health and wellness Word Searches

Doctors 2025-01-24

35 Items: aidcoatxraynursescrubclinicgloveshealthoxygenreflexvitalsbandagecheckuppatientscalpelsurgeonsyringevaccinehospitalpharmacyrecoveryresearchdiagnosisdisinfectemergencyinjectionoperationproceduretreatmentmedicationappointmentexaminationstethoscopethermometerprescription

Health Information Manangement (HIM) Word Hunt 2025-10-06

34 Items: DiagnosisEKGReportMRIReportPFTReportSignatureECHOReportPlanOfCareXrayReportConsentFormsCTScanReportTransferFormCertificationProgressNotesScreeningFormPhysicianOrderOfficeVisitNoteOperativeReportRecertificationAnesthesiaRecordDischargeSummaryImagingWorksheetMedicalNecessitySleepStudyReportUltrasoundReportInitialEvaluationMammographyReport...

Mental/Emotional Health Wordsearch (2.1-2.5) 2026-01-22

33 Items: SadCopeTimeHappyAngryGoalsFocusSocialGrowthStriveAnxietyBatteryEmbraceProblemEmpathyMindsetMistakeFailureSuccessEmotionsNumbnessSolutionSympathyWellBeingSelfWorthContinuemAdulthoodPositivityNegativityExpressionResilienceImprovementAdolescence

Amanda's Litty Word Search 2025-10-08

12 Items: PCR: ____ chain reactionName of drive-in in San DiegoAmanda's undergraduate major currentlyColor of Amanda's car that Kaylie lovesPiano Surprise song at Eras Tour Amanda and Kaylie attendedMovie that Amanda, Kaylie, and friends watched at the drive-inAcoustic Surprise song at Eras Tour Amanda and Kaylie attended...

Emotional Intelligence Word Search 2025-12-29

9 Items: The EI component involving understanding others’ emotions and perspectives.The EI component focused on managing impulses and staying calm under pressure.The score or measurement used to assess emotional intelligence, similar to IQ.The EI component that drives persistence, passion, and resilience toward goals....

Private Word Search 2025-01-27

27 Items: safetyhealthto careof APPsburnoutworkforcechallengescare modelstelemedicineto NIH fundingreimbursementshealth effortssustainabilitybetween GI groupsreducing GI spendinequities from AIin clinical trialsmicrobiome controlequity's involvementtechnologies like AIrole of associationsauthorization hurdlesof gastroenterologistswith new administration...

DOLCH SIGHT WORDS - List 1 2016-06-10

20 Items: aIheofontoinittheandhisbutforshewashadyoutheysaidthat

Global Interconnections 2017-06-06

21 Items: andFairTradeGoodstradeImportExportSocialProfitProduceConsumeEconomicservicesIncreaseDecreasePoliticalTransportEnvironmentGlobalisationCommunicationInterconnectedness

O antiphon 1 2021-01-12

21 Items: OoftousofourGodandtheMostHighwithlovecomepathpowerteachWisdomguidingcreationknowledge

PARAGRAPH 2023-05-24

20 Items: orandbutcausesincewordseffectclausemarginindentproblemsolvingcomparebecauseoutlinephrasescontrastsentencesignalwordspunctuationmark

AND Continuing Words 2024-09-07

20 Items: andalsowhilethatisinfactindeedfinallymoreoverlikewisesimilarlyinadditionforexamplepreviouslyfurthermoreforinstanceeffectivelyessentiallyspecificallyinotherwordssubsequently

And Word Search 2025-02-27

20 Items: asbedoheismeoftoandareseethewasyoubookfromhavelooksaidwhat

1st anniversary 2025-03-16

20 Items: ItomyandYouAllmanymorecomeLoveWithMarchJulioFirstyearsHeartHubbyWifeyDeniseAnniversary

Atlas Word Search 2025-03-24

20 Items: andcatwassadbaglegwhobutdogbeehaynotpayeradaylogcowboghowcog

Elijah 2025-06-09

21 Items: BEDSATTHECATBEDPEGDOGANDBIGMUDHILLRUNSHOMEWENTSAIDSANDGOESWALKBEACHWHERELITTLE

Austen House Word Search 2025-10-14

21 Items: andandlovelifejaneemmafindshonorpridesenseknightaustenwhoeverpersuesmrdarcyproverbs21verse21prejudiceprosperitysensebilityrightouesness

