health and wellness Word Searches

Unit 5 Review Word Search 2023-12-07

15 Items: Admitted California as a free state.United States destiny to expand from Coast to Coast.War that resulted in the United States gaining Texas.The election when Republican Abraham Lincoln was elected.A war fought between the North and the South about slavery.Admitted Missouri as a slave state and Maine as a free state....

Idiomatic Phrases: Emotions 2026-02-11

15 Items: She decided to stop worrying about the argument and move on.He’s been unusually quiet and low since the bad news arrived.He completely lost control when he heard the unfair accusation.After weeks of stress, she felt completely drained and exhausted.He felt tense and jumpy all day, expecting something bad to happen....

Health Food x Junk Food 2025-08-08

16 Items: milkricesodacakeapplebeanswaterpizzacandycarrotorangetomatohotdogchocolatehamburgerfrenchfries

Day 2 Organizational Behaviour End-of-Class Review 2024-08-26

32 Items: According to psychology, this can be _____.People will behave _____ with how they are perceived.This is a popular personality type test or framework.Errors in attribution are also called distortions or _____.Perception affects _____ made by the individual, and the group.This is based on perception of what reality is, not reality itself....

Word Search (ver 1) 2024-12-27

28 Items: Steak, ribs, bacon, chicken, ham..A fruit that monkey and apes like to eat.Similar to dairy milk, but made of soybean.A long green vegetable, made mostly of water.An animal with a long bushy tail and narrow face.Some eat this with cookies, it contains lots of calcium.An insect with a pair of colorful wings. They feed on nectar....

AP Gov Word Search 2025-12-05

25 Items: The legal right of an individual or entity to bring a lawsuit in court.The party who initiates a lawsuit by filing a complaint against another party, known as the defendant.The process of manipulating the boundaries of electoral districts to favor one political party over another....

Get Well Soon, Hamdan! / قيامك بالسلامة يا حمدان! 💬 Message: Wishing you a speedy recovery — stay strong and keep smiling! الله يشافيك ويعافيك — خلك قوي وابتسم دايم! 2025-10-25

12 Items: – ضغط– قوة– صحة– تمدد– عضلة– مدرب– شفاء– سكوات– لياقة– الدمبل– النادي– الأثقال

Passionate Care Management Core Values 2023-07-14

9 Items: Showing enthusiasm and energy in everything that we do.Being open and honest so everyone knows what you are accomplishing.Sharing ideas and creativity with the team. All ideas are important!The golden rule. Always being mindful to _____ PCM team members, clients, and patients....

What is a mineral? 2024-04-28

9 Items: A paste-like material made from minerals, used for coating walls and ceilings.makeup: The specific combination of elements and compounds that constitute a mineral.A powdery substance made from minerals, used in construction to bind materials together.A mineral used in ceramics, known for its distinct chemical composition and crystal structure....

Threats 2025-11-18

20 Items: monitoring Ongoing tracking of threats or behaviorspolicy Defines rules and acceptable use expectationsthreat Risk from trusted individuals misusing access.execution Delivering and managing awareness activitieshandbook Summarizes key security policies and guidancebehavior Mistakes that accidentally create security risk...

Rascacielos Word Search 2025-10-06

30 Items: To doPuzzledCar beecar bombwild catMidfieldMudguardCemeterypacemakerUmbrellasSpiderwebDeaf muteskyscrapersalvavidasCorkscrewsTo imitatechiaroscuroEnvironmentBittersweetUp and downarmored bodyhigh and lowBottle openersblack and whiteSpanish speakerPencil sharpenersperson who carries and brings gossipA condition where a person’s foot has no arch...

Unit 1 2026-03-31

19 Items: A person who writes poems.A section or part of a book.An article or entry published online.A person who writes lyrics for songs.A person who writes content for a blog.Stories intended to scare or create fear.Books based on real facts and information.To make a book or text available to the public.To review and correct a text before publishing....

TERMS TO KNOW WHEN BUYING A HORSE 2024-01-18

11 Items: Horse is not yet trained to be ridden.Injury that affects the horse’s movement or health.Horse runs off suddenly and will not respond to aids.Standard measurement unit of height (1 hand = 4 inches).No injuries that prevent the horse from regular performance.Horse equipment used to ride, drive, or care for your animal....

