fourth of july Word Searches

Red Words as of 1.31.24 2024-10-30

21 Items: Iahetobyofisgodothesheforwashasseeandputhowyouhisfrom

cognitive explainations 2025-11-19

9 Items: What may HAB lead too?distortion A form of irrational thinkingWho conducted a study into moral developmentWhat may criminals do to justify their crimes?level What is the second level of moral development?level What stage of development are criminals likely to be?conventional level What is the third level of moral development?...

Marie Curie 2014-11-05

14 Items: ofnobelprizepariswinnerradiumx-raysphysicspoloniumchemistryradiationuniversitydiscoveriesradioactivity

Income Taxes 2025-01-07

18 Items: UnmarriedMoney that is not taxedEarnings that are taxableSingle but with dependentsMarried and filing togetherSpouse died within the filing yearMarried but filing different tax formsThe line of the tax schedule based on incomeTax that is based on a percentage of the amountThe percentage increases as the amount increases...

Physics chapter 4 2025-11-03

18 Items: F=maBalanceA push or pullstays at rest until acted uponThe force acting per unit massthe force of gravity on an objectThe support force acting on an objectThe sum of all forces acting on an objectThe state of being without detectable weightA group of parts that work together as a wholethe greatest velocity a falling object reaches...

U3 VOC 1-15 2025-04-01

15 Items: mayshopwantelsewhichlaterclerkjuicetreatflowercoffeecoursethirstypaintinganything

Bible Memory Verse 2016-08-19

12 Items: I8amof12thethesaidJohnJesuslightworld

Super Words 2023-09-15

11 Items: dooftotheseeyouherthattheywhattheir

2 letter 2024-02-15

11 Items: begoismemyofonsotoupwe

The Word Search 2024-02-26

11 Items: toonofgonotheseeputforofffrom

You Word Search 2025-03-21

11 Items: AIToOfItOnYouAndTheWasHave

Sight Word Search 2025-10-22

11 Items: itisofhetomyfortheshehisone

TURKS AND CAICOS 2025-04-30

14 Items: smallest inhabited islandcoconuts grow in these treesvolleyball in Castaways movieanimal that roams around Grand Turksmall barrel cactus on the nation's flagworld famous beach on north side of Provotropical trees that grow in coastal watersCapital city of the Turks and Caicos IslandsAtlantic Bottlenose dolphin that loves to play...

Flu Vaccine Word Search 2025-10-03

12 Items: A symptom of the fluThe goal of vaccinesExtra dose of the original vaccineA month people tend to get vaccinatedThe method of administering a vaccineA shot that contains a killed flu virusA type of germs that vaccines can preventThe bodies ability to fight off infectionsProteins produced by the immune system to fight infection...

Chapter 17 Part 1 2023-08-21

18 Items: A business of a single owner (two words)The nonmonetary exchange of goods or servicesExpenses that reduce taxable income (two words)Expenses incurred before a business opens (two words)a mixture of partnerships and corporations (three words)Annual taxes owed on personal and business income (two words)...

Sight Words 2022-12-01

21 Items: byofforhasaregetrunwassitcanyouseewillgirltheylookplaylikethisfindcome

DAILY PUZZLE 3.7.25 NATIONAL CEREAL DAY 2025-03-06

21 Items: OfdrymilkoatsbrancornPostbowlLuckyHoneyMillsspooncerealflakesRaisinCharmsBunchesGeneralCheeriosKelloggsbreakfast

Birthday Surprise 2025-09-04

22 Items: aiWeatoforareandyouyouboatyourloveMarshCreeksunsetdeciderentinggettingtakeoutsunrisechoosing

Sight Word For Kindergarten 2025-09-13

21 Items: Iaofattoishewemearethemayforsheseethatlikehavemakewithlook

Snap Words 2025-12-11

21 Items: ifoforbigeatnotnowoutputcamehomehaveintomakemorereadtakesameyourthreelittle

Wordsearch 3 2026-01-15

21 Items: ofdobyohoffitsnowtooI'msawsaidcomeweremadecameheretheredon'taboutlittlechildren

Hull Word Search 2025-07-01

26 Items: Born in HullHad a Bass voiceHis wife was PatWorked in the AdmiraltyWent to Balliol at OxfordSquire, his daughter KateWent to school in LongdeneSupported Nottingham ForestWas Vice Chair of Age ConcernSkipper, his daughter EleanorUsed to sing in the LSO chorusWas Chair of Fishguard FestivalFluffy, the cat who adopted his lap...