20 Sight Words 2025-10-24

20 Items: anbyonanyaskflyandhadseehasfromgivelookplayhavesaidHerelikecouldevery

Sight Words 2025-10-29

20 Items: dohememyandcanhasshewasyouhaveherelikelookplaysaidthiswithwherelittle

November Wordsearch 2025-11-02

20 Items: OnAndNowOneForTwoGiftFormEachEntrySpentFiftyBucksThriftEqualsDollarsExampleEntriesTwentyfiveCompetition

Happy Valentine's Day! From Violet 2015-02-08

12 Items: ANDDOGMOMDADLIKELOVEHAVEHAPPYVIOLETMS.LEEFRIENDCUPCAKE

Gold M100W 2017-08-12

12 Items: aIbeinisitoftoandthewasthat

About Word Search 2022-09-07

12 Items: atallandeveraboutearlyenougheitheritselfinterestimportantinformation

Cat Word Search 2022-09-06

12 Items: hetoyoushetheandfortheythisthatwiththese

Puzzle 1 2022-09-07

12 Items: atallandeveraboutearlyenougheitheritselfinterestimportantinformation

The Bible - The Word Of God 2023-11-04

14 Items: aaistomymyandforyourwordlampfeetpathlight

0129 2024-01-29

12 Items: egghasandbutbeeflikehaveapplebananaorangenumberchicken

Gold high frequency words 2024-03-27

12 Items: iisaminnoitgoattodidtheand

week 4 2024-08-08

12 Items: sipNatSamDanandsadpanpintiptapmadmap

Unit 1 Sight Words 2025-01-30

12 Items: ONAMITINATCANANDDIDHADHIMHASSAID

Ice fishing 2025 2025-01-12

12 Items: AndCodeYourExistMorseBetweenTappingMissionMessagesTranslateDifferencesCommunication

Jump Out Words 2025-05-30

12 Items: ofittobeasattheandyouforarewas

Got questions? Search His word! 2025-10-11

12 Items: BeHeIsAndGodSixTenKnowThatStillPsalmForty

The Word Search 2025-10-20

12 Items: oftoinisithetheyouandforwasthat

Feel better!!!!!! 2025-10-24

13 Items: Mr.AndAndYouAreTheFeelYourBestEnjoyBetterDonaldHalloween

Of Word Search 2025-11-01

12 Items: ofifnoitheongotheareandyesthat

Week 1 Words 2025-11-09

12 Items: anatmannaptanmatsatjamJantheandalways

. 2025-11-18

12 Items: HiatYwsandareYeahformrazorspeechclimatewatchingdisturbed

Spelling List #1 2020-04-30

12 Items: gonotheseesheandyouforplaywithjumplittle

fair trade vocabulary  2021-02-08

12 Items: andtradeIncomeSupplydemandImportsProfitsJusticeBargainexports.Consumersworkforce

im a dog 2021-05-14

14 Items: catdogandlionkailaveykailkisszebrahippotessaaveryaveryelephant

Insects Word Search 2023-09-14

14 Items: sixoneonetwoandmayhavelegsheadhavewingsthoraxinsectsantennae

VRQMVOTJ 2024-01-26

12 Items: foranddearjoinmealcutievivekmistrypleasehomemadevalentinesactivities

3.kl sõnarägastik 2024-09-18

12 Items: andByelateunitMissthatHellosorrymorningBritainAmericaFinland

Smile Word Search 2024-11-25

12 Items: sayearandcanarmhelpnicenamesmilesharemouthlisten

Heart Words 2024-12-10

12 Items: wetogodocantheseeandyousaidlikethey

Romans 10.17 2025-09-08

13 Items: ofSoandtheWordfromfaithcomesChristRomanshearingthroughhearing

PSALM 119:105 2025-10-02

15 Items: AAISTOMYTOMYANDYOURWORDLAMPFEETPATHLIGHTPSALM

Ephesians 4:32 Puzzle 2025-11-09

12 Items: andoneGodkindeachjustotherChristanotherforgaveforgivingcompassionate

Find the following words 2025-12-24

12 Items: AIWeTheAndSeeCatMatSatPatRatLike

physical weathering 2016-05-23

15 Items: androckthawfrostfrostfreezeerosionwedgingwedgingabrasionphysicalsedimentsweatheringdepositionexfoliation

COUNTRIES 2021-09-22

13 Items: andAngolaAlbaniaAlgeriaAndorraAntiguaBarbudaArmeniaAustriaArgentinaAustraliaAzerbaijanAfghanistan

Fair trade By:Caston 2022-02-07

13 Items: andsellsupplydemandretailworkersbargainsocietyproductfairtradeconsumerscapitalismentrepreneur

Miguel Word Search 2022-06-09

13 Items: isoftofatandoutthewalkfindhousegrassmiguelshould

Lesson 15 Sight Words 2023-01-31

13 Items: tomemywenowyouandseearethewithwhatcome

