fourth of july Word Searches

Recap Unit 9 2024-11-11

19 Items: an apartment buildinghow heavy something isstories, poems and playsdepartment that sells productspersuade someone to by somethingunit of measuring liquid in Europeopportunity to decide between optionsowned/ used by someone else before meworried that something bad will happenunit of measuring liquid in the UK and US...

Civics vocabulary 2026-01-29

19 Items: Channels of mass communicationA set of beliefs or principlesInvolving two political partiesA duty or obligation someone hasThe process of learning somethingA legal member of a country or a stateThe branch of government that makes lawsThe method by which a bill becomes a lawA formal discussion on a particular topic...

M3 Unit 1-3 vocabulary 2023-09-01

11 Items: the ovule becomes this partmany food chains linked togetherthe ovary of a flower becomes thismethod of identifying an unknown organismtype of process where humans control traitspollen moving from the anther to the stigmathe passing of features from parents to offspringtype of process where the environment controls traits...

Kaylee & Jonathan 2025-07-09

20 Items: Groom's siblingBride's siblingBest man's nameMonth John proposedBride's middle nameGroom's middle nameCouple's dog's nameGrade Kaylee teachesHoneymoon destinationGroom's birthday monthMatron of honor's nameBride's college mascotBride's birthday monthBride's favorite colorGroom's favorite colorMother of the groom's nameMother of the bride's name...

Hades 2025-11-24

74 Items: NyxDusaZuesAresRailArmsSackObelKeysPoolDoomCallCastHadesChaosBladeBloodHouseAegisChillAlectoCharonHypnosSkellyAthenaHermesLernieGreeceWretchJoltedVerminHammerZagreusMegearaOrpheusArtemisDemeterTheseusVarathaof StyxElysiumBlindedof StyxThanatosAchillesCerberusEurydiceSisyphusPoseidonDionysusDefianceDarknessChthonicAmbrosiaDiamondsProphecyTarturus...

Everest Word Search 2026-04-24

20 Items: Sin CityD-day beachMexican dogJailhouse RockerSeven sided shapeCapital of EnglandLara Croft actressFamous literary horseHan Solo's best friendBart, Homer, Marge etcOwner of Woody and BuzzItalian sports car brandStar of Mission ImpossibleAlice in Wonderland authorLargest Mammal in the worldSinger of 'don't start now'Tallest mountain in the world...

Quiz Time 2026-04-24

20 Items: Sin CityD-day beachMexican dogJailhouse RockerSeven sided shapeCapital of EnglandLara Croft actressFamous literary horseHan Solo's best friendBart, Homer, Marge etcOwner of Woody and BuzzItalian sports car brandStar of Mission ImpossibleAlice in Wonderland authorLargest Mammal in the worldSinger of 'don't start now'Tallest mountain in the world...

Chapter 9 2025-02-18

15 Items: presevering our scarce natural resourcessets standards for manufacturers to go byprincipals of morality or rules of conducta natural resource that cannot be replaced when used upgovernment agency to monitor workplace diversity and agegovernment agency that monitors safety standards in business...

SPN 1 2B Vocab 2025-11-18

30 Items: myinofdeskyourheredoorflagdondetheretheremousetableclockchairtablescreenwindowbehindposterit's akeyboardcomputeron top oftrash canunderneathin front ofwaste basketwhat is thispencil sharpener

July 4th(third grade) 2025-07-05

7 Items: BandParadeFreedomMarchingFireworksCelebrateIndependence

Winika's Challenging Word Search 2022-08-09

20 Items: not responsibleIt is like a canoea very small objectTo turn into a liquidstyle of the middle agesa naive act or statementfreedom from work or dutylong duration of own lifeyou can also control thiscomplicated plan or actionglowing impression of lightsomething that isn't necessarysomething enforced by the courtinclined to dispute an argument...

Word Search 2023-03-06

20 Items: Not a dogNot a catcolor of rosesspanish teacherColor and fruitWhere birds livecolor of patrickThe color of grassThe color of the sunWhere kids go to learnWhat you cut paper withAnimal born with a shellDevice we all use everydayBig cat king of the jungleAnother girl color not pinkdevice given to us by schoolBird with long legs that is pink...

