fruit s basket Word Searches

FK White 25-26 2025-08-05

64 Items: Dennis-ESLHurley-ESLLopez-IBCAManuel-ESLSuiter-RTIGoudeau-ESLPenado-BandStoupy-BandWarnken-ArtGobert-SPEDForeman-SPEDCheramie-STEMMiles-7th ELABoss-LibrarianFruge-PE CoachTaylor-7th ELAZaazoui-FrenchComeaux-6th ELAHebert-7th MathTenali-8th MathEdwards-PE CoachC. Hayes-6th ELAHiggins-6th MathPerkins-7th MathRoss-8th ScienceSavoie-Combo ELA...

Unit 3: Electrons in Atoms 2023-09-26

20 Items: 3.00 x 10^8 m/sHeight of a waveparticles of lightthe arrangement of electrons in an atomElectrons on the outermost energy level of an atomthe clockwise or counterclockwise motion of an electronthe possible energies that electrons in an atom can havenumber of complete wavelengths that pass a point in a given time...

CHAPTER 3 2025-05-06

181 Items: THÌTHỜIMOODTHỨCTENSEVOICEASPECT-S-FORMDẠNG--SBIẾN-TỐTHÌ-ĐƠNDẠNG-GỐCHABITUALDẠNG/THỂOPERATORBASE-FORMPAST-FORMA-WORD-TOMORPHEMESOF-A-VERBMAIN-VERBSEXPRESSINGDO-HAVE-BEDẠNG-CƠ-SỞINFLECTIONMORPHOLOGYSHOW-TENSEVERB-PHRASECỤM-ĐỘNG-TỪPOTENTIALLYTRỢ-ĐỘNG-TỪPHÂN-TỪ--EDINCLUDE-HOWSHOWS-TENSEFOR-EXAMPLEIN-PROGRESSOF-THE-VERBTỪ-CHI-PHỐILEXICAL-VERB...

Review 2025-04-08

1 Item: welder, ashes, surface, chance, patch, badge, taxes, advice, manager, stretch, gardener, clutch, bricklayer, judge, faucet, luggage, recess, crutches, countries, take, took, taken, sing, sang, sung, come, came, come, ring, rang, rung, bad, worse, worst, s

Tuskegee airmen 2023-01-31

15 Items: bomberescortsDavis was promoted to _______ on May 29, 1944.Davis led his squadron on its first _______ mission on June 2, 1943.Davis' father became the U.S. Army's first African-American _______ in 1941.Davis became the _____ African-American pilot to solo in an Army Air Corps aircraft....

"Easter brings new beginnings! 2025-03-03

1 Item: Bunny, Chocolate, Egg hunt, Resurrection, Spring, Basket, Holiday, Sunday, Celebration, Cross, Church, Flowers, Tradition, Parade, Feast, Lamb, April, Candy, Blessing, Painted eggs, Sunrise, Ceremony, Joy, Renewal, Family, Peace, Jesus, Good Friday, Palm

Summer Word Search 2025-06-06

1 Item: SUNSHINE LEMONADE LEMON JUICE SWEET SOUR PICNIC YELLOW FRUIT FAMILY LOVE TRUST DADDY MOMMY SAMMY ELLYNN ANNA ADVENTURE FAITH FUTURE SMILES HAPPY FUN SNUGGLE HUGS KISSES MARSHMALLOW KIND BUNNY

Organiziranje procesa e-učenja 2025-10-06

30 Items: Kako se naziva proces provjere znanja polaznika?Kako se naziva procjena uspješnosti provedbe e-učenja?Kako se zove oblik stručnog osposobljavanja nastavnika?Kako se naziva digitalno spremište nastavnih materijala?Kako nazivamo zajednički rad polaznika u procesu učenja?Kako nazivamo postupak vrednovanja postignuća polaznika?...

Chapter 13 - Economic Challanges 2025-11-29

20 Items: Inflation that is out of control.Grant Federal funds given to the states in lump sums.Basket A representative collection of goods and services.Rate The percentage rate of change in price level over time.Income Income that does not increase even when prices go up.Unemployment that occurs when people take time to find a job....

Summer Word Search 2025-06-06

1 Item: SUNSHINE LEMONADE LEMON JUICE SWEET SOUR PICNIC YELLOW FRUIT FAMILY LOVE TRUST DADDY MOMMY SAMMY ELLYNN ANNA ADVENTURE FAITH FUTURE SMILES HAPPY FUN SNUGGLE HUGS KISSES MARSHMALLOW KIND BUNNY

Atomic Structure & Periodic Properties 2024-11-25

20 Items: The energy required to remove an electron from an atom.The distribution of electrons among the orbitals of an atom.The energy change that occurs when an atom gains an electron.The outermost electrons of an atom, involved in chemical bonding.Energy levels surrounding the nucleus where electrons are located....