Sight Words- Set 1 2023-11-04

13 Items: wegoishetheseecanshehasandlikeplaylittle

Emma's Sight words 2024-02-12

13 Items: soorofbenodoamatareforallandlook

To cure ur boredom 🌷 2024-11-05

13 Items: IsToYaAndSaifAhblAlsoDontYbalaPunchStudyForgetTaisie

Whatever Word Search 2025-05-25

13 Items: totheandareduethatyourpowerkrupasolelypossessWhateverinspiration

Green Eggs & Ham I 2025-07-24

13 Items: andareboxcareatfoxboatdarkeggsgoatgoodcouldanywhere

Unit 5 Crossword 2025-07-25

13 Items: orsoForandnorbutyeteitherratherhoweverneitherwhethernotonlybutalso

natalie and tilly and natalie and tilly  2016-05-31

17 Items: stopstayskipskinspinspotlivemenuskillspilltherethesebeganbelowbecamedetailwednesday

Ch. 2 - Explorers to the New World Gr 5 2025-11-18

17 Items: great harman organized journeya ship with triangular sailspeople who buy and sell goodsto sail completely around the worldSpanish soldiers who were conquerorsan outbreak of disease that spreads quicklyslave traders bought and sold humans as propertya settlement or area far from the country that rules it...

I Word Search 2026-01-15

40 Items: DODJBARPIEKISSVEILVOWSRINGSUITHOFFLOVEBRIDEGROOMDANCEDRESSTOASTAFTERHEELSPHOTOSPETALSAUGUSTCHEERSSUNSETFAMILYAND MRSFOREVERBOUQUETHOLLANDWEDDINGHITCHEDFRIENDSMARRIAGEMICHIGANOFFICIALHONEYMOONAND HAVENCOCKTAILSCUFFLINKSBOUTONNIEREPHOTOGRAPHER

Pinocchio Word Search 2026-01-22

29 Items: PanInc.NemoDumboBambiMulanStoryBeautyTarzanFrozenAvatarAladdinTangledPoppinsFantasiaHerculesZootopiaPinocchioLion KingCinderellaDalmatiansPocahontasParent Trapin Wonderlandand the Trampand the BeastLittle MermaidSchool musicalof the Caribbean

Human Body Systems 2023-05-08

11 Items: provides movementsends messages as hormonestransports blood through bodyprotects the body from diseasebreak down and absorbs nutrientsfilters blood and excretes wastemakes hormones, egg and sperm cellstransports oxygen and carbon dioxideprovides structure, makes blood cellsfancy system name for the skin, hair, nails...

Unit 1 Reading 2: The Star Llama 2025-09-12

17 Items: A meetinglively and playfulTo happen or take placeHavin or giving off heatShine with a steady lightA plan used to reach a goalSpecial relationship or connectionA flowing body of water like riverSomeone you are with, often a friendTo shine with a soft flickering lightTo bring together into one place or collection...

Pharmacy Week Biometrics Word Search 2024-10-09

12 Items: A1C tests your blood _______ levels._______ (abbreviated version) is also known as cholesterol.Humana’s well-being rewards program is through _______ _______.BMI is calculated using your weight, height and _______ _______._______ (abbreviated version) is also known as good cholesterol....

Protagonist Word Search 2023-08-18

14 Items: In the second act, Grendel's mother seeks _____ for her son's death.His loyal warrior, _____, assists him, and together they slay the dragon.Beowulf defeats Grendel using his immense strength, earning the _____ of the Danes.Despite his advanced age, Beowulf valiantly battles the dragon but is _____ wounded....

Grand Word Search 2022-06-05

30 Items: jdiTeamQueenmusicIdeasGuardBetheljobiesritualawardsa LikesDressesmascotsvisaliadreamerstresurerand ShowchaplianelepantsDaughtersCustodianBraceletsmedallionlibrarianCord ClubchaperoneCaliforniaand Craftsvolleyballcompetition

Christian Iconography Word Search 2025-12-04

32 Items: IHSEyeDoveFireWindLilyGoatHaloCrossCrossAnchorof GodBranchChristChi-RhoIchthysPeacockBaptismTrumpetSerpentAureoleShamrockShepherdof Judahand WineTriquetraand OmegaPentagramMonstrancePomegranateFleur-de-LisBronzeSerpent