INTERNET 2025-09-03

10 Items: Digital platforms that allow the creation, exchange, and collaboration of content among users, making the dialogue interactive.Refers to being connected to the Internet or a digital network, allowing access and real-time interaction with information, services, or people....

Wedding Word Search 2025-04-26

15 Items: AbbyChrisRingsWeddingBestmanFlowersBridesmaid- Tabby Cats Name- Black Cats Name- Black Labrador's Name- Where Abby and Chris live- A game Chris likes to play- Something Abby likes to do- A band Abby and Chris went to see live- The month Abby and Chris started dating

Culture Word Search 2026-03-02

15 Items: Willingness to delay rewards, linked to greater commitment to education.Lower educational performance compared with other groups or expectations.The idea that some groups lack cultural resources needed for school success.A movement for gender equality that raised girls’ aspirations and achievement....

Word Search 2024-12-27

28 Items: Steak, ribs, bacon, chicken, ham..A fruit that monkey and apes like to eat.Similar to dairy milk, but made of soybean.A long green vegetable, made mostly of water.An animal with a long bushy tail and narrow face.Some eat this with cookies, it contains lots of calcium.An insect with a pair of colorful wings. They feed on nectar....

New Deal Programs 2023-08-14

15 Items: Civilian _____ Corps: Provided employment to young men in conservation and natural resource projects.Banking Act of 1933 (_____ Act): Separated commercial and investment banking to prevent risky speculation.Rural _____ Administration: Provided loans to rural cooperatives to bring electricity to underserved areas....

Cards Word Search 2023-11-13

15 Items: _____ at places like food banks or shelters to help others.Make cookies or treats and give them to your neighbors or _____.Spend time with _____ people who might be alone during the holidays.Go for a walk outside and think about all the amazing things in _____.Write About _____: Write an essay or poem about what you're thankful for....

jewish history 2023-09-04

10 Items: In 586 BCE, the Babylonians captured Jerusalem and destroyed the _____ _____, leading to the Babylonian Exile.In the 1st century CE, the _____ _____ conquered Judea and, in 70 CE, destroyed the Second Temple during the First Jewish-Roman War....

Everyday Synonyms and Antonyms 2025-04-14

10 Items: : SOFT : Gentle and not hard.: BRAVE : Synonym for courageous.: QUICK : Synonym of fast and rapid.: GENTLE : Synonym of soft and mild.: NEAT : Synonym of tidy or organized.: JOYFUL : Synonym of happy and delighted.: FAST : Another word for quick or speedy.: TIDY : Another word for neat and orderly.: HAPPY : Another word for feeling cheerful....

40 Years of Savoy 2024-04-30

28 Items: OliverIolantheOklahomaRuddigoreThe MikadoSister ActHMS PinaforePrincess IdaMy Fair LadyHigh SocietyTrial By JuryThe SavoyardsAnything GoesCrazy For YouCalamity JaneSouth PacificThe GondoliersMe and My girlGuys and DollsThe King and ILegally BlondeThe Merry WidowThe Wizard of OzSunshine on LeithFiddler on the RoofBeauty and the Beast...

Unit 1 2026-03-31

19 Items: A person who writes poems.A section or part of a book.An article or entry published online.A person who writes lyrics for songs.A person who writes content for a blog.Stories intended to scare or create fear.Books based on real facts and information.To make a book or text available to the public.To review and correct a text before publishing....

Unit 1 2026-03-31

19 Items: A person who writes poems.A section or part of a book.An article or entry published online.A person who writes lyrics for songs.A person who writes content for a blog.Stories intended to scare or create fear.Books based on real facts and information.To make a book or text available to the public.To review and correct a text before publishing....