RESEARCH WORD SEARCH 2026-03-06

25 Items: What is RTG-3000?What does NAH stand for?What is delivery type S?What piece do slats usually come with?Which distribution Center is # 79 in SE?What is not eligible for a Do Not Strip?where can you find a service tech phone #?Which distribution Center is # 99 in Texas?Where do you verify color options for an item?...

Adventures in the North-East 2026-05-18

30 Items: Where were we? (14)How did we get there? (8)How do you get to #3? (8)Another name for #3 (4,6)What did we buy at #4? (7)Distant relative of #21? (5)Only the ruins are left. (9)They're what made #3 famous. (7)Another way of referring to #9. (7)Which month was it when we went? (8)Maybe you should have booped it. (4)...

C making the /s/ sound 2025-11-22

1 Item: cell fancy space circle circus ice city lace circle race

olahraga 2023-03-15

20 Items: pedang anggarolahraga bola lonjongpemimpin pertandinganpukulan melambung pada bulu tangkislatihan lari dengan meningkatkan waktu yang lama.penggunaan obat untuk meningkatkan performa atletSeorang wasit disebuah pertandingan bola basket sering membawaSebuah pertandingan yang dilakukan dengan durasi waktu 2x45 menit...

Activities Word Search 2026-03-12

250 Items: ARTBEDBIBCUPMOPMOMMUGNAPZOOBABYBATHBIKECAKEEGGSFOODGLUEHATSHOMEHUGSKIDSMEALMESSMILKOVENPARKRESTSANDSOAPTIDYTOYSTRIPWALKYARDAPPLEAPRONBOOKSBROOMCLOCKCOATSDRYERFLOORFRUITJUICELUNCHMEALSPAINTPAPERPIZZAPOTTYSHOESSLEEPSNACKSOCKSSPILLSPOONSTAINSTORYSTOVESTUDYSWINGTABLETEDDYTRASHWATERWIPESBAKINGBANANABLOCKSBOTTLEBUCKETCARPETCEREALCHORESCLOSETCRAFTSDINNER...

Alcohol Laws 2026-04-03

12 Items: chemical breakdown by bacteria, yeast or other microorganismsbusiness which sells alcohol for consumption at a different locationbusiness which sells alcohol for consumption at the location of sale(ABV) measure of how much alcohol (ethanol) is in a given volume of a beverage...

Understanding Loss Drafts 2023-09-19

19 Items: A list of materials needed to complete the repairsThe company that provides the home protection policy.Estimate from the insurance company detailing the damagesThe entity that represents the homeowner in a court case.The amount the insured is responsible for in case of a lossThe actual cost to replace a structure at its pre-loss condition....

Common Assessment #1 Review 2025-10-15

14 Items: where the word comes fromSequence of events in a storyCategory or type of literatureof View Perspective from which the story is toldthe reader uses prior knowledge & observations to formulate an educated guessUsing clues in the sentence to figure out the meaning of a word you don’t know...

Apple Word Search 2025-10-30

250 Items: figeggpieoiltearumiceskyseacatdogcowpigratfoxbatantbeedaysunpenartrunflybuscarbedbagboxcuppearplumlimekiwidatecornpeasriceoatsmilkmeatfishporkbeeflambsaltcakesoupherbsodawinebeerfirewindrainsnowrocklaketreeleafrootseedbirdfishgoatwolfbearlionfrogwormsoulmoonstartimeyearweektalemythbookpagewordsongdrumbandstepmovewalkjumpfallswimdiverideroadpathbike...

Word Search 2026-02-10

25 Items: To cook food inside an oven.To cook food in hot oil or fat.A flat metal pan used for frying foodTo prepare food by applying heat; to cook.To combine two or more ingredients together.To cut food into very small pieces or cubes.To put something more into a mixture; to add.To make something warm or hot before serving....

Word search 2025-10-13

250 Items: antbugbatbusbunbincancatcowdaddigeareyeeelfanfunfurinkicejetkidkeymapnetpanpenpetredratskytoyuggurnyakyamzooatomarchasiaballclapcorncakecoldcitydirtduckdarkdeepdeerdustdivefistfeulfarmfundgamegategainhairideaipadjunkjokejailkitekicklistlatelamploaflionlipsladymeltmailmilkmenunameneckoatsovenpantpalmpearpestpickqtipringriserainreadrailrocksilksoda...