Lord of the Flies 2023-09-27

20 Items: Wild, uncontrolled.Large sea snail shell.Older boys on the island.Boys tasked with hunting.Someone who saves others.Younger boys on the island.Person rejected by society.Place of shelter or safety.Brutal, uncivilized behavior.Group gathering for a purpose.The pig's head; symbol of evil.Dance Ritual dance by the boys.Advanced state of human society....

Sip - n - Search 2025-05-05

31 Items: James' hobbiesYears togetherJames' nicknameJames' Best ManBride's hometownGroom's hometownCouple's HometownGroomsmen's namesMorgan’s nicknameBridesmaid's namesJames' birth monthJames' middle nameEngagement locationJames' career fieldMonth of engagementCouple's cat's namesJames' favorite beerMorgan’s middle nameMorgan's birth month...

Londen Johnson 2025-05-21

23 Items: Groom’s signBride’s signCraig’s hometownLonden’s hometownGroom’s Alma materLilli’s favorite toyMonth Craig proposedDating app we met onColor of Craig’s eyesHoneymoon destinationBride’s favorite singerNumber cake flavors triedCastel where Craig proposedFavorite Portuguese dessertFirst big vacation togetherOur favorite Christmas dish...

World Building Jumble Smash Word Search 2026-07-25

20 Items: - the land or kingdom- the ruler of the land- a strong safe building- what happened long ago- special power or spells- the sun or night lights- laws or secret language- a family group or tribe- the drawing of the world- money used to buy things- the era or history period- large water covering land- an entry point to a place...

Libby & Nate 2024-07-25

30 Items: Grooms alma materCouples dog’s nameBride’s middle nameGroom's middle nameCouples favorite barMonth groom proposedHoneymoon destinationBride’s favorite foodBride’s favorite wineBride’s favorite hobbyBride's birthday monthDating app they met onGroom’s favorite hobbyBride's college mascotGroom’s favorite dessertGroom’s favorite bourbon...

Amy & Craig 2025-03-05

28 Items: Craig’s jobWedding venueAmy’s workplaceName of their dogProposal locationTown they live inWhere Amy grew upAmy’s middle nameCraig’s middle nameWhere Craig grew upColour of Amy’s eyesMonth Craig proposedName of the Best ManCraig is allergic to…First holiday togetherAmy’s favourite TV showMonth they got togetherHigh school they went to...

ELA Word Search 2026-05-14

20 Items: A complete sentenceThe end of the storyThe author's attitudeAn incomplete sentenceA person, place, or thingWhat the sentence is aboutWhere the story takes placeThe feelings of the audienceThe lesson/moral of the storyThe action word of a sentenceA comparison using like or asThe first step in the plot pyramidThe most exciting part of the story...

Tuesday Trifle Two 2026-03-31

22 Items: SomeoneMake a Deal?Tarot Number 4Tarot Number 5Tarot Number 6Tarot Number 7Tarot Number 8Tarot Number 9Card from EgyptTarot Number 10Tarot Number 12Tarot Number 17Tarot Number 18Tarot Number 19Tarot Number 20Arcana of HealingArcana of CastingArcana of StackingArcana of GuardingCard from VenezuelaCard from the big cityCard from Medieval Europe

Malicious Software - CAT 2023-07-24

17 Items: Type of unwanted softwareUse of software without purchasing itA large network of compromised computerslegitimate software that monitors your online activitycriminal activities involving computers and the internetGathering information about a person in a position of powerdistribution of a story that is not true on social media sites...

Listen To Me! 2-3 2023-08-09

44 Items: maywalkrestlawntripjunejulysmarttimidbravefunnygamesbooksmusicplantcleantablevisittastyfoggymarchaprilactivehonestpolitepuzzledinnerdishespalacetemplefamousaugustgarbagelaundryjanuaryoctobersiwmmingfestivalfebruarynovemberdecemberbadmintonseptembercompetition

Summer Word Search 2024-05-16

45 Items: funsunhotbbqmaypoollakeboatjulyjunesandbreakbeachoceanpartygamessummersportsaugusttravelshortssandalsflowerssunburnfishingcookoutnoschoolswimmingvacationsunshineicecreamfloatiessunscreenpoolpartysleepoverbeachballmosquitossunglassessleepinginwatermelongraduationsummercampbathingsuitsummerschoolwaterballoon