Animal Farm Lesson 1 Vocabulary 2026-01-04

14 Items: The main political party in charge of China. ​A deliberate and brutal slaughter of many people​Disagreeing with the government's views or decisions.​about individual freedom and limiting state power to ensure itA public expression of objection, disapproval, or dissent against something...

rooms of the house 2023-11-06

20 Items: roomyes/i/am.no,/i'm/not.where/are/you?mom/and/dad/arein/the/kitchen.it's/the/bedroomwhere/is/sister?where/is/brother?where/is/grandpa?grandpa/is/in/theit/has/bed/pillow/and/blanket/insidei'm/in/the/classroomi'm/in/the/classroomit's/the/room/we/sleepwhere/are/mom/and/dad?sister/is/in/thebedroomare/you/in/the/bathroom?brother/is/in/the/bathroom.

S 2024-04-09

19 Items: (mystery)(peculiar)(watchful)(captivating)(proper manners)(group of stars)(sad and pensive)(theatrical dance)(science of sound)(calm and peaceful)(related to horses)(related to cooking)(sentimental longing)(art of good cooking)(lively and energetic)(complex musical piece)(ability to bounce back)(study of celestial bodies)...

One Little Word 2025 2024-12-30

50 Items: gonexthealhopeopenlivelovealivefocusbravelightlightbeginrenewalignthrivecreatechangeenoughworthyinvestchoosegrowthevolvejourneynurtureforwardembracebelieveclaritycherishbreathesparkleprogressdiscoverreinventstrengthkindnesswellnessmovementwellnessadventureintentionstillnessgratitudecultivateconfidencerevitalizeconnectionperspective

Macro Chapter 21 Vocab 2024-10-29

17 Items: exports minus imports (X-M)a period during which real GDP decreasesgoods and services purchased from other countrieswhen governments buy goods and services from firmsThe purchase of new capital goods (tools, instrumentsTaxes paid minus cash benefits received from governmentsThe expenditure by households on consumption goods and services...

Reagan R 2024-05-16

15 Items: Energy that is storedThe total distance movedThe ability to cause changeHas a definite shape and volumeelectrons in the outermost shell.The process of changing directionHas an indefinite shape and volumeExplains how particles in matter behaveAnything that has mass and takes up spaceHas a indefinite shape and definite volume...

Laboratory Word Search 2018-08-27

35 Items: STATHOODHANDMEANBLOODPIPETBEAKERNEEDLENEEDLETISSUESAFETYGLOVESHYGENEHEALTHENZYMEREAGENTCOURIERSYRINGESCIENCEQUALITYDISEASEALIQUOTANTIGENGLUCOSEPROTEINANTIBODYMUTATIONCHEMISTRYINCUBATORINFLUENZACENTRIFUGELABORATORYMICROSCOPEPHLEBOTOMYMICOBIOLOGY

Chapter 4 : Life at school (Word Search 1) 2021-04-22

34 Items: artgoodlikelovehateDutchbreakFrenchhealthMondayFridayrecessEnglishhistorysciencephysicsbiologyTuesdaylessonsmorningphysicalThursdaygeographychemistryeducationreligiousWednesdayafternooninterestedtechnologyaestheticsmathematicsmethodologycommunication

Biodiversity 2024-10-23

34 Items: lifefaunagenushealthchangeoceansnatureinsectmarinehabitatspeciesclimategeologylichenswildlifeorganismwetlandsmutationecosystemdiversitybiospherefisheriesevolutiondepletionecosystemsrainforestextinctionbiologicalvegetationurbanizationenvironmentaldeforestationsustainabilityoverexploitation

Integrity Word Search 2024-08-20

34 Items: ArtGymMathBandLunchMusicAdamsSalonWaiteRecessSkillsGiustiCurtisDenaliChorusCivicsHealthScienceOConnorTauroneCougarsLockersAlgebraOrchestraBackpacksAssembliesFieldTripsConnectionAgendaBooksEighthGradeEngineeringWashingtonDCLanguageArtsDigitalLiteracy

Federal Budget and Spending 2025-11-17

35 Items: NASALaborStateUrbanBudgetEnergyHealthSocialBillionDefenseHousingJusticeServiceCommerceHomelandInterestInteriorMedicaidMedicareSecuritySecurityTreasuryTrillionVeteransCommunityEducationEngineersDepartmentGovernmentAgricultureDevelopmentEnvironmentDiscretionaryInternationalTransportation