MWB Word Search 2026-06-01

27 Items: One bottle of Argan oil in each Jar#1 Luxury Haircare Brand in the WorldBarrier Boosting line of skincare productsProfessional quality with affordable pricesAims to make haircare a ritual like skincareQuickly became the #1 selling spf at SephoraProducts mimicking clinical Korean procedures#1 Brand for Heat Styling Products to Reduce Frizz...

Jogo caça palavras ecologia 2025-07-01

24 Items: Vaca Violeta Vulcão Venezuela Vegetação nativa Volga Veado VentoFoca Figueira Furacão França Filtragem de água Fiji Foca Energia solarUrso Uva Uivada Uruguai Uso consciente Uruguai Urso polar UltravioletaSabiá Samambaia Sismo Suécia Saneamento básico São Francisco Saola SolarXaxim Xylopia Xerofitia Xangai Xenofobia ecológica Xingu Xerelete Xergia...

KVCS Zoology Week 1 Vocab Quiz 2023-09-02

20 Items: The study of plantsPlants that live for two yearsPlants that grow year after yearPlants that live for only one yeartype of adjective that modifies nounsFlowers that have both stamens and carpelsTakes the place of common and proper nounsA mature ovary that contains a seed or seedsFlowers that have either stamens or carpels, but not both...

Massive Word Search 2025-10-09

250 Items: antbugbatbusbunbincancatcowdipdaddigeareyeeelfanfunfurinkicejetkidkeymapnetpanpenpetredratskytoyuggurnyakyamzoostomarchasiaballclapcorncakecoldcitydirtduckdarkdeepdeerdustdivefistfeulfarmfundgamegategainhairideaipadjunkjokejailkitekicklistlatelamploaflionlipsladymeltmailmilkmenunameneckoatsovenpantpalmpearpestpickqtipringriserainreadrailrocksilk...

everything word search. 2025-10-02

250 Items: antbugbatbusbunbincancatcowdaddigeareyeeelfanfunfurinkicejetkidkeymapnetpanpenpetredratskytoyuggurnyakyamzooatomarchasiaballclapcorncakecoldcitydirtduckdarkdeepdeerdustdivefistfeulfarmfundgamegategainhairideaipadjunkjokejailkitekicklistlatelamploaflionlipsladymeltmailmilkmenunameneckoatsovenpantpalmpearpestpickqtipringriserainreadrailrocksilksoda...

Gtgyg 2026-03-27

250 Items: bbqbikedawndeckdeerdockfernhikekitelakeloonparkpierpondalgaebeachcabincanoecliffcreekduneseagleferryfruitgladegrilljerkykayakmaplemoosepatioplumsporchriverrockssaladshadesteakwavesarcadebeaverbreezebugnetcameracampercheesechaletcloudsfamilyforestgardengokartguitarhikinghotdogislandmarinameadowpaddleparadepicnicrapidsrvparkscenicsmoressnackssoccer...

SUGAR & SWEETS 2026-05-05

250 Items: BARNUTPEZPOPBITSBOWLCAKECOLDCONECOOLDOVEDRIPHARDICEDKIWILAVALIMELUSHMARSMELTMILKMINIMINTOREOPEARPINTRICHSOURTUBSTWIXYORKANISEAPPLEBERRYBLASTBLISSBUENOCANDYCOCOACREAMDAIRYDOUGHDULCEFANCYFUDGEFLOATFRUITGOOEYGRAPEHONEYICINGJELLYJUICYLATTELEMONLICKSLIGHTMANGOMAPLEMOCHANERDSPARTYPECANPEACHPLAINROLOSSCOOPSHAKESILKYSPOONSTONESUGARSWEETSYRUPSWIRLTAFFYTANGY...

Unit 110 2026-03-16

42 Items: Type of tea that's not very popular. .................................Type of tea that has herbal and fruit. .................................Packing tea - Bigger leaves of tea: ................................. Leaf.Type of tea that Maofeng is an example of. ....................................

I Love you Grayson your love Emerson 2025-12-02

4 Items: chocolate camp play outside and like to make stuffloves me and Pokémon ,Roblox, Minecraft ,animals Football art and crafts Fidget toy toys and gifts from me...

Politika i gospodarstvo 2024-09-18

12 Items: Pravila i propisi koje donosi vlast s ciljem reguliranja ponašanja građana i osiguravanja društvenog reda._____________Članovi političke zajednice koji imaju prava i obveze prema državi, uključujući pravo sudjelovanja u političkim procesima.________________...

Summer 2026-05-28

25 Items: A sandy area of land next to the ocean or a lakeJuly Fourth holiday celebrating America's freedomThe direct light and warmth that comes from the sunA period of travel or time off from school and workSleeping outside in a tent or cabin away from the cityThe sixth month of the year when summer officially begins...