Cat Word Search 2024-05-22

42 Items: catbathotsunufocowboylionhailmastbikefishjulyjunerockgoldgirlkingzebrahippoclockchipsperezplutobrillqueensofiatrainsticketplanetnissanpoliceschooldallasprinceacademyelephantskeletonrailroadtornadoeshelicopterMan's best friend

Erik & Abbey 2024-07-11

45 Items: zooeriklovekissjulywifeabbeybridegroomringspennytreesmillerhikingfamilynaturesummerforeverhusbandfinallyawkwarddancingbelovedweddingwilliamseternityabbicadesquirrelkayakinglaughterdevotioncocktailshoneymoondanapointcelebratetwentiethadventurebigbearlakejustmarriedlookoutpointintothewoodsfifteenyearstimeaftertimesweetsomethingpartnersincrime

Monday Word Search 2025-03-17

44 Items: MAYJUNEJULYMARCHAPRILMONDAYFRIDAYSUNDAYAUGUSTEASTERTUESDAYJANUARYOCTOBERWEEKONEWEEKTWORAMADANTHURSDAYSATURDAYFEBRUARYNOVEMBERDECEMBERWEEKFOURWEEKFIVELABORDAYHANUKKAHWEDNESDAYSEPTEMBERWEEKTHREECHRISTMASHALLOWEENMOTHERSDAYFATHERSDAYNEWYEARSDAYMEMORIALDAYVETERANSDAYCOLUMBUSDAYWINTERBREAKTHANKSGIVINGVALENTINESDAYSPRINGEQUINOXAUTUMNEQUINOXWINTERSOLSTICE...

BrazilShit 2023-12-21

12 Items: Name of CurrencyRanking in economyName of Largest Rainforestname of the country we're inLocation you're at right nowContinent of country we're inCapital of the country we're inThe Country's National LanguageLocation you were previously athow many timezones the country hasBrazil's Most famous soccer player...

Super sigma JROTC word search!!! 2024-12-03

11 Items: a member of a political communitya religion supported by the state through tax moneythe care, guardianship, and control exercised by a deitythe principles of virtue as expressed in Judeo-Christian teachingsthe status of a citizen with its attendant duties, rights, and privileges...

Week 20 Thursday 2024-02-11

25 Items: adultsthoughtto knowunable to speakto previously fightable to do somethinghaving the same valuemaking a lot of noisepertaining to the brainimpulsive and unpredictableA break in the earth's crustto get or gain through some effortto think that something will happena piece of land surrounded by waterwilling to wait without complaining...

Waves Unit Vocabulary (RIS) 2024-03-14

22 Items: lowest part of a wavehighest part of a wavehow compressed or rarefiedrapid back and forth motionfrom one compression to the nextwave traveling parallel to the forcedisturbance causing medium to vibratewhat a mechanical wave travels throughfrom crest to crest or trough to troughthe distant parts of a longitudinal wave...

ww5 u10 2024-06-10

24 Items: to freea particular timeto set up or beginto be or act againstexcellent of its kinda very large number; manyto forbid by law or orderhappening once in a whilethe act of following aftera longing or strong desirethe state of being enslavedthe act or condition of being againsteasy to get; present and ready for usenot wanting to do something; unwilling...

Learning Yarn Words 2024-08-15

74 Items: 12346789010GoSadBadCrySitArmSitManyGoodI amFromComeNoseBackNeckHeadKneeSandHereHelloTiredHappyAngryStandAnkleBellyTeethElbowMouthFingerTongueMorningIpswichThunderWelcomeBrisbaneMosquito5 or handVery manyShouldersWaterholeThank youDay or sunWild honeyStorm birdEye or lookBright starSand goannaYam BellbirdWater dragonEar or listenSpeak or talk...

1st Semester Review 2025-01-07

27 Items: "rebirth"Holy cityRenaissance manwrote the 95 Thesesfather of Christianitysigned the Magna Cartagives depth to paintingsthe first census; a bookKicked out of the Churchfocuses on the human potentialled the 3rd Crusade for Englandperson who called the 1st Crusadepromoted religious tolerance in Englandtrade between the old world and the new...

Week 19 Thursday 2024-02-11

25 Items: adultsthoughtto knowunable to speakto previously fightable to do somethinghaving the same valuemaking a lot of noisepertaining to the brainimpulsive and unpredictableA break in the earth's crustto get or gain through some effortto think that something will happena piece of land surrounded by waterwilling to wait without complaining...