I Word Search 2026-01-15

40 Items: DODJBARPIEKISSVEILVOWSRINGSUITHOFFLOVEBRIDEGROOMDANCEDRESSTOASTAFTERHEELSPHOTOSPETALSAUGUSTCHEERSSUNSETFAMILYAND MRSFOREVERBOUQUETHOLLANDWEDDINGHITCHEDFRIENDSMARRIAGEMICHIGANOFFICIALHONEYMOONAND HAVENCOCKTAILSCUFFLINKSBOUTONNIEREPHOTOGRAPHER

Soap Word Search 2025-07-28

21 Items: A film or show with singing and dancingshow A program where guests talk with a hostcomedy A funny love story in a movie or showA funny movie or show that makes people laughA suspenseful movie with tension and excitementA film made using drawings or computer graphicsA movie about cowboys and life in the Wild West...

Soap Word Search 2025-07-28

21 Items: A film or show with singing and dancingshow A program where guests talk with a hostcomedy A funny love story in a movie or showA funny movie or show that makes people laughA suspenseful movie with tension and excitementA film made using drawings or computer graphicsA movie about cowboys and life in the Wild West...

Word Search - Golden Words 2018-06-24

12 Items: Iaofisbetoinitwastheandthat

EH 2018-03-13

12 Items: tencatbotthefortoowinwonwowandarewhy

Name: _____________ Lesson 16 2023-02-06

12 Items: issoofmyhowandtheyoumanywithwhatwhere

Fundations 1 Unit 2 2025-06-25

12 Items: isoftheandhiscatsiplogfoxfitpetdug

TO THE WOMAN WITH THE MOST BEAUTIFUL SMILE 2025-07-30

14 Items: IYouAndYouTheAndLoveMostTodaySmileLaughVivianForeverBeautiful

fraya is a poo 2025-07-31

12 Items: aiisdoMEpooandyesdidthisfrayaALISSIA

Millies camp word serch 2025-08-05

12 Items: andcliprockwallclimbdinnerarcherypegwingcholatebreafastclimbingpillipiland

• W O R D S E A R C H • 2025-08-30

12 Items: byeaJforandJARSEarthMEDANKLINIKProjectBirthdaynatureaJREBOISASI

My Motion and Machine word search. 2025-10-18

16 Items: to put togetherto go up and outa machine that helps lift thingsplane- a machine that moves objectsa simple machine that goes up and outis a movement from one position to another.( The scientist) First Law of Motion states:- is any applied force that moves an object.- are any type of device/technology that makes work...

National Public Health Week Vol. 3 2025-04-11

30 Items: ArtQPRTMCASISTAMHFASunrunWalkingTakeahikeTigertotsDawnrisersVolleyballBasketballRabbitbrushZumbastrongRunforhealthFooddriverunPlannerpartyMentalhealthWalkforhozhoSTIawarenessFlexymobilityLoveoffitnessHealthymothersDumbbellcrusherstressawarenessSoccerforsuccessalcoholawarenessWellbeingwarriorsHealthandwellnessexponihidineebawellnesscenter

Celebrating the Superheroes of Health Information 2025-04-21

42 Items: CakeDataMailROLOPunchWebexAthenaBagelsCodingDonutsLetterSnacksHIMTeamOutlookPotluckRecordsDocuwareIndexingScanningTrackingCelebrateIntegrityDiagnosisDictationDuplicateMicrofilmPhysicianRadiologyTouchworksDateofBirthAllscriptsPMHealthSourceRevenueCycleAuthorizationMedicalRecordTranscriptionCorrespondenceCustomerServiceInsuranceReviewPatientAdvocate...

Women's health event CLO X folly 2025-05-22

21 Items: CLOGUTACNESKINDETOXFOLLYLIVERBREATHECZEMAENERGYBALANCESYNCINGCORTISOLESTROGENHORMONESANDROGENSAWARENESSCONFIDENCEMICROBIOMERESILIENCEPROGESTERONE

Health-Next Level Friend/Dating Skills 2025-11-25

25 Items: talkcodeshoutshareclearplansbuildcurfewfamilyrespecthealthycouragediscusskindnessschedulepressurerehearseelaboraterejectionboundariesguidelinesfriendshipintentionalconversationcommunication

Can Cell Phones Harm Our Health? 2026-02-11

30 Items: ratCDCDNAearSARcalltextphonemouselimitsleepmachlagliomaprovenlengthdebatecautionstudiessciencespeakerpocketsheadsetharmlessquestiondizzinessradiationHeadachesdangerousmigrainesreception