Understanding Loss Drafts 2024-08-01

17 Items: A list of materials needed to complete the repairs.An examination of the condition and safety of the home.The entity that represents the homeowner in a court case.The amount the insured is responsible for in case of a lossThe actual cost to replace a structure at its pre-loss condition...

Understanding Loss Drafts 2025-06-24

17 Items: A list of materials needed to complete the repairs.An examination of the condition and safety of the home.The entity that represents the homeowner in a court case.The amount the insured is responsible for in case of a lossThe actual cost to replace a structure at its pre-loss condition...

DGA Word Search 2026-02-18

17 Items: Another name for vitamin B12.DGAs advise a limit of 2300mg per day.This is essential for muscle maintenance.So many to choose from. Recommendation is 2 servings per day.Critical for bone health and you can get it from a non-food source.Commonly associated with dairy products and essential for bone health....

Card Connections Summer 2024 Recap WORD SEARCH! 2024-09-20

40 Items: Julypizzapizzaaugustbakingcostco___ fraud___ amountdispute ___extra creditextra creditexpialadociousCard Specialist ___they moved to MilwaukeeAngela's favorite hobbiesour project team is pretty ___.who's basket are you bidding on?Card programs' newest team member!the card specialists are pretty ___.the dispute specialists are pretty ___....

ULTIMATE WORD SEARCH 2025-04-22

41 Items: Half girl, half fishThe king of the jungleHidden gold and jewelsA sneaky, fast fighterColorful arc after rainA spooky floating thingA colorful flying insectA tiny cake with frostingIt buzzes and makes honeyA slow animal with a shellA yellow fruit monkeys loveCold, sweet, and melts fastA horse with a magical hornA spiky plant in the desert...

Easter at St Peter's 2026-04-01

1 Item: bunny rabbit bilby chick egg basket bonnet hunt chocolate bun cross church prayer family autumn leaves picnic brunch roast treat gift surprise ribbon bow nest grass carrot joy Sunday faith hope cocoa pastel jelly cupcake cookie park feast

Desserts 2025-10-14

1 Item: Apple Pie, Cake, Mousse, Fudge, Pudding, Donut, Ice Cream. Fudge, Custard, Sorbet, Fruit Tart, Candy, Tiramisu, Crepes, Eclairs, Cream Puff, Cookies, Cupcake, Cheesecake, Cobbler, Cake Pop, Truffle, Caramel Apple, Macarons, Ganache, Souffle, Jello, Frozen

Nutrition 2022-12-13

35 Items: Blood sugarFruit sugarStart of digestionIndigestible starchComplex carbohydratesVitamins and MineralsGetting enough to eatPre-cursor to Vitamin ACarbs, fat, and proteinOne of the macronutrientsNeeded for blood clottingBuilding blocks of proteinIron found in animal foodsVitamin B12 is stored hereNatural source of Vitamin D...

Harbor Me Vocabulary Quiz 2025-04-10

27 Items: HeaterImperfectTo shelterSpanish word for riceSpanish word for pastryState of being never-endingThe act of coming back to lifePuerto Rican shaved ice dessertUncertain, indefinite, or unclearHaving been reborn in another bodyKilling of one person by another; murderOffering resistance to something or someone...

Dental implants and partial dentures 2026-02-15

12 Items: A denture used for a short interval of time.side of the dental arch to those of the other side.The unit of a removable partial denture that connects the parts ofA partial denture that can be removed and replaced in the mouth by the patient.The unit of a partial denture that covers the residual ridges and supports the denture teeth....

Viernes 13 (1980), dirigida por Sean S. Cunningham, es conocida por popularizar al asesino en serie con una máscara. Curiosamente, el icónico personaje Jason Voorhees no usa su famosa máscara de hockey hasta la tercera película de la serie. 2024-08-20

30 Items: JasonNocheHorrorSangreMuerteGranjaCabañaGritosPelucaCrimenTerrorSombraEscenaSangreAsesinoMáscaraAsfixiaVíctimaTensiónVoorheesCuchilloPelículaSuspenseCampistaCampamentoCampamentoCrystalLakeAdolescenteEscapatoriaDesmembramiento

Hydrogen Word Search 2025-05-14

30 Items: (H): 1s1(He): 1s2(Li): 1s2 2s1(Be): 1s2 2s2(B): 1s2 2s2 2p1(C): 1s2 2s2 2p2(N): 1s2 2s2 2p3(O): 1s2 2s2 2p4(F): 1s2 2s2 2p5(Ne): 1s2 2s2 2p6(Na) - Atomic Number: 11 Electronic Configuration: 1s² 2s² 2p⁶ 3s¹Magnesium (Mg) - Atomic Number: 12 Electronic Configuration: 1s² 2s² 2p⁶ 3s²...