Lymph Word Search 2025-12-15

30 Items: dermpylorootPeritermlymphfluidSouthlipomasuffixprefixmegalyDallasXerisisSplenicpathwaysciencevitiligobaseballepidermisTrichosismelanocyteSclerodermaLiposuctionenlargementcombiningformimmunotherapyadenocarcinomaLymphadenopathyimmunodeficiency

13* THE INDEPENDENT LIFE 2026-02-02

11 Items: --> JOY--> ALIVE--> VIGOR-->EXCITED--> STRONG--> BRIGHT--> HEALTH--> SPIRIT--> ACTION--> VIBRANT--> EXCITEMENT

Word Search 2024-12-27

28 Items: Steak, ribs, bacon, chicken, ham..A fruit that monkey and apes like to eat.Similar to dairy milk, but made of soybean.A long green vegetable, made mostly of water.An animal with a long bushy tail and narrow face.Some eat this with cookies, it contains lots of calcium.An insect with a pair of colorful wings. They feed on nectar....

Printed Word Search 2024-11-07

6 Items: SourcesMaterialsand Industry Regulationsand Educational MaterialsStudies and Academic SourcesNetworks and Professional Consultation

BIO235 2024-11-09

20 Items: - detect pain- Farsightedness- Nearsightedness- respond to light- detect organ pain- measures eye pressure- detect touch and sound- detect smell and taste- controls the pupil size- detect temperature changes- examines eye drainage anglechart - measures visual acuity- the membrane covering the eye- blood vessel layer in the eye...

Unit 1 2026-03-31

19 Items: A person who writes poems.A section or part of a book.An article or entry published online.A person who writes lyrics for songs.A person who writes content for a blog.Stories intended to scare or create fear.Books based on real facts and information.To make a book or text available to the public.To review and correct a text before publishing....

asdf 2025-11-14

12 Items: (adj.): causing damage, harmful.(adj.): cheerful and full of life.(adj.): ina dying or death like state.(adj.): able to be broken down naturally.(verb): to preserve in the memory forever.(adj.): harmful to physical or moral health.(verb) to cause the extreme embarrassment to.(noun): the act or process of bring back to life....

Chapter 6 2022-09-27

6 Items: safetyliteracyand securityand identitycyberbullyingand attribution

Laws & Codes in Texas 2025-11-03

8 Items: body of laws which govern trafficgreatest possible punishment for the crime committedset of laws which are related to the punishment of crimes and offensesbody of laws which protects health, safety and welfare of the general publicserious crimes such as murder, kidnapping, robbery punishable by a year or longer in state prison...

Supplements and Aids 2024-11-15

20 Items: BCAA, activates muscle protein synthesisclass of drugs that increases CNS activityfound in fat burning supplements and preworkoutsstimulant that reduces fatigue and pain while exercisingderived from leucine, promotes muscle growth (abbreviation)plant that reduces inflammation and aids muscle regeneration...

Histology Word Search 2025-10-02

22 Items: inflammation of a glandproduces hormones; no ductsSurgical removal of a glandmicroscopic study of tissuesAbnormal hardening of a glandAny disease or condition of a glandSecretes chemical substances into ductsincrease in bulk of body part/organ due toMalignant tumor originating in glandular tissuecontains cells specialized to contract and relax...

AP LANG VOCAB 2025-09-17

27 Items: – severely critical– intervene with something– a security guard or watcher– being everywhere all of the time– something causing misery or death– to provoke or incite somebody into action– of, characteristic of, or resembling a lion– marked by doubt, uncertainty, or skepticism– to indicate something by action or implication...

Road to American Revolution and Revolutionary War Review 2022-11-28

25 Items: Shot heard round the world.The author of Common Sense.A 1767 law that taxed glass, paper, and tea.The author of the Declaration of Independence.The commander in chief of the Continental Army.Colonial activists dumped tea into Boston Harbor.This battle was the last major battle of the Rev. War.The only colony not at the First Continental Congress....

Ceramics Word Search 2025-03-11

24 Items: Stage when clay is moist and workableProperty that allows clay to absorb waterSheet of clay rolled out using a rolling pinClay pieces that serve a function; have a useProperty that allows clay to be shaped and moldedClay pieces that have been fired in the kiln onceMachine that uses high heat to vitrify clay pieces...