Cluster 1 Lesson 1-5 Vocabulary 2024-01-17

16 Items: The importance of something to the matter at handHow people interact with their regions physical geographyA region's temperature and weather conditions over a long periodFinding a place using other places or features around it as a guideSurface features (such as mountains and valleys) in an area of land....

EMD Word Search Part 5 2025-12-02

6 Items: Type of Person Found on Card 26Type of Trauma Found on Card 27Type of Injury Found on Card 30Type of Problem Found on Card 25Type of Problem Found on Card 28Type of Incident Found on Card 29

HOW LONG DOES IT TAKE? - Verbs & Phrasal Verbs 2016-09-11

14 Items: upupofsetoffendrunoutoutouttakepicklookwatch

Bible Memory Verse 2016-08-19

12 Items: I8amof12thethesaidJohnJesuslightworld

Bible Memory Verse 2016-08-25

12 Items: I8amof12thethesaidJohnJesuslightworld

Water Quality 2025-11-18

14 Items: The Earth system that comprises all the water.The relationship between the hydrosphere and humans.These nutrients contribute to nutrient pollution in water.The safety and suitability of water supplies for human use and consumption.Processes that are required for the good health of humans and the environment....

Music Memory 2024-04-29

10 Items: GrilloSalutede lunefrom SupermanIrae from Requiemfrom Sleeping Beautyto Act 3” from Lohengrinfrom Orchestral Suite No. 2from Carnival of the AnimalsArrival of the Queen of Sheba Solomon

Exam Review Word Search - Chaps 5&7 2025-01-17

11 Items: Change in momentumThe amount of force per unit areaspeed Peak acceleration when fallingTwo values change in opposite directionsSecond Law Acceleration ~ net force/massvelocity Peak acceleration when falling with directionResistance Friction Acting on something moving through aircollisions Whenever two objects become tangled or couple together...

Unit 5 10 word Vocabulary word search 2025-02-24

10 Items: sodio(salt levelgripe (short for influenzasaludable (in good health.fresco (when something is freshactivo (when a person is doing somethingmetas( something you set in hopes of become a better version of yourselfDatos (facts that are collected,analyzed,and utilized in various contexts...

Prayer Word Search 2025-04-30

10 Items: – A prayer calling down God's favor.– Trust in God and belief in His promises.– A posture that opens the heart to hear God.– The inspired Word of God used often in prayer.– To make holy through God's presence and action.– A word of affirmation meaning “so be it” or “truly.”– Personal acts of prayer and piety outside of liturgy....

Leo Lens - December 2025-12-31

10 Items: The collective term for newspapers and news mediaThe process of producing multiple copies of the paperA paid notice used to fund the newspaper's productionA title often used for official journals or newspapersA journalist who reports from a specific remote locationThe activity of gathering, creating, and presenting news...

Identifying Abuse 2025-04-01

10 Items: excessive or unjustified use of a drug.reducing the risk of future harm for DV patients.type of violence that patients above the age of 65.signs of bruising, cutes, burn marks, and swelling.failing to provide adequate care or support to a individual.identifying signs of abuse in patients upon initial encounter....

Classification Word Search 2026-01-09

8 Items: Organisms w/o a nucleus.The name of “our” domain.Science of naming or classification.The “Father” of the science of naming.Kingdom known as containing decomposers.Another way to refer to a scientific name.Kingdom where cells have walls made of cellulose.Scientist who first separated organisms into 2 groups (plants & animals).

Science Review Word Search 2023-03-02

17 Items: F=MxAspeeding upslowing downa push or a pullfirst lunar phasethe unit for forcethe unit for energythe amount of speedthe earth orbits the...the power house of the cellwhat you can use to see cellswhat holds the slide in placethe direction the earth orbitshow many lunar phases are therethe color of the moon during a lunar eclipse...

Word Search! 2024-03-28

15 Items: You drive thisOpens and closesYou sleep on thisWe use them to seeIt's white and coldIt's bright and hotAn animal that flysYou can eat this thingThe teacher of the classYou put them on your feetThe first day of the weekdayAn animal that's black and white70% of our bodies are made up of thisYou carry this to school on your back...