ITS ALL ABOUT MICROSCOPIC LIFE 2024-03-01

22 Items: The powerhouse of the cellSingle Celled microorganismsone-celled aquatic organismsGreen pigment in plants and algaea substance capable of causing cancersmallest unit that can live on its ownMaterial within a living cell-jelly-likeSmall common fly found near rotted fruitViruses that infect and replicate in cells...

BSBMED301 - Word Search Revision 2026-05-31

25 Items: the ability to walkword root meaning heartword root meaning stomachsuffix meaning inflammationsuffix meaning the study ofeponym for a movement disordersuffix meaning surgical removalabbreviation for range of motionbody cavity containing the brainword part at the end of a medical termword root meaning swallowing or eating...

Characters in Romeo and Juliet 2026-04-01

21 Items: Romeo's fatherRomeo's motherJuliet's suitorRomeo's servantPrince of VeronaMontague's nephewFights with SampsonRomeo's close friendHe loathes MontaguesJuliet's real motherMale lead of the playRefuses to sell poisonFemale lead of the playWoman that raised JulietHeld in a quarantine houseCapulet's illiterate servantPatriarch of the Capulet Family...

social studies Interim Review 2026-02-24

20 Items: Named the New Southkeader of populist partybetween two people(divorce cases)things that you HAVE to do (taxes)each branch of gob has their own power to dobetween someone and the law (robbing a bank)programe to help poor black AND white farmerssomeone has their own tools and labor to offeroganztion to keep African Americans from voting...

APES Unit 11 2024-04-30

12 Items: Bottom of the ocean97% of water is ________Factor in water availabilityUnevenly distributed human needCover 71% of the Earths surfaceNot enough light for photosynthesisTransport water over long distancesamount of water used for all purposes per personOpen water, contains phytoplankton to photosynthesize....

Deluge Word Search 2025-10-27

15 Items: To move back or away from a previous position.A powerful tropical cyclone with violent winds.In a way that shows great energy, speed, or anger.Extremely large or great in size, degree, or extent.Scattered pieces of waste or remains after destruction.Walked heavily and slowly; worked hard and persistently....

Marketing 2026-04-23

22 Items: The final user of a product.Selling the same product to the whole market.Dividing consumers in the market by geographic area.Developing products for a small segment of the market.Markets for goods and services bought by the final consumer.Things we would like, but which are not necessary for our survival....

Section 3 Unit 15 (46) Word Search 2 2024-02-16

30 Items: (η) the physics(η) the science(το) the cause, reasonto discover, uncover, invent(η) the chemistry (fig or lit)(η) the (genre) science fiction(η) the method, system, fashion(το) the sample, specimen, tokento research, investigate, search(η) the energy, action, potential(ο) the (male) astronaut, cosmonautanalog, proportional, proportionate...

Unit 107 2025-10-05

30 Items: and they are...-Offer money as payment-Something given as a gift-An outdated type of payment-This could be wrong on the bill-A modern way of making a booking-An analysis from the billing system-How to make a booking whilst visiting-This person deals with group bookings-This could fail when taking a payment-A birthday may be a special one of these-...

Marketing 2026-04-23

22 Items: The final user of a product.Selling the same product to the whole market.Dividing consumers in the market by geographic area.Developing products for a small segment of the market.Markets for goods and services bought by the final consumer.Things we would like, but which are not necessary for our survival....

Marketing 2026-04-23

22 Items: The final user of a product.Selling the same product to the whole market.Dividing consumers in the market by geographic area.Developing products for a small segment of the market.Markets for goods and services bought by the final consumer.Things we would like, but which are not necessary for our survival....

Marketing 2026-04-23

22 Items: The final user of a product.Selling the same product to the whole market.Dividing consumers in the market by geographic area.Developing products for a small segment of the market.Markets for goods and services bought by the final consumer.Things we would like, but which are not necessary for our survival....

Beneficial Genetic Mutations 2023-03-29

16 Items: Some frogs have developed ___ feet as a mutation for better swimmingA resistance to this type of disease by the sickle cell anemia mutationA resistance to this type of medicine helps bacteria survive and reproduceAn ability to find prey that evolved in bats because of a genetic mutation...