Pharmacy Crossword Puzzle: 'Discover Pharmacy!' 2025-08-04

8 Items: Opposite of diseasePlace where pharmacists workA liquid medicine taken by mouthA common Pain-relieving medicineWhere you go to get a prescriptionMedicine in solid form, often roundA doctor writes this for your medicineA person who prepares and dispenses medicine

Word search 4 2023-10-17

11 Items: timetaskschangelessonhealthlessonsuniformteacherslearnerstuckshopprincipal

OdettesBudgetingLife 2024-12-19

35 Items: DebtEtsyGiftsPOBoxFamilyHealthNewCarTravelMedicalSavingsClothingFunMoneyHolidaysRoadTripSelfCareSuppliesVacationBirthdaysEducationFurnitureStarNotesAnnualFeesElectronicsLowPriorityCarInsuranceHighPriorityStudentLoansEmergencyFundMiscellaneousOneMonthAheadSubscriptionsCarMaintenanceContentSupportMovingExpensesVariableExpenses

Executive Branch Puzzle 2025 2025-02-07

35 Items: RunLawsFairCivilChiefPrimeMoneyPartySpentRulesHouseThreePublicBranchDutiesActionSenateChargeHealthCabinetCountryServantsMinistryMinisterSecurityDecisionAssemblyExecutivePortfolioPermanentPoliticalSecretaryEducationParliamentGovernment

Dauphin Way Lodge Recovery 2025-07-15

35 Items: HelpHopeLoveCleanFaithGoalsPeersShareSoberFamilyFutureGrowthHealthRescueStrongBalanceCourageFriendsJournalPathwaySupportTherapyBlessingMaturityPositiveSurvivalAwarenessCommunityGratitudeAcceptanceConfidenceAffirmationCelebrationInspirationEncouragement

Bridge Program Workshop 10 2025-07-24

35 Items: ClubCookLoanGroupHobbyTutorLearnMentorAbroadHealthDentalCareerGraderBusserOfficeCourseFacultyCashierBaristaStudentProgramActivityAdvocacyResearchVolunteerInsuranceAssistantAdmissionConnectionExperienceRecreationDishwasherAssociationRequirementAccessibility

A&O 2025-09-05

30 Items: HRISFITSAPMGMTOSCMBCMUMKTGCBDCZoomBABAENTREOPMGTACCTGFINANCminorsmajorsBIZEVALBookingshandshakedegreeplanCareerCoachBuerkCenterinternshipsstudyabroadtranscriptsFosterFridayCaseCompetitionsAcademicCalendarFoster's Mental Health Counselor's netid

EA and A 2025-10-21

35 Items: deaddeafheadleadquadswanswapwandwantwashbreaddealtdeathdreadheavyleaptreadysquadsquatswampwatchwaterbreathhealthspreadsteadyfathersquashwaddlewafflewallowwanderfeatherswallowbreakfast

Everyday Synonyms and Antonyms 2025-04-14

10 Items: SOFT : Gentle and not hard.BRAVE : Synonym for courageous.QUICK : Synonym of fast and rapid.GENTLE : Synonym of soft and mild.NEAT : Synonym of tidy or organized.JOYFUL : Synonym of happy and delighted.FAST : Another word for quick or speedy.TIDY : Another word for neat and orderly.HAPPY : Another word for feeling cheerful....

Employer-Of-Choice 2023-03-13

16 Items: teampridepassionintegritydiversitysuccessionmission-26sustainabilityperform-&-growresponsibilityemployer-of-choicehigh-trust-culturephycological-safetychallenge-status-quoorganizational-healthevery-employee-is-special

Unit 4 Vocab Word Search 2026-03-12

17 Items: VerticalAny device intended to be used for air travelThe main body of an aircraft that is designed to hold cargo, crew, and passengers.Enclosed area at the front of an aircraft where the pilot and flight crew operate the vehicle.A material made by melting and mixing two or more elements together, where at least one is a metal...

Energy & Matter in an Ecosystem Challenge Word Search 2025-01-11

32 Items: living thingthe ability to do workrefers to land environmentsrefers to water environmentsprotection of natural resourcesprotist that makes its own foodanything that has mass and volumematter from a once living organisma consumer that consumes plants onlywaste products from living organismstwo or more elements that are bonded...