Baptism Word Search 2023-11-10

8 Items: oil used during baptismthat can not be removedword meaning "to plunge"of Christian Initiation for adultsperson who is preparing to receive all of the sacraments of Initiationtransparent liquid poured over the infants head during the process of baptismnewly received into the church through the sacraments of initiation at the Easter Vigil...

Revolutions Word Search 2025-09-19

11 Items: the state of being freeFreedom from being ruledPeople from Britain (England)A king or queen rules the countrypeople who moved from Europe to live in AmericaWashington The first President of the United StatesA prison in France stormed during the French RevolutionPeople fight against unfair rulers, sparking a big change...

Alcohol Vocabulary 2024-12-18

20 Items: E-cigarettesWhen you stop smokingEnlarged stuffy lungsA toxic oily substanceAn electronic cigaretteA smoldering end of a productA type of e-cigarette companyRaises nervous levels severelyCauses cancer in living tissueTobacco that hasn't been burnedWhite patches on a mucous membraneWhen people exhale smoke out of it...

Word Search 2026-01-25

8 Items: A tight hugThe non-gang memberMy nickname for youThe "Blank" to my podThe leader of the gangMy 2nd nickname for youThe chief of staff of the gangThe coordinator of birthdays & celebrations

27 2025-08-17

15 Items: Lesser crime.Taken into custody.Short-term detentionFound guilty in court.Long-term jail facility.Punishment ordered by court.Organized set of riders traveling togetherEmblem showing affiliation with a motorcycle clubMetal container for fuel or oil carried on long ridesMeeting place for a specific branch of a motorcycle club...

ROCKS! 2026-01-07

7 Items: this type of melted rock is found inside the Earth.a type of rock formed by compacted and cemented sedimenta type of rock formed directly from cooled magma or lava.this type of melted rock is found on the outside of the Earth.this type of crust, or tectonic plate,is found beneath the ocean!...

Hurricane Word Search 2025-02-11

10 Items: The sound produced by lightning during a stormA severe snowstorm with strong winds and low visibilityA large, powerful storm with strong winds and heavy rainA visible mass of condensed water vapor in the atmosphereA sudden shaking of the ground caused by tectonic movementsA flash of light caused by an electrical discharge in the atmosphere...

Variable Word Search 2025-10-08

15 Items: The opposite of that operationA term the number stays the sameThe process of finding the variableWhen there's only one step to solveWhen there's only two step to solveA letter that represents a unknown numberThe final number that makes the equation trueA the number that is multiplied by the variablesign The sign that means two expressions are equal...

The Ultima’s Awakening 2025-02-01

18 Items: OfTheTheLaraLyraLolaNicoWomenTaaviLycanErikaKeeperDeWolfArianneWebiMayProtectorFrostclawHawthorne

Personal Finance 2025-11-17

18 Items: lifebillclaimcopaypoketcheckpolicylimitspremiuminsuredliabilitycollisioninsuranceinsurancedeductiblebeneficiarycomprehesiveunderinsured

Dien Wedding 2025-05-11

53 Items: VowJulyDogsRingBlueMarchBeachMusicPizzaHingeIdahoBrideGroomReggieFamilyComedyTravelTriviaAuburnBourbonFlowersForeverCookingRunClubFirepitHammockWalkingGoBuffsFloridaArizonaSanDiegoHolyCityMiniGolfKentuckyExerciseProposalConcertsMarriageCrutchesLineDanceNewlywedsGameNightShareHouseCharlestonPickleballVolleyballWindjammerRiverTowneTavernTable...

Spelling Word Search 1.5 2025-10-23

15 Items: a line of poetry or a section of a songto ride on ocean waves using a surfboardserious and strict in manner or appearanceto go back to a place or give something backto say something suddenly and without thinkingto twist or move around in an uncomfortable wayan exam given in the middle of a school term or semester...

Final Review 2025-11-21

15 Items: Economic system developed by Adam Smith.French estate that was made up of the clergy.Who gained independence through a slave revolt?What country became unified under Otto von Bismarck?What was the result of all Latin American revolutions?What is another word for peasant in the feudalism system?...