Task #13 - SPH4U Word Search (Lucas Soliman) 2023-06-14

25 Items: A quantity with only magnitude.The change of an object's positionThe x and y properties of a vector.The amount of matter within an objectThe amount of energy stored within an objectenergy in the form of motion within an objectA material that permits the flow of electronsThe rate of change within an object's position...

IIM And LD Module 2023-09-29

26 Items: Where we put notes in the module.The tab you go to to open a new claimWe find documents in the module here.In claim documents S stands for _____.In claim documents P stands for _____.In claim documents U stands for _____.We typically search for claims using the ____.We send the procedure packet on the _________ tab....

Askiathegreat Word Search 2024-10-04

29 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthagegreat early church fathers and martyrs from Carthage...

Slay word search 2025-06-16

1 Item: would you marry me let s together a monkey how would you marry me let's together a monkey how would you marry me let's together a monkey how would you marry me let's do together a monkey how would you marry me let's together a monkey

Tweens 3 2023-07-27

1 Item: when, where, how much, how many, how much, why, passion fruit, jelly beans, lollipop, gumdrops, beet, lettuce, plum, bubble gum, cabbage, mix, follow, share, choose, plant, prepare, vegetables, computer, laptop, fig, candy, doughnut, pie, pineapple, farm,

WWI, 1920's, The Great Depression 2025-09-25

1 Item: speakeasy, prohibition, feminism, harlem, armstrong, crisis, migration, radio, flappers, poverty, speculation,charleston, unemployment, racism, stockmarket, suffrage, cinema, crash

Spelling Rule: Final /j/ and /s/ 2024-11-21

1 Item: judge, damage, package, twice, stage, carriage, since, practice, marriage, baggage, office, message, bridge, chance, notice, ridge, manage, palace, bandage, fringe, average, fleece, fragrance, excellence

Unit 7 Spelling Contractions & Possessive S 2026-01-20

1 Item: couldn't dog's kids' she'll we've aren't he's mom's won't I'll they're bugs' I've dad's shouldn't where's haven't it'll hadn't

SUMMER 2025-01-29

1 Item: august,barbecure, baseball, barefoot, backpacking, beach, berries, boat, camp, canoe, daisy, dive, fan, fin, firefly, fishing, flip flops, flowers, fourth of july, frisbee, fruit, garden, grass, holiday, hot, humid, heat, ice cream, july, june, lemonade,

Food Preparation Terms 2024-11-22

25 Items: To cook LiquidTo cook by dry heatTo cool food to 40°FA measurement less than 1/8 tspto cool to 32°F and store at 0°FTo cut food into long thin stripsTo remove the skin of a citrus fruitTo mix a concentrated liquid with waterTo mix gently with a spoon in a rotary motionTo rapidly mix with a spoon fork or wire whisk...

Room 21's Words Part 1 2023-03-09

1 Item: and an am all are back but by can come called did do each from for get go going he her here has have in I it is jump look like little my me no of on she so see the to then they that them this us up we will was want were went what you your girl boy him

where's wally word search???(:!!!ev@s 2025-05-22

1 Item: wally

70’s R&B & Soul Artists 2025-09-24

1 Item: Franklin, Marvin Gaye, Stevie Wonder, Al Green, Diana Ross, The O’Jays, Gladys Knight, Curtis Mayfield, Earth Wind & Fire, Isaac Hayes, Teddy Pendergrass, Smokey Robinson, The Spinners, Minnie Riperton, Patti LaBelle, Barry White, The Isley Brothers, Anit

Financial Planning Word Search 2022-09-20

28 Items: unexpected changefixed term pensioncontributions made before income taxtransferring super to pension accountprice charged by the insurance companyA very long comprehensive questionnairean estimate of the prices for your coversa combination of stepped and level premiumspremium increases each year in line with age...

SPH4U Word Search 2024-01-21

21 Items: The change in velocity over timea balance between different factorsVelocity at a particular instant in timethe point where an object balances (3 words)The sum of vectors when they are added togetherThe stored energy of position possessed by an objectThe type of friction that occurs when an object is at rest...

SPH4U Word Search 2024-01-21

21 Items: The change in velocity over timeA balance between different factorsVelocity at a particular point in timeThe point where an object balances (3 words)The sum of vectors when they are added togetherThe stored energy of position possessed by an objectThe type of friction that occurs when an object is at rest...