American Revolution 2025-11-02

15 Items: Known for leading violent riots against the British.These Colonists opposed British rule in the colonies.These Colonists supported British rule in the colonies.Famous for the pharse "Give me liberty, or give me death."An act meant to single out Massachusetts, and punish them for the Boston Tea Party....

animals and summer and christmas 2013-12-10

44 Items: catdogbeeflyfoxcowhotsunbirdliongoatswimsandtigerkoalasheepbeachoceantowelspadeangleSantaelveslizardmonkeyrabbitpossumbreezebuckettinselfamilychickenfriendselephantladybirdkangaroosunshineumbrellabutterflydragonflysunscreenChristmassandcastledecorations

sports 2025-09-03

20 Items: – Losing a game.– A short, fast run.– A sports contest or game.– A series of competitions.– A person who plays sports.– Breaking a rule in a game.– The total points in a game.– Practice to improve skills.– The winner of a competition.– Enforces the rules in a game.– Physical health and strength.– A point scored in many sports....

Averroès 2024-11-26

20 Items: EnergyImmuneBiologyCultureSurgeryMoleculeResearchMythologyTraditionDiagnosisDiscoveryExperimentPhotosynthesisThe smallest unit of matterThe study of disease causes and effectsA monumental structure from Ancient EgyptThe protein in red blood cells that carries oxygenA tool used by doctors to listen to the heart and lungs...

Planets and fruits and people 2024-12-02

26 Items: SunBenLiaMarsMoonPearEarthPlutoGrapeApplefruitMangomelonMasonSaturnOrangepapayaFruitsJupiterPlanetscoconutKayloniKennedyHoneydewElizabethWatermelon

Proud Word Search 2023-05-25

13 Items: EyepopMaryBestrollsoulsingerauthoractressselling artistand Tina Turner Revuelove Got to Do with Itand roll Hall of famer

2025 PRM ID/Avoidance Word Search 2025-05-06

23 Items: ***** up***** room***** ahead****** risk**** time outAvoid *******Use the *********** workersScan for ********* on instinctKnow your **********. Stay alive***** for hazards********* hazards*** for assistanceTrust your ********Stay ***** and engaged****** unaddressed hazards**** the demands of the taskUse proper *** and equipment...

Group 1 2026-01-12

5 Items: Based on age, health, lifestyle, and labs etc.A leveled payment throughout the term of the policyDrafts occur on the 1st, 8th, 15th, and 22nd of each month.Window during which a term policy may be switched to a permanent policyDiscounted rate based on premium payment being annual, semi-annual, quarterly, monthly

Lions and Tigers and Bears 2024-01-28

32 Items: sunbearmasailionwhitelionbalitigerbrownbearpandabearpolarbearslothbearjavantigerjavantigerwhitetigerandeanbearkodiakbearafricanlionasiaticlionbarbarylionpantheraleobengaltigergrizzlybearcaspiantigercaspiantigermalayantigersiberiantigersumatrantigerspectacledbearsouthchinatigermelursusursinustibetanbluebearindochinesetigerasiaticblackbear...

Ethics 2025-11-05

18 Items: An imaginary line that separates me from you.How we define our relationships with clients.Doing what is right even when no one is looking.Our own moral principles that govern our behavior.The last step to setting boundaries is to trust your _________.ATC Company PREA policy has a _____ tolerance for PREA violations....

Feelings Word Search 2023-03-08

27 Items: shysorrylet downirritatedsurprisedvery scaredcause injuryeasily upsetuncomfortableextremely angryfuriously angryunable to relaxsorrow or miserysilly and excitableoverwhelming happinesseager to know somethinghushed or nearly silentanxious and apprehensivegreat happiness and triumphlively energy and excitementenvy of someone's advantages...

American Word Search 2025-04-22

14 Items: Someone from CanadaNumbers and problemsBarbara is from the UKYou can draw and paintCleopatra,gods and warsSomeone who's from the USAGreta is German, she's fromJoao is brazilian, he's formMessi is from Argentina, he'sNaomi is Japanese, she's fromCitlali is Mexican, she's fromSalvattore is Italian, he's fromSomeone who was born in China is......

Quaint Word Search 2025-11-17

13 Items: paths for bicyclesfull of life and energypaved with rounded stonesunwanted or harmful soundbusy and full of activityspace area for vehicles outsidebeautiful and visually charminggently sloping landscape featuresarea where only walkers are allowedparking facility below ground levelregular travel between home and work...