health and wellness Word Searches

Exercise Word Search 2025-05-11

50 Items: ArtYogaFilmMindMovieGamesGenreSpaceMusicHobbyFlavorNatureSportsPlanetAuthorDesignJourneyScienceHistoryCultureAnimalsTourismCuisineWritingAthleteFashionTextileFinanceExerciseDiscoverBusinessWellnessComputerPaintingActivityWildlifeCommerceDeliciousEconomicsAdventureNutritionAlgorithmTechnologyLiteratureInstrumentPsychologyEnvironmentArchaeology...

Micah 4 The Lord's Reign in Jerusalem 2023-04-30

21 Items: You will go off to ???We will walk in His ???I will make your horns ???Many say, "Let her be ????"There will be no ??? anymoreArise and ??? daughter of ZionAnd their ??? into pruning hooksNo one shall make them ???anymoreAnd they do not understand His ???I will gather the lame and the ????Now it shall come to pass in the???days...

Word Search 2025-12-15

20 Items: App for short videosSweet ring-shaped treatSuperhero movie universeSport played with a hoopTakeaway food with toppingsPopular casual or sports shoesPlaying video or computer gamesWhat you hold to play most gamesUsed to listen to music privatelyThe part of a car that makes it runOnline game where users create games...

Vocab Part 2 2023-02-28

15 Items: a popular votemilitary draftthe right to votecan defend with logicking noble and easantssudden overthrow of the governmentmilitary static where they burn or destroy cropsto formally give up control of a country or stateto incorporate into an existing political unit, such as a city or country...

Vocab 3 2024-09-18

15 Items: A living part of an ecosystemA nonliving part of an ecosystemStep in a food chain or food webAn organism that makes its own foodAn organism that cannot make its own foodA consumer that eats both plants and animalsConversion of light energy from the sun into chemical energyOrganism that feeds on plant and animal remains and other dead matter...

Deaf Appreciation Month Word Search 2025-03-11

15 Items: Not completely deafDeaf Awareness MonthTo have loss of hearingA device that can help people hearA famous deaf inventor and businessmanThe last name of the inventor or hearing aidsA famous deaf disability rights activist and an authorThe past of deaf or hard of hearing people and cultureA famous deaf composer and pianist in the 1700s and the 1800s...

Vocabulary Words 2025-11-25

13 Items: adj. -French origin, bizzare "odd/fantastic"adj. -Latin origin, from vulnerare "to wound"v. -Latin origin, from in "in" and durus "hard"v. -Latin origin, from examen "a test, balance, or weight"n. -Latin origin, from per "through" and specere "to look"v. or n. -Latin origin, from contra "against" and stare "to stand"...

Mental Health Awareness Month 2023-05-24

11 Items: swingsstressfatiguecourageinsomniaemotionsselfcareexercisetirednesscommunicatemindfulness

AEG Word Search 2024-04-16

38 Items: airasgwildeiaegsoilsafewordsafeflowsoilarchwatercleanexcelearthhealthtimelysnacksrecycleleaderstestingsamplesclientsschoolsleadersteamworknutshellmanagersprojectscompliantdeadlinesstormwaterconsultingtechnicianaccountingconsultantsenvironmental

Brandon & Tiffany 2025-02-01

36 Items: FUNLOVECAKEKISSRINGADORETRUSTBLISSGROOMBRIDEDRESSDRINKSMALENYHEALTHCHEERSBRANDONTIFFANYFOREVERROMANCECHERISHSUPRISEPROMISELOYALTYWHISKEYFOREVERJOURNEYTOGETHERDEVOTIONTEAMWORKFAVOURITEHAPPINESSADVENTURECHAMPAGNEFLOWERGIRLSUNCONDITIONALENGAGEMENTPARTY

Junior Year in Review 2025-06-09

35 Items: ArtMathMassAPUSHHouseCommaLunchYondrHealthSummerWinterClauseFinalsEnglishHistoryPhysicsBaldwinRetreatChargerTechBarTheologyResearchMidtermsSentenceAssemblyWorkStudySemicolonFitzgeraldGradatGradSocialHallChromebookConvocationCollegeCareerMulticulturalGoogleClassroom