Askiathegreat Word Search 2024-10-04

28 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthagegreat early church fathers and martyrs from Carthage...

WWI, 1920's, The Great Depression 2025-09-25

1 Item: speakeasy prohibition feminism harlem armstrong crisis migration radio flappers poverty speculation charleston unemployment racism stockmarket suffrage cinema crash

A Word Search 2026-03-05

1 Item: banana is an elongated, edible fruit—botanically a berry[1]—produced by several kinds of large treelike herbaceous flowering plants in the genus Musa. In some countries, cooking bananas are called plantains, distinguishing them from dessert bananas

NEEDOHS< SONNYS< SQUISHIES 2026-05-21

1 Item: series, snack series, fruit series, animal series, robbi, secret, nice cream, nice cube, fuzzball, groovy cat, groovy dog, mini needoh, dream drop, dumpling, glitter dumping, sqeezeluck, coconut oil, slow rise butter, nicicle, groovy glob, color change, g

ddddddddddd 2023-10-24

1 Item: Tuna Noodle Casserole, Green Bean Casserole, Beef Stroganoff, Chicken à la King, Jell-O Salad, Chicken Pot Pie, Deviled Eggs, Spam Musubi, Shrimp Cocktail, Fruit Cocktail, Ambrosia Salad, Baked Alaska, Pineapple Upside-Down Cake, Swedish Meatballs, Sloppy

Vaetchanan 6.0 2026-07-18

30 Items: What should repentance produce?What must crooked paths become?What Hebrew word means “Comfort”?What must proud mountains become?What did the wandering son decide to do?What does grief often cause us to lower?Who prepared the way of Adonai in Luke 3?What does the word of our God do forever?What Hebrew word in the Shema means “one”?...

Term 2 2026-04-18

19 Items: left, and, lunch, land, hand, went, mustwear, tear, pear, hair, air, pair, chair, square, spare, glare, staretalk, walking, stalk, chalk, balk, both, don’t, most, post, gross, hostthumb, lamb, crumb, limb, numb, comb, dumb, plumber, debt, doubt, subtletoucan, soup, coupon, wound, youth, fruit, juice, bruise, suitcase, cruise, recruit...

Autumn Word Search 2022-10-15

37 Items: / HARVEST ***/ LEAVES COLOR/ *** OR TREAT/ A *** HARVEST/ AUTUMN IN SPANISH/ AUTUMN IN CROATIAN/ ANNUAL PARADE IN NYCALMANAC / KINKS KLASSICRAIN / GUNS N' ROSES SONG/ ANOTHER NAME FOR HALLOWEENCORN / ABOMINATION OF A CANDYPIE / DESSERT ON THANKSGIVING/ IT'S THE GREAT ***, CHARLIE BROWNBOOGIE / VILLIAN IN HALLOWEEN TOWN...

Nutrition Wordsearch 2025-03-21

24 Items: A mineral found in saltRefers to a state of well-beingA type of fat found in the blood.A mineral that helps carry oxygen in the bloodA type of fat typically found in animal productsRefers to a type of fat that is considered healthyA food group that includes milk, cheese, and yogurtEssential nutrients that help regulate body functions...

Summer Time 2026-05-27

50 Items: Backyard cookoutGentle summer windCasual beach sandalsClassic cookout foodPoolside shaded shelterWind-powered watercraftFrozen treat on a stickLong drive taken for funLarge body of salt waterSmall beach collectiblesLand surrounded by waterOutdoor meal on a blanketSmall boat paddled by handClothing worn for swimmingInformal word for vacation...

Long vowel 2026-05-17

1 Item: sheep, bomb, spring, strong, robe, tape, cook, see, peel, window, goat, cow, feet, glue, fruit, boat, food, beach, sheese, father, arm, fork, spoon, stray, play, money, trolley, cute, light, pie, count, dirt, fur, mouth, feather, kite, knife, wrist

Human Interaction 2025-02-27

18 Items: the cutting down of foreststhe gases that surround the earth (close to earth)hazy air that contains smoke or particles or other pollutants.all the waters on the earth's surface (e.g., rivers, lakes, oceans)Gases in the Earth's atmosphere trap infra-red heat near the Earth.the hard, solid part of the earth (e.g., the soil and rock near the surface)...

Bloc 6 (partie A): Le féminin des noms et des adjectifs (règle particulière) : doublement de la consonne finale suivie d’un e (eil/eille; el/elle; en/enne; et/ette; on/onne; s/ss) //Le féminin des noms et des adjectifs (règle particulière) : transformatio 2025-10-22

42 Items: nulnulleacteurjumeaubergernageurportieractriceamateurjumellesportifmenteurbergèredanseurnageuseacheteurécolièreélecteuramatricesportiveauditeurmenteusedanseuseacheteusechauffeurélectriceauditricecourageuxmusicienneconducteursilencieuxcordonniercourageusetraducteurconductricesilencieusecordonnièretraductricetravailleurtechniciennetravailleuse...