Health Unit 1 2024-02-07

8 Items: empathypassivehealthyassertivedecisionsaggressivecommunicationrelationships

Diabetes & Oral Health 2024-11-11

8 Items: DiabetesToothLossXerostomiaOralHygieneMiracleFluidToothMobilityImmunoglobulinPoorGlucoseLevel

Health Word Search 2025-12-12

8 Items: wristinjurythroatbruisecoughingaccidenttoothachetemperature

Health Word Search 2026-02-25

8 Items: RUNEATWALKJUMPWATERSLEEPFRUITBRAIN

Caffeine Word Search 2024-11-25

20 Items: a severe allergic reactionproduced from the formation of beetsa stimulant found in coffee, tea, and cocoanutrients people take in addition to the food we eat.a type of vegetarian that eats plant sources and eggsa type of vegetarian that only eats food from plant sourcespopular diets that claim to offer a quick fix to health issues...

Get Well Soon, Hamdan! قيامك بالسلامة يا حمدان! 2025-10-25

12 Items: – ضغط– قوة– صحة– تمدد– عضلة– مدرب– شفاء– سكوات– لياقة– الدمبل– النادي– الأثقال

Mental Health Word Search, Liam 2024-02-21

15 Items: painpanicstresssocialanxietytherapysymptomsdepressiongoalsettingvolcanomodelsocialphobiapanicdisordergeneralanxietydisorderobsessivecompulsivedisorderposttraumaticstressdisorder

Ella Makuch period 5 health 2025-12-10

15 Items: dogsbeachsunnybooksfriendshoodiesreadingdrawingpaintinglacrosseacaibowlscurlyhairfrankoceanfieldhockeypaddleboarding

Dumb Phones" on the Rise 2024-11-17

11 Items: ZtimemediaphonesphoneshealthAnxietyMinimalismtechnologyDepression(Fear of Missing Out)

Reconstruction Test Review 2025-10-05

22 Items: Became president in the election of 1876The constitutional amendment that ended slaveryHe was the first African American to serve in the U.S. SenateCivil rights leader and journalist who exposed lynching in AmericaThe Supreme Court case that upheld “separate but equal” segregation...

T. L. E 2025-02-03

26 Items: These are flat heateduse to hold food in placeUsed to open canned foods.where food is directly cookedThe toaster is typically a smalluse to strain solid to liquid ingredients.Used to slice foods more evenly and uniformlyMachines used to chill sandwiches and other foods.A knife with a sharp edge that has saw-like notches or teeth....

British and Irish Dogs 2025-08-05

20 Items: Scent hound, used primarily to hunt hareA large, black and tan gundog from ScotlandPembroke and Cardigan are both types of what?What word goes in front of 'beagle' and 'blue'?Pepper and which other colour can Dandie Dinmont Terriers be?A terrier was associated with this city long before Noel and Liam...

Afro Word Search 2025-11-19

43 Items: Study of past eventsMovement to end slaveryTime that is yet to comeAfrican-Brazilian religionFamily descent and lineageFair treatment and behaviorAct of setting someone freeMusical bow used in capoeiraLegal and moral entitlementsProcess of receiving knowledgePolitical activist and academicLeader of Quilombo dos Palmares...

The One Pager and more 2025-05-06

11 Items: We trust our peopleThe best experienceRetention and engagementQuality and on time deliveryTopline growth and profitabilitySustainability and volunteer hoursThe app we go to for all our helpscreensAcronym for customer relationship managementThe name of the truck that brings us ice creamThe month that we celebrate a full week for CS...

Medical Marijuana Word Search 2024-12-02

7 Items: Another term for marijuanaA type of Schedule 1 controlled substanceThe action of working together for a common goalEnsuring patients are cared for, their needs are met and heardA set of principles and standards that nurses follow to provide optimal care...

Customer Engagement Hub Market: Trends, Growth Opportunities, and Regional Insights 2025-06-23

13 Items: playersdriversupdatesanalysissegmentationOpportunitiesthe rising trend of cloud-native engagement hubs and strategic partnerships among tech giants to deliver unified, data-driven customer interaction platforms globally....