Summer Enrollment 2025-06-11

30 Items: FSAEOITIPPDentalVisionHealthTexFlexYou_OnlyDeadlineLong_TermBeneplaceTexa$averShort_TermDependentsERS_OnLineDisability401(k)/457Add_or_DropEligibilityPrescriptionJune23-July04Opt_Out_CreditAD&D_InsuranceYou_plus_FamilyExpress_ScriptsAlightSolutionsOptional_Term_LifeTobacco_User_StatusChild_CertificationHealthSelect_of_Texas

Patient Education 2025-08-05

29 Items: AidsChangeSettingLearningTeachingFeedbackLiteracyHandoutsCoachingResourcesPromotionWorkshopsEducationteachbackCurriculumAssessmentEvaluationEngagementMotivationCounselingMultimediaMonitoringInstructionEmpowermentInteractiveDevelopmentCommunicationUnderstandingDemonstration

Leadership class 2029 2025-09-02

35 Items: TASKFIREGOALSEXCELSPHERESTRESSCAREERTRADESHEALTHMISSIONCOLLEGEPATHWAYPLANNINGTANGABLERIGOUOUSTEAMWORKCIVILITYEXECUTIVEEDUCATINGCOUNSELORINTANGABLEEMPOWERINGPHILOSOPHYFLEXIBILITYPERSERVANCEENCOURAGINGORGANIZATIONSTAKEHOLDERSSELFRELIANCEMETACOGNITIONCOLLABORATIONSELFAWARENESSSELFDIRECTIONSELFASSURANCESELFCONFIDENCE

Dental Word Search Easy 2025-12-29

30 Items: PAINCANALTEETHDECAYPLAQUEBRACESTARTARCROWNSHEALTHX-RAYSBRIDGESSURGERYDISEASEHYGIENEIMPLANTFILLINGSFLOSSINGBRUSHINGFLUORIDECAVITIESCHECK-UPCLEANINGDENTURESTOOTHACHEMOUTHWASHTREATMENTWHITENINGEXTRACTIONPREVENTIONANAESTHESIA

Design Thinking Vocabulary 2026-01-04

35 Items: UAETESTWASTELOCALSMARTDEFINEIDEATEIMPACTGLOBALHEALTHMENTALPROBLEMCLIMATEQUALITYSOLUTIONFEEDBACKHERITAGEIDENTITYPROTOTYPEREDUCTIONRESOURCESRENEWABLESOLUTIONSWELLBEINGLIFESTYLEUNDERSTANDCREATIVITYTECHNOLOGYARTIFICIALENVIRONMENTSUSTAINABLECITIZENSHIPINTELLIGENCEAPPLICATIONSRESPONSIBILITY

Geometric Word Search 2025-09-27

18 Items: 23Forms occupy space, such as sculptures or buildings.- A line is a path made by an object moving across a surface.- describes the different ways elements of an artwork are arranged.- The art of making objects from clay and hardening them in a kiln.Shapes - are irregular or uneven shapes. These can often be found in nature....

Askiathegreat Word Search 2024-10-04

29 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthagegreat early church fathers and martyrs from Carthage...

constitution terminology 2023-01-22

20 Items: Having two branches or chambers.The first term amendments in the U.S. ConstitutionComposed of the Senate and the House of Representatives.A person who shapes or creates a concept, plan, or system.To control or supervise by means of rules and regulations.The funds or revenue of a government, corporation, or institution....

Cohesive Word Search 2025-02-10

30 Items: UnifiedDoubterPowerfulResidentGratefulSeparationExtremely angryLoyal and dedicatedEffect or influenceTamed for human useCombine into a wholeThe way someone actsOpen to harm or attackCareful and responsibleAccepting of differencesInequality or differenceOpen-minded or progressiveLack of interest or concernNatural impulse or behavior...

Sharks 2025-07-25

30 Items: makocoraljacksonmale cowstriped horsemetal in wiresvaluable metalto lie in the sunpirates of the ...yellow citrus fruitopen ocean swimmingflorence nightingaleclothes you sleep inbiggest fish in oceanhead shaped like a toolAfrican spotted big catcolour of ocean and skyspriritual agent of Godstripes and eats anythingmouth like a cookie cutter...

Neuroanatomy Word Search 2026-02-12

34 Items: pain reliefsignals painmuscle movementtriggers hungervital functionsfear,aggressionhearing,languagememory formationtriggers fullnessvisual processingvoluntary functionsinvoluntary functionssleep cycle regulationtouch,spatial awarenessfatty, insulating tissuecalming:"Rest and Digest"maintenance(ex.hunger,thirst)arousal:"Fight, Flight, Freeze"...