Genesis Chapter 3 - Explain humanity's fall into sin. Eve, tempted by the serpent, eats the forbidden fruit and shares it with Adam. They disobey God, they are cast out of the Garden of Eden. This chapter introduces sin, separation from God, and the hope  2025-04-12

15 Items: EveGodSinAdamTreeGoodEvilCurseNakedleavesSerpentCherubimKnowledgeExpulsionTemptation

Help the Earth-Recycle! 2022-10-02

11 Items: A process of converting wastes into reusable materials.The thin, hard outer layer of an egg which is very fragile.A slender woody shoot growing from a branch or stem of a tree or shrub.A material made up of very thick, stiff paper, usually pale brown in colour, used especially for making boxes....

Askiathegreat Word Search 2024-10-04

30 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriaspans much of southern Africathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthage...

Askiathegreat Word Search 2024-10-04

30 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriaspans much of southern Africathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthage...

Ron's Birthday Word Search 2025-03-05

45 Items: Kelly's nicknameWhat you call D.J.What D.J. stands forYour mom's first nameYour dad's first nameShe sleeps next to youShe works for the StateYour church denominationNickname you call KierstinHe owns an auto repair shopShe sings in her school choirHus name means "intense fire"Military branch you served inShe has a townhouse in Florida...

It happened in 2024! 2025-10-10

10 Items: Dame Maggie Smith died in September this year, played whom in Downton Abbey?Which fast food chain celebrated the 50th anniversary of opening its first outlet in the UK in 2024?A scrap of what was incorporated into each of the medals awarded at the 2024 Summer Olympic Games in Paris?...

Jherson - Verbs Day 1--8 2023-10-04

40 Items: I l_______ my daughter.Do you ________ French?What time do they a_______?I r_______ what you told me.I l_______ hot dogs from IKEA.We will b_______ work at 8:00am.Do you want to c_______ with us?Can I ______p you find something?That doesn't a_______ my question.Did you m_______ anybody new today?If I ____t too much, I will get fat....

Courtroom Vocabulary 2026-02-04

28 Items: a crimea contradiction.to erase or remove completely.a person involved in a lawsuit.accused or charged with a crime.give evidence as a witness in court.a writ ordering a person to attend court.not connected with or relevant to something.action taken in a court to settle a dispute.the lawyer(s) conducting a case. (Atticus Finch)...

Beneficial Genetic Mutations 2023-03-29

16 Items: Some frogs have developed ___ feet as a mutation for better swimmingA resistance to this type of disease by the sickle cell anemia mutationA resistance to this type of medicine helps bacteria survive and reproduceAn ability to find prey that evolved in bats because of a genetic mutation...

Les ami(e)s de la classe 2022-09-06

1 Item: Kora, Kalina, Brinley, Nicholas, Max, Lemuel, Daphne, Albert, Jaxson, Lucas, Audrée, Tobias, Samuel, Paisley, Olivia, Fréderik, Emilia

Spelling & Vocabulary Wk. 16 2026-02-24

10 Items: - be given, presented with, or paid (something).- a wild dog that resembles the wolf, native to North America.- a fossil reptile of the Mesozoic era, in many species reaching an enormous size.- work in an organized and active way toward a particular goal, typically a political or social one...

5 Months, 35 Hidden Clues, 1 Favorite Person. 2026-06-02

35 Items: The "Electric City" ⚡Officially "our game" 🃏Your next destination ✈️The elite drink choice 🍵Our very first watch showThe ultimate comfort showYour favorite cooked food 🥣Our absolute favorite sweetThe superior choice of pet 🐾The elite tier food option 🍕Your ultimate favorite fruit 🍓Can't start the show without itThe number of months I've loved you...

July Word Search 2026-07-09

56 Items: Rich dairy productPopular dairy foodPopular summer fruitVacation taken by carCommon summer footwearCultured dairy productFlavored milk favoriteRefreshing summer drinkAmerica's pastime sportOutdoor cooking activitySeventh month of the yearPart of the American flagPart of the American flagAnimal that produces milkSeason that begins in June...