Circulation Search By: Zena.K and Jana.J 2025-12-05

15 Items: What organ pumps blood throughout the body?What receives blood from the right ventricle?What receives blood from head and upper limbs?What receives blood from the trunk and lower limbs?Which type of blood vessel carries blood away from the heart?Which type of blood vessel carries blood back toward the heart?...

Political vocab 2024-12-10

22 Items: States that consist of multiple nationsA group of people with a common identityExtending a country’s influence by forceA State that mostly consists of one nationNation that is spread out among multiple statesA nation that does not have a state for themselveschanging voting districts to favor one party over another....

Word Search Feb. 5, 2024 2024-02-06

17 Items: a co-workerat the same timea very tall buildingto mix up or confusean emotion or feelinga long, difficult walkto make bigger or betterto encircle on all sidesone of the last of its kindable to be eaten; good-tastingpractical or applying to real lifea basic characteristic or substanceto move back and forth in a jagged line...

Books of the Bible  2020-08-04

21 Items: ofSongJoelAmosHoseaJonahMicahNahumIsaiahDanielHaggaiSolomonEzekielObadiahMalachiJeremiahHabakkukZephaniahZechariahEcclesiastesLamentations

Gigi 2021-02-04

23 Items: ofbugbutbabybadabingbadaboombestbingbandbellabotherbackupbubblebiscetsbrotherbalencebaboonsbagloniebackbonebunblingballareina

Day of the dead 2024-05-02

20 Items: ofdaythediedeadlossdaysfoodcolourmexicanholidayflowersfestivalskeletonancestorsrelativescelebratebutterflycelebratingtraditional

Heart Words Word Search 2025-05-23

21 Items: myheweohsonogotodooftheshewassaydayaretooforseeplayplays

I like cheese 2025-08-14

23 Items: IISoMyOFNahTheLikeMuchThatBodyIntoIntoJustTurnIntoTurnsCheeseMASTERKiddingActuallyCheez-itsCHEESE!!!!!!!!

word search 2 2026-01-08

21 Items: ofdobyohoffitsnowtooI'msawsaidcomeweremadecameheretheredon'taboutlittlechildren

09 2025-08-16

15 Items: This term refers to a car.A very long motorcycle journeyA short ride taken in a single dayTraveling long distances by motorcycleLifestyle of riding cruiser motorcyclesThe culture and passion for riding bikesA planned trip covering multiple destinationsTo ride a motorcycle aggressively or intenselyFeeling of liberation while riding a motorcycle...

Musicals 2022-05-26

27 Items: MIAWIZFAIRrentannieevitaOF OZgreasechicagoPOPPINScamelotoklahomaOF MUSICcarouselMUSIC MANTHE WOODSLION KINGseussicalhairsprayFAIR LADYCHRISTMASKING AND ISIDE STORYMISERABLESBYE BIRDIEIN THE RAINME IN ST LOUIS

Auténtico 2B 2023-04-19

23 Items: ofmyflagdeskdoorhereyourmouseclocktablechairtherein/onposterscreenwindowWhere?computerbackpackkeyboardtrash canon top ofpencil sharpener

Festivals 2025-04-23

27 Items: DiwaliEkadashiAnnakutaNandotsavaGopashtamiVyasa-PujaJanmashtamiRatha-YatraRadhashtamiSnana-YatraRama-NavamiKirtan-MelaJhulan-YatraGita-JayantiGaura-PurnimaKartika-VrataTulasi-VivahaGauranga-MelaGovardhan-PujaVamana-DvadasiPavitra-EkadasiAkshaya-TritiyaBalarama-PurnimaFestival-of-IndiaNrsimha-CaturdashiPanihati-Chida-DahiFestival-of-Inspiration

Insurance Claim 2026-01-28

29 Items: SOLOffPayDraftCheckPacketStatusRepairEscrowPlacedProctorCompanyReleaseIn FullCurrentof LienInvoiceReissueProposalDocumentsAffidavitDelinquentof ForgeryProcessingInspectionEndorsementDepreciationSupplementalAdjuster Report

On Every Street - July 11th to August 8th, 2021 2025-06-30

34 Items: AlinFordAldonFelixKnorrMoyerQuailSumacAlmondBensonDaltonEuclidEugeneHooverKrieseSchellTartanAllStarAlsgardMayfairPearsonSalernoSanbornWallaceAltaDenaBrindisiJosselynKeithleyPinetreeQuailRunVolterraDalgleishPattersonValentino