Energy Word Search 2025-11-19

23 Items: Top of a waveHow energy movesHeight of a waveBottom of a waveBaseline of a waveLongest wavelengthShortest wavelengthEnergy due to motionUsed for sterilizingUsed for medical imagingDevice that sends signalsDevice that receives signalsHow often a wave passes a pointDistance between repeating pointsAbility to do work or cause change...

WHI.2 Vocabulary Practice 2025-01-15

12 Items: Old Stone Age ____________________New Stone Age ____________________more than necessary; excess ________________skilled craftspeople; specialized labor ______________second of the three principle ages (Stone, ______________, Iron)transition from nomadic life to settled farming _____________________...

SCOTT PILGRIM 2025-03-04

34 Items: kimkencatenvytoddkyleglowevilscottstacyjimmylucasroxieninjatwinsramonaknivesgideonpirateleaguewallacestephenmatthewglassesgigadeonrockstarmoviestaryoung-neilnega-scottother-scottpixel-swordself-respectpower-of-loveunderstanding

Scientific Terms Word Search 2023-05-16

20 Items: the highest point of a waveWhat unit waves are measured inthe way transverse waves travelThe unit frequency is measured inwhat you divide by to find frequencyThe force that draws objects to earththe substance that a wave travels throughThe horizontal lines on the periodic tableThe type of reaction when heat is released...

1 st Semester Review 2025-01-07

27 Items: "rebirth"Holy cityRenaissance manthe first censuswrote the 95 Thesesfather of Christianitysigned the Magna Cartagives depth to paintingsKicked out of the Churchfocuses on the human potentialled the 3rd Crusade for Englandperson who called the 1st Crusadepromoted religious tolerance in Englandkilled nearly 50% of Europe's population...

Reproductive Healthcare 2025-02-03

28 Items: work as a teama term for cancerprotects human rightscare during pregnancyStudy of living thingsnot able to get pregnantinformed decision makingcares for newborn to teenschange in normal cell growthinability to have intercoursenewborn to first 30 days of lifeProvider specialist in older adultstudy of the structure of the body...

Maginferrando Word Search 2025-10-01

20 Items: EMPIREPACIANOJOSEBECHJOSERIZALDONFRANCISCOWho opposed the idea of sending Rizal to the UST?Who returned to Lipa and later married Manuel Luz?Who was Rizal’s favorite mentor and lifelong friend?Who is the author of José Rizal’s first favorite novel?Who was the school registrar who refused to admit Rizal?...

Disease, Illegal Drugs, Medicine 2025-12-09

30 Items: Not allowed by lawChemical substancesScarring of the liverDrugs prohibited by lawSingle-celled organismsTaking too much of a drugThe consumption of a drugTiny germ that reproducesA dependence on a substanceProtection against a diseaseA strong feeling of happinessYellowing of the skin and eyesA mental state of extreme fear,...

Mothers Day 2026 2026-05-06

32 Items: DulcieO? (3)LeanneGeorge (6)Iatric (6)Gary.....(6)Is now 93 (6)And Goliath (5)Two of them. (7)Postcode 3751 (6)Cytase anagram (6)Favour or Grace (4)Evergreen Shrub (7)Green and Yellow (5)Cross, Musician (11)Latin word "gaudere" (5)First and second name (7)Not personas but close (7)Scrooge McDuck's sister (7)And who else could this be? (5)...

26년 모의고사 30, 31 2026-06-26

21 Items: relating to the Middle Agesconsent to receive or undertakenot valued or appreciated highly enoughexceptionally good or clearly noticeablechange the position direction or focus ofmake partial or minor changes to somethingfeaturing new methods advanced and originalquick to detect or respond to slight changes...

BAGEL WORD SEARCH 2025-04-18

16 Items: commonly spread on bagelsanother word for cream cheeseanything that can make baked goods risehome of the America's most famous bagelsorganism responsible for making bread risewhat microorganisms eat to produce leaveningthe molecule responsible for chewiness in breadorganism responsible for tart flavor of sourdough...

C3 Revision 2025-10-01

16 Items: Test for hydrogen gasTest for carbon dioxideThe rows in the periodic tableSpeeds up the rate of a reactionThe columns in the periodic tableMade by reacting metal and oxygenSubstance made of only one type of atomGas produced when a metal reacts with acidsalt produced when hydrochloric acid is usedThe side of the period table containing metals...