DEPOSITS SYSTEMS 2024-11-05

15 Items: USED TO ROUTE THE CORRECT CALLS TO YOUUSED TO FILE CLAIMS AND SERVICE REQUESTSUSED TO TRANSFER CLIENTS AND ACCEPT CALLSUSED IN MOBILE BANKING AS A DIGITAL ASSISTANCEUSED TO GUIDE THE CLIENT TO THE CORRECT DEPARTMENTYOUR MAIN RESOURSE FOR KNOWLEDGE AND GUIDANCE ON CALLSUSED TO CAPTURE COMPLAINTS AND VIEW PREVIOUS COMPLAINTS....

Communication Word Search 2026-02-05

23 Items: Communication that uses spoken words.The physical ability to perceive sound.Communication between two or more people.The process of sending and receiving messages.Actively paying attention to understand a message.The use and understanding of time in communication.The study of tone, pitch, volume, and rate of speech....

The Nervous System :) 2024-02-21

15 Items: - the largest lobe of the brain- the sensory switchboard of the brain- part of the brain that controls breathing- part of the brain that coordinates movement- part of the brain in charge of memory and hearing- a disorder of the brain characterized by repeated seizures- part of the body that receives and sends sensory information...

Pirate Word Search 2025-06-22

12 Items: A costume with a helmet and hoseA costume that looks like a machineA round, orange costume with a stemA big, roaring costume from long agoA fancy costume with a crown or dressA costume with a cape to save the dayA costume with a cape and sharp teethA costume with a pointy hat and broomA costume with a hat, boots, and lasso...

10 Humanities Revision 2025-11-09

12 Items: The mixing of races.Being the same in status and freedoms.The forced separation of people by race.Man who challenged Terra Nullius and won.Contained area that held Jewish people in WW2.Mass genocide of Jewish people by Nazis in WW2.Feelings of contentment that come from good wellbeing.A member of the National Socialist German Workers Party....

Semperfidelis Word Search 2024-04-15

24 Items: light and liberty-UNCto err is human-Senecafrom sea to sea-CanadaFor humanity-Wake ForestMake haste slowly-Augustusmind and hand-NC A&T + MITbuyer beware-famous proverbo the times! o the customs!always faithful-US Marine CorpsI think therefore I am-Decartesthus always to tyrannts-Virginiaart is long,life is short-Horace...

Criminal Thinking Errors 2025-07-01

15 Items: A criminal thinking error that shows a failure to follow through with commitments and intentions.A behavior of criminality that displays a lack of accountability for one's actions or obligations.A positive attitude of being thankful or having a readiness to show appreciation for and to return kindness....

Domestic Word Search 2022-11-20

35 Items: mentraphelptvadwomenstoryhealthdangerverbalgroupsaccessrightsvictimsupportwebsitedomesticviolencephysicalproductsservicesreliablepositivenegativechildrenfinancialresourcespreventioninfluencesobligationconsumerismrealisationinformationinfographicsocialmediaresponsibility

Love Word Search 2022-12-26

35 Items: joyloveflowsafehopemagicfaithtravelfamilybeautyhealthgrowthchangesecurefriendscourageclaritymindfulforgivefreedomempathymanifestkindnessstrengthblessingfearlessabundancegratitudestillnesslimitlessconnectionproductiveinspirationbreakthroughspirituality

Words of the Day 2023-04-06

35 Items: hivairaidsrestviruswaterhearthealthcancerasthmastrokevaccinehygieneobesitypathogenimmunityepidemicpandemicexercisesunlightdiabeteswholisticnutritiongermtheoryantibiotictemperancemoderationtrustingoddanieldietdeprivationmicroorganismdirectcontactchronicdiseaseindirectcontactcommunicabledisease

Human Services Word Search 2024-09-10

35 Items: careneedsgoalsnursehealthskillsassistmidwifeserviceempathysupportguidancepositivecounselorabilitiescommunityambulanceaptitudesattitudeseducationcompassionprotectionbehavioursexperiencecasemanageroccupationsolderadultsspecializedsocialworkerdisabilitiesindependenceprofessionalschildandyouthrelationshipsrehabilitation