Epidemiology- Word Search 2025-05-03

5 Items: study of serum.The study of how disease spreads and can be controlled.are often collected for the diagnosis of bacterial pneumonia.is a preferred method for manual cleansing in health care when hands are not dirty....

Game 2023-04-10

15 Items: The colour of chocolate.A small vehicle for travelling on water.The day before today. The letter starts with Y and ends with Y.An object for taking photos or making films or television programs.An object with a sharp blade used for cutting fruits, vegetables etc...It is a vegetable. The letter of the word starts with C and ends with T....

Word Scramble 2022-11-15

40 Items: the ability to carry out a taskthe cost of operating a businessa natural ability to do somethinga business owned by a singular persona mental position with a fact or statethe worth or value of a good or servicemoney recieved on a regular basis for workNike is an example of an _____ (business type)the percentage of the industry's total revenues...

Scrum Glossary 2023-07-21

34 Items: 10, See "Product Backlog __________"5-4, A self-managing team consisting of one Scrum Master, one Product Owner, and Developers.8, The selection of items from the Product Backlog Developers deems feasible for implementation in a Sprint....

Onboarding Word Search 2024-11-13

3 Items: The process of integrating new hires into an organization and its culture.The total monetary and non-monetary rewards given to employees for their work.Non-wage perks provided to employees, like health insurance, retirement plans, and leave.

Greek Mythology 2026-02-16

17 Items: God of wineMother EarthThe god of warGoddess of loveThe god of the seaGoddess of the huntThe King of the GodsThe goddess of wisdomGoddess of the hearthGoddess of agricultureThe goddess of rainbowsThe god of the UnderworldThe messenger of the godsGod of fire and blacksmithsThe god of healing and prophecyQueen of the Underworld, goddess of spring...

Medi-Cal 2014-10-31

33 Items: LowTARxrayLongTermCareCardPlansneedyMentalHealthCountyIncomeDoctorsMedicalBenefitsHospitalCoverageMedi-calSuppliesMaternityEmergencyPediatricScreeningEquipmentMedicallyProceduresLaboratoryCaliforniaEligibilityPrescriptionsCategoricallyRehabilitation

First Three Words For New Year's 2024 2023-12-27

34 Items: joylovehopeplangracepeacefocuswisdomhealthgrowthcreatecharityservicebalancerespectpatiencekindnesshumilitygoodnesssimplifyorganizelearningexercisecuriositycommitmentcompassiongentlenessdisciplineprioritizeforgivenessstewardshipfaithfulnessthankfulnessencouragement

Welcome to Integrity 2024-08-20

34 Items: GymArtMathBandWaiteLunchMusicNeagleCivicsRecessChorusSkillsHealthOConnorTessmerTauroneDohertyAlgebraScienceLockersTissuesIntegrityBackpacksOrchestraMontgomeryConnectionFieldTripsAssembliesEighthGradeAgendaBooksEngineeringLanguageArtsDigitalLiteracyComputerScience

Lifetime Sports 2025-04-07

30 Items: crewgolfropegolfartsyogadancetennishockeyhealthreliefskiinghikingwalkingcyclingstaminafrisbeearcherymarathonbaseballfootballswimmingstrengthwrestlingbadmintonpickleballbasketballvolleyballcheerleadingweightlifting

TBC 2025-11-30

34 Items: LGDLaraHugoBellKempHASSAdelePoppyHenryRickyJesseMasonLoganIrwinAleeahMarcusMaddieClarkeWatsonHealthJasmineCollierVanstanNanangoEnglishScienceRhiannonFranklinMcCarthyPatricksMcDonaldReligionTechnologyMathematics

HEART STOPPER LORE 2026-03-05

30 Items: BENNICKLGBTELLETORITARAALICENOVELPARISSARAHRUGBYLOVERSHEALTHBRIGHTSCHOOLLONDONSERIESCHARLIEFRIENDSGRAPHICTEENAGERDRAININGMEETS BOYHEARTFELTTEARJERKERDEPRESSIONCHALLENGESCOMPLICATEDRELATIONSHIPHEARTSTOPPERS