Astronomy Word Search 2026-03-30

16 Items: Put a ring on it.The name of our sun.This planet is sideways.Lost its planet privileges.Stars are never this color.The third rock from the sun!The closest planet to the sun.Named for the Roman God of War.This type of star is very dense.This kind of star is very large.Now the furthest planet from the sun....

Vocabulary - Chapter 7 2023-03-13

21 Items: revokeTo make known.The act of choosing; choice.Formal evidence of ownership.The right of ownership to goods.A guarantee of quality imposed by law.Exercising the most influence or control.The responsibility for loss or damage to goods.Conforming to one principle, standard, or rule; consistent....

Living Systems Investigation 1 & 2 2025-04-21

24 Items: All of the water on Earth.Anything that takes up spaceA collection of interacting parts.To use again or continue a process.The rock and mineral part of Earth.A mixture of decayed organic matter.An organism that makes its own food.The layer of gases surrounding Earth.A reddish-brown worm found in decaying material....

The Final Tracklist 2024-07-12

16 Items: Harm506-aloneof meaddict!eclipsewith LaufeyOf The PartyComing Back!It Just Be Us?twothousandnineKids Are Not Finea Memory with AVONTHE CREDITS with Phoebe Bridgesor Die with davd and beabadoobeeHunter & The Ghosts of Murdered Snakes

2B 2024-11-14

14 Items: ofmytheyourin/onbehindwhere?it's aon top ofUnderneathin front ofWhat is the?unas some,a fewthere is,there are

2B 2024-11-14

14 Items: ofmytheyourin/onbehindwhere?it's aon top ofUnderneathin front ofWhat is the?unas some,a fewthere is,there are

2B 2024-11-14

14 Items: ofmytheyourin/onbehindwhere?it's aon top ofUnderneathin front ofWhat is the?unas some,a fewthere is,there are

2B 2024-11-14

14 Items: ofmytheyourin/onbehindwhere?it's aon top ofUnderneathin front ofWhat is the?unas some,a fewthere is,there are

2B 2024-11-14

14 Items: ofmytheyourin/onbehindwhere?it's aon top ofUnderneathin front ofWhat is the?unas some,a fewthere is,there are

Cycle 1 Vocabulary Week 12 2024-12-04

13 Items: when two angles add up to 90 degreestwo angles that add up to 180 degreesthe SI base unit of thermodynamic temperaturepart of a line that is bounded by two distinct end pointsa particular attitude toward or way of regarding somethingthe action of representing oneself or one's views or interests...

Provider Referral Word Search 2024-03-28

30 Items: 2. __________3. ______________4. ____________ of times referred.2. Language other than ___________California state animal is a ______.2. (orthodontist, endodontist, etc.)3. ______________ for a given provider3. Unusual or exceptional ____________.The member is referred to this team for ________.These needs include things such as: 1._____________...

Marketing 2026-04-23

22 Items: The final user of a product.Selling the same product to the whole market.Dividing consumers in the market by geographic area.Developing products for a small segment of the market.Markets for goods and services bought by the final consumer.Things we would like, but which are not necessary for our survival....

Marketing 2026-04-23

22 Items: The final user of a product.Selling the same product to the whole market.Dividing consumers in the market by geographic area.Developing products for a small segment of the market.Markets for goods and services bought by the final consumer.Things we would like, but which are not necessary for our survival....

Marketing 2026-04-23

22 Items: The final user of a product.Selling the same product to the whole market.Dividing consumers in the market by geographic area.Developing products for a small segment of the market.Markets for goods and services bought by the final consumer.Things we would like, but which are not necessary for our survival....

Marketing 2026-04-23

22 Items: The final user of a product.Selling the same product to the whole market.Dividing consumers in the market by geographic area.Developing products for a small segment of the market.Markets for goods and services bought by the final consumer.Things we would like, but which are not necessary for our survival....