Animal Rights vs. Animal Welfare 2024-10-09

35 Items: ZoosCareHealthRightsEthicsComfortJusticeCircusesEqualityAutonomyActivismAdvocacyStandardsWellbeingSufferingAbolitionSentienceEnrichmentRegulationProtectionLiberationCompassionSanctuariesFurindustryConservationExploitationAnimalrightsAnimaltestingInherentvalueAnimalwelfareRehabilitationOverpopulationFactoryfarmingNonhumanrightsHumanetreatment

Word Search Puzzle #2 2024-11-17

35 Items: ARTMATHDESKDRAMABOOKSLEARNMUSICPENCILRECESSGRADESSCHOOLHEALTHHISTORYNUMBERSSCIENCEENGLISHFRIENDSREADINGLIBRARYCRAYONSTEACHERWRITINGALPHABETHOMEWORKBACKPACKSPELLINGSTUDENTSSUBJECTSSCISSORSCLASSROOMGEOGRAPHYELEMENTARYLANGUAGEARTSSOCIALSTUDIESPHYSICALEDUCATION

risk taking 2025-11-03

30 Items: riskliferightsdangerhealthmakingsafetytrustsskillsdevelopseekingsupportstrategythoughtsidentityfeelingspositivenavigatenegativesolutionsjudgementawarenessbehaviourconscienceresiliencemanagementchallengesrecognisingadaptabilityresponsibilities

New Years 2025-12-28

35 Items: NewOldWishPartyToastMusicGoalsPeaceHappyClockCheersSnacksHealthNewYearBalloonSparkleSequinsBubblesFriendsGlitterDancingSingingConfettiMidnightBallDropMemoriesStreamerCelebrateCountdownFireworksGoodVibesGratitudeTraditionNoisemakerResolutions

PBS The Nervous System 23-24 2023-11-15

20 Items: the top part of the brain stemthe lobe that processes hearingthe bottom part of the brain stemthe middle part of the brain stemthe lobe of the brain that processes visionthe study of microscopic anatomy of tissuesthe type of cell found in the nervous systemthe nervous system that consists of the nerves...

Food , Drinks and deserts 2023-12-21

138 Items: hammilkcrabporkPORKmushyamswaterlagerlattestoutgritssushicoffeefrappegrappaeggnogoolongbrandycognacshrimpwafersturkeyquinoapotatosalmonsalamifondueseltzerslushiechicorylobsterhotdogslasagnawafflesoatmealpumpkinmuttonsoxtailslemonadesmoothieiced-teaestragonabsinthepancakesporridgepigtailspopsiclemilkshakecherryadeorangeadeiced-beerroot-beergreen-tea...

Nurse Word Search 2025-09-22

25 Items: Your mom and dad.Work that you do after school.The leader of the whole school.The children who learn at school.The place you go to learn every day.You can find swings and a slide here.The teacher writes on this with chalk.You carry your books and pencils in this.A short break for playing between lessons.The room where the school secretary works....

Ruler Word Search 2025-06-22

12 Items: A sheet you use to write or draw onThe person who leads the whole schoolThe room where students learn and workA writing tool with bold, colorful inkPeople you like to play and learn withA book with pages for writing and notesPages you read to learn or enjoy a storyA white stick used to write on chalkboards...

Chapter 4 Section 1 2025-11-03

13 Items: AgoraKnossosHoplitesHoplitesMainland __________ is a mountainous peninsulaThe first Greek kings were _____________________Early Greek communities grew up ____________________The Greeks were the first people to develop _____________like independent countries and varied in size this area is called...

Integrated Medical Wellness Get to Know Us 2023-06-13

14 Items: The owner of the clinic.The psychiatrist on staff.The medical provider on staff.The house manager of Maya house.The house manager of Melinda house.The facilitator with the fancy haircut.The administrator for the whole clinic.The medical biller working the front desk.The therapist in charge of everyone's care....

Eucharist 2023-11-13

9 Items: Going to the altar to receive...invoking the power of the Holy SpiritTranslation of Eucharist in Greek and thanks to GodAct of turning bread and wine to Body and Blood of Christ"to make holy" and shedding of Jesus' blood for our salvationthe highpoint of the mass and central sacrament with special title...

Jobs in health care 2024-03-21

11 Items: nursedentistorderlydieticiantherapistoptometristcardiologistpractitionerlabtechniciandermatologistxraytechnician

Coast Word Search 2025-08-01

16 Items: The movement of sedimentThe distance a wave has traveledAn area where the land meets the seaFine material is carried along in the waterThe dropping of material due to a loss of energyThe movement of water up a beach as a wave breaksThe covering of land with a large amount of waterLarge boulders and rocks are rolled along the sea bed...