Ateez In Your Fantasy - Wrigley Field, July 26 2025 2025-07-21

35 Items: sanworkateezatinyyunhomingijonghoanswerdejavubouncyyeosanghalaziaseonghwawooyounghalahalaillusionhetmongisandeokihongjoonginceptionfireworksguerrillacrazyformlemondroptyudeongijjongbearpiratekingwonderlandturbulencejjoongramibbyongmingwooyonyangiceonmyteethddeongbyeoliinyourfantasy

Summer of the Mariposas Chapters 1-7 2025-10-15

15 Items: Mother to InesNumber of sistersLeader and narratorOdilia's magical itemThe baby of the familyThe dead man's first nameSpanish for "butterflies"State where the girls liveMama's job is a __________Country the sisters travel toMythical creature guiding the girlsAnimal that symbolizes transformationFavorite game played by the Garza family...

The Great Depression 2022-10-31

10 Items: When you owe moneyThe collapse of world tradeWhere people store their moneyWhen people didn’t have a job, they were ———One of the most depressing moments in historyWhen people didn’t have a home, they were ———Many people lost many —— during the Great DepressionMany workers lost lots of ——— during the Great Depression...

Lipids Word Search 2023-08-14

10 Items: Source of energy, including sugars and starches.Fats and oils that store energy in living organisms.Short chain of amino acids, a component of proteins.Large molecules made by linking smaller repeating units.Breaking down molecules with water, often for digestion.Small molecule that can link together to form a polymer....

The Memory Vault 2025-02-10

10 Items: Testing improves learning and memoryEffortful memory, including facts and experiencesEncoding is more effective when it is spread over timeProcessing of information outside of conscious awarenessAutomatic memory, including procedures, skills, and habitsProcess of holding information in the mind and working on it...

UOI 4 - W1 2026-01-12

10 Items: The very hot centre of the EarthThe hard outer layer of the EarthOn the inside or closer to the centreThe outside or top layer of somethingOn the outside or furthest from the centreLines or edges that separate different areas or partsThe way something is built, organised, or put togetherOne level or sheet of material placed over or under another...

Word Search 2024-07-06

10 Items: Who was the last Viceroy of British India?Who wrote the book “The Discovery of India''What is the universal symbol for friendship?Which Indian leader is known as the “Father of the Nation”?Which movie features the friendship of a lion cub and a warthog?Who is one of Harrys best friends in the famous Harry Potter series?...

Lesson 1: He Is Smart 2023-01-16

15 Items: shybadboygoodlazygirldonemovebravesmartworrycoursenaughtyhonestyamazing

history word search 2024-10-08

15 Items: signed by henry viiicreated the mona lisaLed to the reformationcreated by John CalvinRediscovery of old ideascalvin created calvinismprotestant who was excommunicatedpainted the sistine chapel ceilingking of England that took office in 1509religious war between Roman Catholic and Germanyaccusing people of witchcraft based on stereotypes...

🌍 Global Trade Word Search 2025-02-03

15 Items: A tax on imported goodsGoods sold to other countriesThe exchange of goods and servicesGoods purchased from other countriesProvides loans to developing nationsThe money used in a particular countryInternational trade without restrictionsThe desire and ability to purchase goodsThe total amount of a good available for sale...

40 2025-08-17

15 Items: Symbol of lone riders.Patriotic biker symbol.Military-style biker emblem.Symbol of danger or betrayal.Common motorcycle paint design.A weekend spent on long road ridesA week dedicated to club events and ridesThe annual cycle of motorcycle club eventsA weekend retreat or event for club membersA special day celebrated by motorcycle clubs...

Charlie's Silent Consonants 2025-11-06

15 Items: owning moneya part of your handsome people can ... housesstaying upset with somebodywhen you give someone a tasksome people have a lot of ...the opposite of a row is a ...another word for 50% full is ...you must ... a question in a quizanother word for person in a moviethere is always a lot of ... at recessyou get ... when in water for too long...