Scientific Revolution 2025-03-19

10 Items: Center Starthe force between objectsCreated Heliocentric modelthe inventor of the telescopeA path around a celestial bodyStep one of the scientific methodcreator of the three laws of motionapproach to understanding the worldthe man who formulated planetary motionthe process of using mathmatical thinking

Nate 2026-04-21

10 Items: made religionRome blamed theFather Son Holy SpiritThe region of Jesus's birthCompleted a lot of propheciesWrote Seven letters to Asia MinerUnwilling to ______ multiple godsOne of the three characteristics of GodWon war after seeing a cross in the skyJesus spent two years of his life in _____

vocab 2024-10-30

31 Items: needlunchclassfirstthirdfifthsixthninthtenthtotalksecondfourtheighthenglishtoteachtostudyseventhyouneedartclasstechologytheclassofcalculatordictionarymathmathicstheschelulethehomeworkscienceclassspainishclasssocialstudiesthreeringbinderphysicaleducation

Spanish 1 2026-01-16

29 Items: artlunchclassfirstthirdthirdfifthsixthninthtenthsecondfourtheighthspanishscienceenglishto talkseventh...classschedulehomeworkto teachto studycalculatormathematicssocial studiesits the... hourphysical educationtechnology/computers

4th Grade 2026-04-23

60 Items: IanCamAvaBKlioAriaAvaEPaulPackGraceAlanaDerekHazelBelenWillaMarioSofiaAliceEmilyAnahiWendyBetsyBellaLinusWyattElisePatonDavisAngelyAuroraCamilaRobertCooperAndreyAdrianStivenManuelTamaraVioletFourthHarmonyMatthewBrookeBJiselleZanilahBrookeMRebeccaWolfpitMonahanNorwalkAddisonLSapphireCarolineJonathanAddisonCIsabellaSkarlettMitchellMichelleCharlotte...

First Aid 2025-04-17

54 Items: beneath the top layer of skinHeavy, uncontrollable bleedingA wound that is torn and raggedNot serious; on the surface;shallowDamp,soft,sticky, and unusually coolarrest The sudden stoppage of the heartA snug bandage used to control bleedingAn anti toxin used to counter act venomOintment and bandages applied to a wound...

Our Universe 2024-12-13

18 Items: Where Nuclear Fusion beginsWhere stars are first formedWhat galaxies are classified by90% of all stars are in this stageAt the top middle/right of an HR DiagramOval shaped galaxy with mostly old starsExtremely bright explosion of a high mass starThe absolute last stage of an average mass starUnit of measurement for long distances in space...

Nyctophobia Word Search 2026-01-04

19 Items: The goddess of nightThe opposite of darkWhere death road is locatedPhobia name for Fear of the darkThe way trees look in the winterYour prikily spikey plant friend!What might be haunting your house.The spooky holiday. Trick or treat!Monster blood. Usually green in movies.Last name of a famous horror author from maine....

GEP 9B Emotions 2025-10-07

11 Items: DownGuttedShockedThrilledDelightedHorrifiedDevastatedGobsmackedOverwhelmedThe feeling of being confusedThe feeling of being very tired

Chapter 4 Vocabulary Terms 2023-10-24

35 Items: tortvenuearrestwarrantsearchesseizuresfriskingsubpoenacivil-lawprecedentpenal-coderegularityuniformitycontrabandconfessionpoliticallyspecificitycriminal-lawexonerationsstare-decisisprocedural-lawpenal-sanctionmere-suspicionprobable-causesubstantive-lawdouble-jeopardyexclusionary-ruledue-process-of-lawself-incriminationreasonable-suspicion...

ATSI WORD SEARCH 2025-11-07

35 Items: AOEAODWOWATSICAMXTONENAMEAINTSLANGEMAILSLANGPLEASESOURCEMANNERSEMPATHYTAGLINEADDRESSCLOSINGENGAGEDWINNERSATTITUDEGREETINGTHANKYOUSCRIPTINGKNOWLEDGECONFIDENCEPROPERHOLDCALLCONTROLTONEOFVOICEPHONENUMBERVERIFICATIONPERSONALIZATION(THE # OF SECONDS YOU ARE REQUIRED TO ANSWER)(THE # OF TIMES YOU ARE REQUIRED TO USE THE WORD PLEASE)...

ESL7 Quiz5 review 2025-12-19

14 Items: timetruefloorcheckgo offalsereturna seedout ofberriestroublecomplainstung by a beebitten by a dog

Progressive Era 2026-05-18

9 Items: Inventor of the AC powerOwner of the Standard OilA publicly traded companyCreator of Carnegie SteelTo pull out a elected official26th President of the United StatesA residential area outside of a cityA collection of businesses that create a monopolyA election that determines the candidate that runs for each party

World War I Word Search (1914) 2026-04-17

10 Items: Famous Fighter Pilot Ace of WW1Treaty signed at the end of the warLocation of the first use of Poison GasConsidered to be the Bloodiest Battle in the warGroup Responsible for the Archduke of Austria's assassinationNeutral Country at the Beginning of the War, before being invaded....