Yes! Word Search 2025-11-19

21 Items: METTALOTUSBUDDHADHARMASANGHAMANTRATEMPLEBEINGSRINPOCHECHENREZIGSUFFERINGNAMASKARACOMPASSIONMEDITATIONDEDICATIONcan simply copy the list below and paste it into the generator of your choice:Using an online generator is the easiest way to make a custom word search puzzle....

How Can Hormone Health Help Me? 2025-07-01

21 Items: CalmFocusEnergyMemoryStrengthImmunityRecoveryVitalityStrengthDeepSleepDigestionEnduranceClearSkinFertilitylongevityStableMoodMetabolismConfidenceResilienceMentalClarityRegularCycles

Business Basics 10/31/24_Wellness is Safety 2024-10-29

36 Items: FluIAPNSCDietTeamColdsRisksSleepTiredAccessHealthInjuryMentalOfficeSafetyStressFatigueHazardsIllnessObesitySupportServicesVaccinesDecisionsIncidentsOwnershipReportingResourcesUnhealthyWorkplaceDrowsinessMedicationRespiratoryDistractionsConcentrationPsychological

Fiber Word Search 2025-01-02

29 Items: RiskpainFiberTotalfruitwatersugargramstrackgrainsweighthealthsolublehealthyDiarrheabloatingBenefitsgel-likeDigestionInsolubledissolvesmovementsvegetablesregulationsupplementsConstipationinflammationinflammationfermentation

Fiber Word Search 2025-01-02

29 Items: RiskpainFiberTotalfruitwatersugargramstrackgrainsweighthealthsolublehealthyDiarrheabloatingBenefitsgel-likeDigestionInsolubledissolvesmovementsvegetablesregulationsupplementsConstipationinflammationinflammationfermentation

Fiber Word Search 2025-01-02

29 Items: RiskpainFiberTotalfruitwatersugargramstrackgrainsweighthealthsolublehealthyDiarrheabloatingBenefitsgel-likeDigestionInsolubledissolvesmovementsvegetablesregulationsupplementsConstipationinflammationinflammationfermentation

District 34 - Williamsburg P&P 2025-05-29

30 Items: CityCityKentPurgeLegalWorksLetterBridgeCurfewHealthRightsReleaseCaseloadBehaviorLifeScanMedicaidPoquosonRecoveryRestraintConditionsIdentifierMedicationObligationSuperviseeRestitutionRestorationShadowtrackSupervisionNotificationWilliamsburg

Change Word Search 2025-12-30

36 Items: joyloveflowboldpowerspacegracefocusshareshinechangefamilyrhythmlaunchhealthevolvelistenthrivepresentpurposeempathybalancestrengthcreationorganizeautonomysimplifyalignmentintentiongratitudeabundancecommunityconnectioncompassionenvironmentrelationships

ERROR-PREVENTION 2026-03-03

7 Items: ARCCHANDOFFAND RESOLVECOMMUNICATIONWHY AND COMPLYQUALIFY VALIDATE VERIFYSTOP THINK ACT AND REVIEW

Beauty 2023-10-25

50 Items: spagellooksstylenailscurlscreammouseblushbrushbeautymakeupfacialpampervanitylotionprimerpowderpolishfashionglamourclothesperfumehaircutmassagejewelrystylistmascarashampoocologneretinolskincarecosmeticflatirongroomingwellnessbathbombhaircarelipstickeyelinereyecreamvitaminslipglosshairstylehairdryereyeshadowconcealerhairsprayfoundationconditioner

Nutrition 2026-03-26

50 Items: FatFuelBodyMindCareMealIronTrustSnackLunchFiberEnergyGrowthHungerDinnerCopingSkillsNourishBalanceHealingVarietySupportRestoreProteinVitaminMineralCalciumRoutineCourageFreedomRecoveryStrengthFullnessWellnessProgressAppetiteFearFoodExposureBreakfastHydrationDigestionChallengeMetabolismConfidenceResilienceFlexibilityConsistencyCarbohydrateSatisfaction...

The Olympian Games 2025-10-15

10 Items: What is the BOA?Further games took place here.When was the Olympian Society established?Where did the NOA's first Games take place?Who created the Much Wenlock Olympian Games?A Christian commitment to health and manliness.When was the Much Wenlock Olympian Games founded?The school that Coubertin was inspired by in England....