Here Comes The Bride 2 Word Search 2017-06-23

24 Items: ofmanyoubestcakemaidtearstoastthankcardsdressshowerhonourfamilyfriendsweddingweddingtuxedosdressesweddingplannerweddingpreacherspeeches

Sight Words 2022-03-27

22 Items: Iingoonisofmymeandtheboyoffhasareboyyougirlwhatherehavelikedown

Sight Words 2022-12-01

21 Items: byofforhasaregetrunwassitcanyouseewillgirltheylookplaylikethisfindcome

Galatians 5:22-23 2025-01-09

24 Items: ofisisbutthethejoyandthelawnotlovesuchfruitpeacespiritthingsagainstpatiencekindnessgoodnessgentlenessselfcontrolfaithfulness

Week 5 spellings 2025-03-28

21 Items: ofbyoffbuywaitwriterightoccurweightmeasureleisurepersuadelanguageexplosioninterfereinterruptlightningparliamentmarvellousopportunitymischievous

4th Quarter Practice Words 2025-04-30

21 Items: ofmefortoohaswhohavetheysaidwantherethiswhathelpplaylookgoodcomedoeswherethere

Delaware Township Trivia 2025-01-26

13 Items: Vocke--- Tea Table--- Farm Park--- race crate--- Stone ChurchMajor industry in DTSergeantsville radio stationProduct sold by local farmersFormer name of Sergeantsville--- Sergeant's Covered BridgeTV journalist who lived in DTHistorical use of Township buildingNumber of people on Township Committee

The Wedding Wordsearch 2025-04-16

13 Items: The best manAnniversary monthThe maid of honourFavourite takeawayStephen's professionHoneymoon destinationLocation of the churchBride's favourite drinkGroom's favourite drinkColour of the bride's dressThe couple's favourite drinkThe place where the couple got engagedThe couple's favourite holiday destination

Infection Control Word Search 2024-08-02

15 Items: An example of a fungi is?A living carrier of transmission.Protozoan parasites cause what disease?What is the first step when donning PPE?A vehicle (non-living carrier) of transmission.Airborne precautions are used for which pathogen.A microorganism that causes infection and disease.Contact Plus precautions are used for what Disease?...

Cestodes & Trematodes 2025-02-21

15 Items: Tapeworm found in cats, using rodents as IH.Giant liver fluke affecting deer and cattle.Canine tapeworm transmitted through rabbits.Broad fish tapeworm found in freshwater fish.Equine tapeworm that affects the ileocecal junction.Lung fluke of dogs and cats, found in North America.Fluke known as the "lizard poisoning fluke" in cats....

Technical words - 5 2025-06-20

15 Items: The font style, size, and spacingThe colors chosen for the websiteA layout based on rows and columnsThe overall style and look of a siteThe arrangement of elements on a pageA menu that expands when you hover or clickEmpty space used for readability and designThe service that stores your website onlineLayout that adapts to different screen sizes...

Bible Memory Verse  2016-08-25

12 Items: I8amof12thethesaidJohnJesuslightworld

games 2017-11-29

12 Items: ofofgamepreyevilcalldutyzerodawnthroneshorizonresident

M100W Golden Words 2020-06-09

12 Items: IABEITINISTOOFANDTHETHETHAT

PSALM 147:4 2025-01-10

14 Items: Heofhetoofthetheallthemstarsgivesnamescountsnumber

Spelling words 2025-02-05

11 Items: ofspotcametakecakemakemadegavespellstillfebruary

Alex's Trick Words 2025-04-28

11 Items: asofbyhasarelooksaidwanttheylovelike

League Word Search 2025-07-02

11 Items: OfKingCroreLeagueMagnusOverallLiquidsLegendsThousandAchievementProductivity

Trick words/vocabulary words 2025-09-11

11 Items: isoftheandhismaplitjobfixquitSeptemeber

For all have sinned and come short of the glory of God. Romans 3:23 2025-10-17

12 Items: ofofForallandtheGodhavecomeshortglorysinned

Sight Words 2026-02-10

11 Items: itofintooncatdogandtheforthat

Branding Wordsearch 2025-10-24

14 Items: funnestest class LOLtry-hard funny not so funnywonk wonk wonk classroom funnyrelationship with a distribution partnerconsumer’s commitment to continue using a brandme cant wait to go home and i bet you too classsomeone who is interested, involved and engaged in the eventpractice of using a successful brand name to launch a new or modified product...