Learning Medical Terminology 2026-05-26

10 Items: Shortness of breath or difficulty breathing.A state of impaired, abnormal, or incomplete functioning.Surgical procedure to remove all or part of the urinary bladder.Relating to an abnormal collection of fluids or blood in the body.Bacterial infection of the skin causing redness, swelling, and pain....

2B 2024-11-14

14 Items: ofmytheyourin/onbehindwhere?it's aon top ofUnderneathin front ofWhat is the?unas some,a fewthere is,there are

2B 2024-11-14

14 Items: ofmytheyourin/onbehindwhere?it's aon top ofUnderneathin front ofWhat is the?unas some,a fewthere is,there are

2B 2024-11-14

14 Items: ofmytheyourin/onbehindwhere?it's aon top ofUnderneathin front ofWhat is the?unas some,a fewthere is,there are

Spanish Vocab 2025-11-18

31 Items: TombMaskArchSaltFoodAngelBibleSkullCrossAltarWaterFruitFlowersIncenseMarigoldSkeletonOfferingDead BreadSpirit GuidesFlower petalsDay of the deadCoffin or CasketPicture or PhotoVelas or CandelasWhimsical SkeletonCemetary/GraveyardDecorated Cut PaperMonarch ButterfliesDay of Little AngelsFace of Day of the DeadCalavera de Azúcar or Alfeñique

CARNAGE THURSDAY 2025-12-11

29 Items: KINKKINKHAHAFAFOKINKSHHHHATTACKCASPERSORORITYA$$HOLESSORORITYHAIR TOOLSAW MOVIERED LIQUIDBOOK TITLENOT GUILTYEND OF BOOKMENSO/MENSATYPE OF GENRESORORITY NAMEVALENTINES DAYHIGHER EDUCATIONOPPOSITE OF ALIVEHAPPENS AT PARTIESMALE SORORITY NAMEMAIN FMC HARLEYS CHARACTERSECOND FEMALE HARLEYS WOMANWHAT HARLEY TYPICALLY CHOOSES...

Revison word search 2023-11-20

17 Items: Extremly largeAlot of soldiersSide of the faceA man made riverA young male chickenExtremly clever or smartTo agree to marry someoneA movement of part of the bodyUsed for joining the ends of a beltTo make waste into reusable materialThe hundredth anniversary of a eventteAn imaginary creature that can breathe fire...

HELLP- syndrome. 2025-10-29

15 Items: The 'LE' in HELLP; includes AST and ALT.Clinical manifestations of the syndrome.The time period before labor and delivery.Gastrointestinal symptom often experienced.The definitive treatment for HELLP syndrome.Common symptom related to high blood pressure.The 'LP' in HELLP; a sign of impaired clotting.A severe potential complication of the syndrome....

LIPIDS ACTIVITY WORKSHEET 2025-10-21

10 Items: A lipid that is the precursor to all steroid hormonesA lipid that is the major structural component of all cell membranesA type of lipid composed of fatty acid esterified to a long chain of alcoholThe functional group that is found attached to the hydrophilic head of a phospholipid...

S.S.D. for weather 2023-05-15

15 Items: the amount of moisture in the airthe weight of the air pushing down on earthan instrument used for determining tempaturewhen a boundary between warm air and cold air stallsan instrument used for measuring atmospheric pressureuses the doppler effect to measure a target's velocityan instrument for measuring the quantity of precipitation...

Centers Word Search 2025-01-28

15 Items: CentersSame positionThe point where all 3 medians of a triangle meet.The point where all 3 altitudes of a triangle meet.Lines that intersect each other at exactly one pointTwo figures that have the same shape but different sizes.The point where all three angle bisectors of a triangle meet....

Vocab week of Feb 23 2026-02-20

9 Items: How much there is of something.The value of where a digit is in the number.A Metric measure of distance. Equal to 1,000 meters.The side opposite the right angle in a right-angled triangleThe operation that reverses the effect of another operation.A list of numbers that follow a certain sequence or pattern....