Spanish Vocabulary 2023-04-19

20 Items: catdogauntcamerafathermotherbrothercousinshusbandparentschildrendaughterdecorationsgrandfathergrandmothergrandparentscousin (male)aunts and unclecousin (female)brothers and sisters

The Crucible Vocabulary Review 2025-02-27

37 Items: bitliefbasinladlefactoagapegauntpoppetseededchristgibbetjoshuacleavelecheryprobitygullingandoveradamanthysteriaand abeldesolateclemencydenounceaffidavitcallouslybewitchedrepreievepenitencerescindedmagistrateand tobiaseffronteryproceedingsremorselessdisputationcondemnationconciliatory

Renaissance Word Search 2024-10-09

15 Items: Point of viewWrote the 95 thesesMajor branch of Protestantismrevival of art and literatureItalian painter and architectA republic in Southern EuropeKing of England from 1509 to 1547A fixed idea on a person or thingItalian artist, scientist, and inventorFrench theologian, pastor, and reformerItalian sculptor, painter, and architect...

The Secret of Kells 2025-09-26

18 Items: Writing tool made from a featherFierce raiders who destroy villagesA handwritten book decorated with artTreasure preserved in the Book of KellsPagan god of darkness defeated by BrendanIrish monastery famous for its manuscriptPrecious metal that makes the pages shineBlend of Christian faith and Celtic legendTheme showing belief in light and learning...

Word Search! 2024-08-13

50 Items: carhatgolfreeftaxisanddocklakeroambeachkayakoceanplanegrilldivingtravelbrunchguestsresortdinnerfoodiecoolerrentaleatingshrimpleisureholidayexploreairportluggageswimmingwellnessfestivalsuitcasetravelervisitingmemoriesoverseasseashellstarfishswimsuitflounderpassportwhirlpooladventuresunglassesexplorationsightseeingdestinationentertainment

Take a mental health break! 2022-08-23

15 Items: graftresinbridgeenameldenturesealantimpactedmandibleocclusalalignmentcompositetreatmentextractionodontogenicperiodontics

SCHOOL 2022-10-23

39 Items: gottWORKknoxzayetreythirdfifthlexiaWORDSstoneschoolmartinmurrayraptorfourthDREAMSpiercehaywardpencilsenglishwritingsciencehistorytomlisonhomeworkphysicaldivisionadditionsandstoneIN SCHOOLcomputerseducationelementaryAND DONUTSvocabularyAND MUFFINSsubtractionkindergartenmultiplication

Find & Focus: Word Search Adventure 2024-11-29

30 Items: CarsFishPetsBirdsSpaceworldherbsFruitsSportscitiesanimalsFlowersSeasonsInsectsHolidaysof treesproductsutensilsFurnitureJewelleryMushroomsphenomenaVegetablesof cheesescharactersinstrumentsand planetsof the pastof transportand fortresses

Authors Word Search 2025-03-18

34 Items: IdeaFactOrderCluesCauseValidIndexPrintInformEffectPurposeSummaryOpinionof ViewSynonymAntonymOpinionCaptionHeadingDiagramItalicsEvidencePersuadeFeaturesGlossaryInferenceEntertainSummarizeParaphraseSubheadingDescriptionof Contentsand Contrastand Solution

Whole Word Search 2026-01-29

11 Items: – Feelings of failure or low self-esteem.– Sense of pride gained from mastering skills.Thinking – Logical thought based on real situations.Intake – Nutrient essential for bone and tooth development.– Adequate water intake to support energy and concentration.Protein – Foods that support muscle growth and tissue repair....

Health Careers Offered Through West Kentucky Community and Technical College 2014-06-06

14 Items: diagnosticmedicalcoderphlebotomistdentalassistantdentalhygienistregisterednursemedicalsecretarynursingassistantmedicalsonographerpharmacytechniciansurgicaltechnologistradiologictechnologistlicensedpracticalnursephysicaltherapyassistant

Topic 1 - Introduction to Geography 2025-10-07

10 Items: County that Telford is located inRegion that Telford is located in______ jobs provide services e.g. teacher______ jobs collect raw materials e.g. farmerMade up of 3 nations: England, Wales and ScotlandStudy of the Earth's surface, environments and people_______ geography is the study of people and manmade features...

