGingerNutmegCayenneOreganoAllspiceAmarettoCardamomCilantroCinnamon

Insects and Bugs 2025-07-06

15 Items: beeantflybugwebhivewingsstingcrawlspiderbeetleantennaebutterflygrasshoppercaterpillar

Countries and Capitals 2025-07-07

15 Items: RomeParisItalyJapanTokyoEgyptCairoIndiaDelhiSpainFranceBrazilCanadaOttawaBrasilia

Food and Nutrition 2025-07-07

15 Items: FatDietWaterFiberSugarFruitsGrainsEnergyProteinVitaminsMineralsCaloriesBalancedVegetablesCarbohydrate

Jobs and Occupations 2025-07-08

15 Items: ChefNursePilotDoctorPoliceArtistFarmerTeacherDentistBuilderEngineerMechanicScientistLibrarianFirefighter

Trees and Plants 2025-07-11

15 Items: OakPinePalmFernMossRootLeafSeedMapleBirchCedarWillowCactusFlowerBamboo

Reptiles and Amphibians 2025-07-11

15 Items: FrogToadNewtSnakeGeckoSkinkLizardIguanaTurtleKomodoTortoiseCrocodileAlligatorChameleonSalamander

Materials and Properties 2025-07-11

15 Items: WoodClayFoamMetalGlassStonePaperFabricRubberPlasticTextureStrengthHardnessAbsorbentFlexibility

Fruits and Berries 2025-07-11

15 Items: PearPlumKiwiAppleGrapePeachMangoBananaOrangeCherryBlueberryRaspberryPineappleStrawberryWatermelon

Feelings and Expressions 2025-07-11

15 Items: SadShyCalmHappyAngryProudTiredBoredScaredLonelyExcitedNervousJealousConfusedSurprised

Countries and Capitals 2025-07-12

15 Items: RomeParisItalySpainJapanTokyoIndiaDelhiFranceMadridBerlinCanadaOttawaBrazilGermany

Plants and Trees 2025-07-13

15 Items: LeafStemRootSeedTreeBushBarkSoilPetalWaterFlowerBranchOxygenSunlightPhotosynthesis

Spices and Herbs 2025-08-02

15 Items: BasilThymeCuminChiliGingerGarlicPepperNutmegOreganoPaprikaVanillaCilantroRosemaryTurmericCinnamon

Puzzle 1 2025-08-02

4 Items: ANDFORTHEYOU

Good Laboratory Practices 2024-05-14

17 Items: The G in GLPThe L in GLPThe P in GLPThe L in ALCOAThe C in ALCOAThe O in ALCOAYear GLPs writtenYear GLPs approvedThe first A in ALCOAThe second A in ALCOAYear GLPs written into LawDescribes how a task is done on a studyCurrent Summary of training and experienceDirector Single point of contact for a study...

M3 Parts of a Flower 2023-09-04

14 Items: the male gamete of a flower.Tough outer coat of the seed.Sweet, sugary fluid found in flowers.Part of the flower that stores pollen.Type of organ flowers are to the plant.Colorful part to attract insects and birds.Part of the flower that holds up the anther.The place where the male and female games fuse....

Holiday Word Search 2024-12-06

27 Items: ElfTreeSnowFoodCheerSantaEggnogLightsNutmegKinaraLatkesFamilyHolidayMenorahDreidelCandlesPresentsNew YearReindeerCarolingMistletoeHot CocoaChestnutsFireplaceOrnamentsJelly DonutMilk and Cookies

Healthy Waterways 2025-02-03

22 Items: poocareroaddrainCreekrunofflittergardenqualitywetlandsedimentpollutionnutrientswaterwayswaterwisevegetationand gutterbiodiversitybiofiltrationpollutant trapsustainabilitywash detergent

NEW JERUSALEM COGIC WOMENTS DAY 2025-05-03

36 Items: ANDZEROFOURPUSHTHRUVERSEFOURPMLATOYASPEAKERSIMPSONNINETEENMICHIGANDISTRICTLOCATEDATKALAMAZOOPRAYUNTILEVANGELISTSHAYLAHALLSUPERVISORCUNNINGHAMMISSIONARYFIRSTANNUALELEVENAMANDTWENTYFIFTHTWENTYSIXTHREGISTRATIONNCHURCHSTREETALLAREWELCOMESUPERINTENDENTMICHIGANWESTERNWOMENSDEPARTMENTSOMETHINGHAPPENSWILLIAMEADAMSIIISECONDJURISDICTIONCHRISTINECUNNINGHAM...

Ancient Rome Vocab #1 2024-04-29

16 Items: A person who is highly educated.A public office in the Roman Republic.A war between citizens of the same country.To break away from or rise against authority, a rebellion.A powerful body of 300 members that advised Roman leaders.The governing and advisory council in the Roman constitution....

Valentine's Day Word Search 2025-01-28

14 Items: LipsFuseCakeBlingHeartCandyof GoldDropperFountainGram CakeShell KitAnd PeaceSparklersGram Cake

Unit 5-Vocab 2025-01-07

10 Items: seeming difficult to do or deal with in, overwhelmingthe tendency of metals and alloys to form cracks during stressa paid training program that uses classroom and on the job training.a material's ability to deform without breaking under tensile stressa measurement of how often an event occurs over a specific period of time...

Mythology and Legends 2025-04-14

10 Items: PHOENIX : A magical bird that is reborn from its ashes.GIANT : A huge mythical being much larger than a human.HERO : A brave person admired for courage and noble deeds.TREASURE : Valuable items like gold, jewels, or hidden riches.DRAGON : A large, magical creature that can often fly and breathe fire....

Earth and Space Science 2025-04-14

10 Items: GLACIER : A large, slow-moving mass of ice formed from compacted snow.AXIS : An imaginary line around which Earth rotates, causing day and night.MAGMA : Molten rock beneath Earth's surface that can form lava when erupted.ORBIT : The curved path of a planet or satellite around another celestial body....

MOCA 2025-07-01

10 Items: This word describes how we show care in our communication.These help us stay efficient, balanced, and focused in our work.What it takes from every role to complete a project successfully.The role focused on supporting internal systems and training the team.The person who gives a final polish to every project before it’s sent....

Values Word Search 2024-08-23

59 Items: funHopeреaceLogicTrustUnitygrowthHealthWonderbalancebraverycomfortCouragefreedomharmonyHonestyRespectPassionLoyaltyJusticeambitionfairnessSecurityCreationPatienceOptimismOpennessLearningcommunitygratitudeDiscoveryEnjoymentIntegrityStabilityStructureacceptancecompassionConnectionexpressiongenerosityCreativityInnovationUniquenessachievement...

Incognito Word Search 2025-02-09

11 Items: (adj): aware.(adj.): meaning the same as.(noun): subcategory or subgroup.(noun): official system of naming.(adj,): not revealing one’s identity.(adj.): in name only, not completely true.(adj.): relating to the process of thought.(adj.): disguised as someone other than oneself.(noun): use of trickery and false logic in arguments....

Philanthropic word search (Hard) 2023-11-07

10 Items: having a friendly, generous and considerate towards othersabundant, plentiful, or having a large quantity or somethingact of using one’s wealth, resources, or time to benefit othersnot holding back, being harsh or severe in criticism or judgementHaving a kind and generous disposition or intention towards others...

Mental Health Awareness: Nursing School Edition 2024-05-15

10 Items: coffeesnackshobbiesselfcareexercisehydrationmeditationpositivitysocializingdigitaldetox