JEN’S TOP 50 2025-11-22

51 Items: A DOZENAND JELLYCHILD’S POSEFAVORITE COLORCOLLEGE MASCOTCHOCOLATE CHIPNUMBER OF TATTOOSA FAVORITE AUTHORHIGH SCHOOL MASCOTVERY SUPERSTITIOUSEVERYBODY CUT LOOSEHOME OF THE BLIZZARDHOLIDAY CREAMY DRINKWORKERS FOR THE HIVEFAVORITE WAY TO SWEATRISING FROM THE ASHESFIRST DANCE 10/6/2001ISN’T SHE PRETTY IN…?CUMULONIMBUS OR CIRRUSGRAPEFRUIT CITRUS SODA...

Econ Word Search 2026-01-06

28 Items: This good is club and public.This good is private and common.Which group wants to maximize PROFIT?Which group wants to maximize UTILITY?Peoples change in preferences over timeWhat is the tax on imported goods called?___ good that means more money, LESS of that goodChanges in __ Prices will lower or increase costs....

Vocab Word Search 2022-10-18

20 Items: The product life cycle stage in which sales rise rapidly.The particular group of customers a business seeks to attract.People who personally use a good or service to satisfy their own wants.Goods and services purchased quickly and without much thought or effort.The product life cycle stage when the product first appears in the marketplace....

Unit 6 Statistics Vocabulary 2025-03-04

24 Items: A guess or estimate based on patterns or data trends.A method of collecting data by asking people questions.The entire group being studied in a survey or experiment.– The number(s) that appear most frequently in a data set.A ratio that compares one part of a group to the entire group....

Spring 2026 Final Exam Review 2026-05-21

29 Items: ______________ a company's purpose______________ The "C" in CSR stands for this word.______________ The "S" in CSR stands for this word.______________ The "R" in CSR stands for this word.the final product and/or service created in a project______________ a roadmap for opening and growing a business...

inanimate insanity word search 2026-04-13

42 Items: a comedianlucky luckybesties with saltthe host of season 1the winner of season 3!the name of a band in iithe winner of season two!the product bow advertiseda bouncy ball "its a ball!"the abbreviation of season 3two people who share a brainthe name for season 1's winnera scientist who is friends with fanthe biggest fan and host of season 4...

Identitas Word Search 2023-10-04

15 Items: Surat lamaran pekerjaan termasuk surat...pada kutipan soal di atas terdapat kesalahan kata yaitu...Pada kutipan surat lamaran pekerjaan di atas kata ‘sangat ingin’ diganti menjadi...“Atas perhatian dan kebijaksanaan Bapak/Ibu, saya ucapkan terimakasih.” Bagian tersebut merupakan bagian dari......

Pekudei / Shemot Review 2025-03-23

45 Items: “accounts”Moses wife.Moses brother1/10 an ephah.the rams horn.The Seventh day.the second plagueThe eldest son of LeviMoses and Aaron’s motherMoses and Aaron’s fatherThe color of Aaron’s robeMiriam played what instrument.A _______ is not to be cursed.Israel left Egypt in this month.They attacked Israel at Rephidim.How many daughters did Yitro have?...

Lemon tree 2024-12-01

20 Items: Boring. (adj). Not interesting; causing boredom.Rainy. (adj). Characterized by rain or frequent rainfall.Feel. (v). To experience an emotion or physical sensation.Far. (adj). At or to a great distance in space, time, or degree.Fast. (adj/adv) Moving or capable of moving quickly; also refers to speed....

And another on for Sherlock: Engineering Edition and some other questions 2025-05-06

18 Items: A citrus FruitAnother citrusCapital of TurkeyHello/Goodbye in ItalianLargest Country in AfricaCan Bob The Builder fix itThe name of Captain Holts dog in B99When viewing the composition of petroleum by weight, what chemical makes up the majority?...

Chapter 3 Vocabulary 2023-10-19

41 Items: Earth's outer layer _____________Earth's thinnest layer______________Earth's innermost layer______________layer beneath the crust __________________when magma reaches the surface _____________layer above the troposphere _____________________water vapor forms water droplets on dust particlesLayer beneath the lithosphere ____________________...

Week 1 2023-09-29

64 Items: Where we put notes in the module._____Authorizations last 24 hours.A borrower is also known as a _______The tab you go to to open a new claimWe find documents in the module here.In claim documents S stands for _____.In claim documents P stands for _____.In claim documents U stands for _____.An account used to pay insurance and taxes....

Mother 2026-05-07

56 Items: ---- fell hup- Cool and tidy- Amazing people in sky- You turn ring into growth- Odd, chalk mess makes food- Nickel and Cerium are good- Miss W moves through water- Weirdly, bag ink for cooking- Tear into vice to be original- Operating car to move forward- Raise five eggs in a rough way- Six hide in long time fondness- Odd tool, yes but fun for kids...