Unit 3 Review 2023-01-29

16 Items: of low quality, or not acceptableenjoyable, pleasant, or interesting:the liquid that comes from fruit or vegetablesthe flesh of an animal when it is used for fooda drink made with the juice of lemons, water, and sugara sweet food made with a mixture of flour, eggs, fat, and sugar...

Unit 1 Key Terms 2025-05-30

22 Items: A person who designs any of a variety of things.An idea that produces a similar idea or an enhanced idea.A limit to a design process. ; A limitation or restriction.The ability to make or bring a new concept or idea into existenceA person using the services of a professional person or organization....

HUMAN BODY SYSTEM 2025-12-02

38 Items: Tissues that enable movement.Another word for a nerve cell.Organs where blood gets oxygen.A muscular sac that stores urine.The strong muscle that pumps blood.The watery fluid part of the blood.The red fluid pumped throughout the body.The windpipe that carries air to the lungs.The main control center of the nervous system....

Christmas 2025-11-30

7 Items: globestoppersWreathsStockingsand baublesNutcrackersand garlands

unit 6 A 2025-04-24

10 Items: 죽다건강심장규칙돌보다동물원기억하다먹이를 주다

Chapter 1 - The First Americans - myWorld Social Studies 2023-01-26

14 Items: to movethe system of growing crops for foodto change in order to live in a new placea group or family member who lived in the pasta large animal that once roamed the Great Plainssomeone who hunts animals and collects wild plants for fooda person who travels from place to place in order to survive...

Health Benefits of Physical Activity 2024-06-20

15 Items: aerobicagilitywarm-upstrengthintervalanaerobicendurancecool-downhydrationintensitymetabolismresistanceflexibilitycoordinationcardiovascular

Giraffe Word Search 2023-05-19

7 Items: an animal who is fat, gray and small.an animal who have big neck and is yellow.an animal fast, yellow or orange and violent.an animal who is Black and white, and have strips.an animal who is small, Black and walk underground.an animal who have a trank, if fat and live in forest.an animal who belongs to the tiger family and has a very loud roar.

Hardware Unit Vocabulary 2025-12-11

19 Items: The "U" in "USB"A type of storage that keeps data without powerTransmits data at high speeds via light signalsCable that connects storage devices to the motherboardStores and manages files for other devices on a networkA piece of software that may need to be installed for a peripheral to work....

Mental and Emotional Well-being 2025-04-14

10 Items: MOTIVATION : The internal drive to take action or achieve a goal.SELFESTEEM : Confidence and belief in one’s own worth or abilities.GRATITUDE : The feeling or expression of thankfulness and appreciation.INTROSPECT : To look inward and examine one's own thoughts and feelings....

French Hierarchy Word Search 2025-03-27

10 Items: a form of government with a monarch at the heada division of a society based on social and economic statusthis war ended with Catholicism being the national religionprotected civilization from harm by raising a military servicehighest class, highly respected, cared for souls, and oversaw and ran religious events...

Democracy & Mexico's Government 2024-10-01

9 Items: govlasts six yearsdebates and makes lawsare composed of judgesit's composed of deputies and senatorsapplies and makes sure laws are followedform of government that depends on the will of the peopleone _________ is to preserve and promote the dignity of the individualMexico's government _________ are the Presidency, the Congress, and the Courts

Dns Word Search 2025-06-20

15 Items: Converts web addresses to IPsProject management methodologiesOverall experience and usabilitySystem to track changes (e.g., Git)Designing for mobile before desktopCode that is free and shared publiclyImprove code without changing behaviorService that stores your website onlineVisual elements the user interacts with...

Critical Words! 2023-01-07

21 Items: A missionBold and hardypopular DnD showWhere it all beginsScholarly magic userGoing on an adventure!Master of martial artsPriest of the old faithSurvive by avoiding noticeSpellcaster with inherent magicHoly warrior bound by sacred oathMagical people of otherworldly graceInspiring magician with musical powerWielder of magic derived from a bargain...

WORD SEARCH UNITS 1 & 2 2026-02-10

24 Items: happyworriedin good shapenot decoratedwilling to helpbroken or harmedtelling the truthnew completely newnot ordinary or usualhelping you do thingsrelaxed and not worriedexisting in large numberscaring only about yourselfold and not useful anymorequiet and doesn't laugh a lotable to be trusted or believednot helpful; doesn't work well...