Teaching 2014-12-02

35 Items: artmathbandtrackdeskshealthchoruscivicsrecessshapesalgebraenglishsciencebiologynumbersspanishstudentssubjectsfootballbaseballprincipalcomputerssuspendedcafeteriaattendancetechnologyvolleyballnumberlinemediacenterspreadsheetinstrumentsfrontofficesocialstudiesphysicaleducationassistantprincipal

EHS Week 2022 Word Search 2022-08-19

36 Items: elonechowastelakinpartsmyehssalesteslaveoliaaustinsafetyhealthbatteryhotlineservicebatteryoneteamfremontcoolantaerosolsecurityforkliftshanghairoadsterelectricdeliverylogisticsworkplacerecyclingcybertruckinterstatesharepointtakechargeenvironmentpreparednesssustainability

What 2023 has in store for you... 2022-12-22

38 Items: loveloverestcalmfamemoneypeacequietcheerblisspeacegracehealthwealthtravelenergyfamilypraisesuccesspassioncouragesupportinsightlaughterapprovallaughteradventurefriendshiprelaxationpositivityconfidenceacceptancerecognitiontranquilityinspirationfulfillmentappreciationopportunities

WELCOME BACK CALCIUM! 2023-08-22

35 Items: artgymprekspedbocesmflacmusicgrowthhealthnursesrecesscalciumlibrarylearningsnowdaysstudentswarriorsadventurebidsheetscafeteriacustodialattendancefirstgradefriendshipthirdgradeindianriverourownstorysecondgradeamazingaidesconstructionkindergartennewyearnewyouadministrationbestofficestaffterrificteachers

It Takes A Village to Raise A Child 2024-09-18

35 Items: mythcarehomeyouthlocalclubswatchsafetyhealthgroupsSportsproverbAfricanvillagesecurityprogramschildrenCommunityeducationwellbeingresourcescontributerecreationupbringingactivitiesvolunteersenvironmentafterschoolperspectivesneighborhoodinstitutionssupportsystemmoralguidanceorganizationsextracurricular

CAPE 2025-08-05

36 Items: gasRobbJaneAnneLeahNolanurseMeganadbandoctorCanadatoxicsAnjaliSkylarKarinaKiemiaReykiaDakotaSkylarhealthjusticeclimateSabrinaTynetteNatalieLoujainsuccessactivistMichelleRhiannonPatriciacommitteeenvironmentfossilfuelssuperheroeshealthprofessional

Esmerelda Word Search 2025-10-23

36 Items: lizamysixtorimikedawnleahcaremindyeetyoloamiraericatessayouthadultunitspsychskirtsevenbrianajustinandrearachelmentalhealthvanessafrancisanaliciarashaynechildrenesmereldacontrabandchristopherpsychiatricmedications

Mr. Stanger's Last Day Word Search 2025-11-20

35 Items: DogsAuraCubsLamarMollySixthFifthSigmaMusicDarwinHealthEighthHipHopStephenStangerCharlieAbigailPontiacChicagoScienceHistoryEnglishSeventhTeacherStoriesGoodbyeKendrickSixSevenDietCokeChampaignThomasboroSubstitutePrideBucksMariosPizzaNameofMyFavoriteStudent

Documentation Word Search 2026-03-02

31 Items: ClearScopeFactsCourtRecordPolicyhealthquotesActionsOutcomeActionsContextNeutralbehaviorlanguageTimelineSpecificPatternsstandardsLiabilityObjectiveTimelinessStatementsCredibilityConsistencyInterventionCompletenessProfessionalNotificationsDocumentationCommunication

Chapter 6 ED310 2023-02-14

10 Items: Data software______ ProcessingAllows ______ on documentsAssess the _______advantage_____lesson results and impactEncourages writing across the_________________dynamics within collaborative writingShare lessons, _______, and outcomes with other peer teachersTeachers create documents for instructions and _________ tasks...

DOG 2025-01-31

17 Items: – The top of the neck.– The side of the face.– The digits on the paw.– The upper hind leg joint.– The joint on the front leg.– The rear end, above the tail.– The loose, hanging upper lip.– The dog's nose and mouth area.– The upper front leg attachment.– The area between ribs and hips.– The lower hind leg, above the paw....