Ecology: Word Search 2025-10-03

41 Items: Eat plants.Eat other animals.Consume dead animals.Single living entitiesBoth organisms benefit.Living parts of an ecosystemEat both plants and animals.The variety of life in an area.Nonliving aspects of an ecosystemThe number of species in an area.Neither organism affects the other.Consume dead organic matter (detritus)....

w WORDS 2023-11-18

50 Items: winwildwisewellwarmwagewavewayswillwishwinkwheewhizwhoawilywinewhimwittywaivewatchwaterwholewhoopworthywantedwinnerwanderwhollyworldlywealthywelcomewaggingwakefulwarriorwarrantweddingwelfarewhipperwhisperwhittlewhopperwillingwillowywellnesswindfallwhimsicalwholesomewonderfulworthwhilewallflower

Welding Word Search 2025-06-09

50 Items: DNAHEXNHXNLXOILHAASIMTSRAILANGLEBLUCOBOOTSCOBOTOKUMAUFORMBAMBOOCLAMPSPCBOLTTOGGLEWRENCHZOMBIEBUSHINGCONSOLECULTUREFABTECHGERMANYMODULARWELDINGACCURACYASSEMBLYBENEFITSBLUPRINTDEMMELERHARDENEDWELLNESSDODGEBALLFIXTURINGHAPPYHOURMACHININGPRECISIONPROTOTYPEREFERRALSTOLERANCEINNOVATIONINSPECTIONENGINEERINGFABRICATIONMANIPULATORWORKSTATIONMAKEITBETTER...

MR.RENNER'S WORD SEARCH 2025-12-01

50 Items: DRCBusAEDMarcGRITRulesRennaSafetyEquityCoffeeGrowthLockerWalkieRespectSupportDigitalGodboutEmpathyHallwayCaffeineSecurityPositiveWellnessTeamworkHomeroomAdvisoryIntegrityMr.RennerAwarenessBelongingCommunityClassroomCafeteriaDismissalProceduresLeadershipTransitionHeadphonesConsistencyDailySplashRestorativeExpectationsConsequencesPreparedness...

Safety Word Search 2026-03-09

50 Items: CareHopeTrustSafetyListenFamilyRespectSupportProtectCourageEmpathyHealingNurtureKindnessStrengthGuidanceAdvocacyWellnessPatienceSecuritySafeHomeAwarenessBelongingPreventionProtectionCompassionConfidenceFriendshipSafeSpacesLovingCareChildSafetyCaringAdultsUnderstandingEncouragementSafeChildhoodFamilySupportSafeCommunityResponsibilityStrongFamilies...

Chapter 7 Econ 2025-03-13

19 Items: Market structure characterized by a single producerGroup of firms producing similar or identical productsIllegal agreement by firms to charge a uniform price for a productPhilosphy that government should not interfere with business activityReal or imagined differences between competing products in the same industry...

Culture Word Search 2026-03-18

10 Items: - songs and sounds people enjoy- moving the body to music for fun- to enjoy a special time together- stories about people from the past- people living and helping together- pictures, crafts, and creative work- words people use to talk to each other- the way people live, eat, and celebrate- people who love and care for each other...

Friend Word Search 2026-02-06

10 Items: - to give or use things together- being nice and caring to others- doing something good for someone- a happy face shared with friends- showing love and concern for others- paying attention when a friend talks- someone you like, trust, and play with- having fun together with games or toys- being with friends and helping each other...

James 4 2023-09-04

16 Items: doisittoandhimwhonotonesinthedoesknowsrightthingtherefore

Hund Word Search 2025-04-22

16 Items: musandhundkattkaninrotteilderslangehamstermarsvinkyllinggullfiskpapegøyeparakittkanarifuglfugleedderkopp

From Word Search 2025-08-08

18 Items: iofofmytothetheandfromthismouthforgehornsfocusritualaugmentempowerstrength

From Word Search 2025-08-08

18 Items: iofofmytothetheandfromthismouthforgehornsfocusritualaugmentempowerstrength

From Word Search 2025-08-08

18 Items: iofofmytothetheandfromthismouthforgehornsfocusritualaugmentempowerstrength

Sight Words 2025-10-29

16 Items: itweishemymewasandthecansheseedidhadwhathave

Memory Verse Search 2025-12-29

18 Items: meinmemyandforyouaregodyourfivefiveGuidetruthteachsaviorPsalmstwenty