fourth of july Word Searches

Firstaid Word Search 2025-04-17

18 Items: - Heavy, uncontrollable bleeding- The sudden stoppage of the heart- Damp, soft, sticky, and unusually cool- A snug bandage used to control bleeding- ointment and bandages applied to the wound- A reduction of blood flow to a part of the brain- Approval for what is to be done or proposed by another...

Five Oceans Word Search 2024-08-29

13 Items: Triangular shaped oceanLargest of the five oceansDeepest point in the oceanSmallest of the five oceansThe Titanic sank in this oceanWas recognized as an ocean in 2000Warm vents formed in volcanic areasHeavy rainstorms that happen in South AsiaThick layer of fat that keeps mammals warmLarge chunk of ice that broke off a glacier...

Victoria & Cory 2025-02-07

24 Items: Who is loudestWho is funnierCory's eye colorTheir dog's nameCory's alma materCory's middle nameWhat Cory collectsVictoria's eye colorCity they got engagedVictoria's alma materVictoria's middle nameTheir favorite TV showCory's favorite animalWho is a better driverWho wins all board gamesRestaurant of first dateAstrological sign of both...

NFL 2025-11-30

29 Items: Won the Super Bowl XXTied for most Super Bowls won (8)Won four Super Bowls in six yearsWon two Super Bowls in one decadeWon four Super Bowls, two with Eli Manning as MVPThey won their only Super Bowl appearance against the ColtsThe first team in history to win a Super Bowl after being 0-2...

Berko Carnegie Wordsearch 2024 2024-04-17

7 Items: The number of shadowers in TeamBerkoThe colour in the title of the 2023 winnerTeamBerko (The name of our school shadowing group)First name of the author of the book 'Door of No Return'Name of the title character in the book by Hiba Noor KhanThe country which is the setting for the book 'Song Walker' by Zillah Bethell...

Phospholipids Word Search 2025-01-27

36 Items: What is a term for “water-loving”?What is a term for “water-hating”?What does passive transport not require?How do phospholipids arrange in cell membranes?Is diffusion a spontaneous or nonspontaneous process?Membrane protein that spans across the lipid bilayer.What is the most abundant lipid in cellular membranes?...

Key Terms-Topic 9 2024-05-22

15 Items: exclusive control by one company over an entire industry1886 labor-related protest in Chicago which ended in deadly violence1890 law banning any trust that restrained interstate trade or commercesociety in which people of different nationalities assimilate to form one culture...

The basics + numbers 0-31 + calendar 2026-01-30

17 Items: 87-72=...The ninth monthThis word means "years"the first day of the weekThe first month of the yearThe amount of hours in a dayThe first day of the weekendthis season comes before "otoño"We use this word to say thousand in SpanishA way to greet someone after 12pm but before dinner timeAfter this number, all numbers up to 99 have three words...

Respiratory Word Search 2023-05-12

14 Items: Voice boxNo airflow#1 Instructor"Dang it _______"Difficulty swallowing#1 risk factor for COPDPH-7.25 PAC02-52 HCO3-24Measures the lungs air capacityInflammation of the pleural liningsPartial of complete collapse of the lungPosition you will typically see COPD patient in1st drug used for obstructive pulmonary diseases...

Carts, Ladders, & Pedestrians 2023-03-31

37 Items: flatFeetpushpullblueCartwireZonecanoeglassClimbLadderLadderstablebrokentuggerPickermutualof WaydriverorangeContactdamagedutilityContactwalkwaybracketspositiontransferspreadersoverreachcrosswalkof ServicepedestrianrestrictedCart Ladderintersection

Preposiciones 2025-09-28

20 Items: inherenearwiththerebelowmiddlecenterbehindinsidewithoutfar fromon, overtogetheron top ofbackroundDown,belowover therein front ofbetween, among

Golden Words 2014-03-19

12 Items: Iainisitoftobetheandwasthat

Unit 7 2014-10-27

12 Items: ofinwhysixbighowdidsitwillsomemakeanimals

I Hear America Singing 2017-04-21

13 Items: NoofNoWaltGrassLeavesRealismWhitmanFreeVerseHyperboleSynecdocheRepetitionAppreciative

sight words 1 2021-03-17

12 Items: ofonatandtheoffputwasdidallsaidyour

Judah's Word Search 2022-11-03

12 Items: ofdoshyshethisthatthenwithshadesheepbrushfresh

Didn'T Word Search 2024-10-18

12 Items: ofeatoutsawfromgivegoodmakewerewhendon'tdidn't

Group C 2024-12-03

12 Items: ToInHeOfIsAtTheAndYouSheForThey

Word Search 2024-12-10

12 Items: OFONOUTHISCCCJACKWEEKTWENTYFINALSCANVASDESERVESASSIGNMENT

Sight words 2 2025-10-23

12 Items: doisoftheyouwaswhoarefromwhatweresaid

Grace's spelling word 2025-10-29

12 Items: ofwhomindtintpondwantholdfaintgiantparentmomentremind

The Word Search 2025-11-04

12 Items: aIbetoofinittheandforthathave

Spelling Words 2025-11-06

12 Items: ofdoshyshethisthatthenwithshadesheepbrushfresh

Our Word Search 2025-12-23

13 Items: MyOfOurFunGirlBoatHouseBaggyHouseNightCairoTrousersEmbarrassment

At Word Search 2026-02-11

12 Items: AtInofonuptobyoffoutfordownUnderneath

Competitors Companion Word Search - July week 4 2013-07-28

12 Items: HullEvertonSwanseaCardiffArsenalChelseaNorwichLiverpoolTottenhamNewcastleSunderlandSouthampton

MMIC Handling Training 2025-04-10

15 Items: A line around the border of a componentWhat type of pack does NOT get filler paper?What position should you open a waffle pack in?Another word for die. The more commonly heard word.Before _____ a waffle pack, gently tap on the top surfaceA vacuum chuck is used to remove die from what style gel pack?...

CoW and brain ventricles 2025-10-30

15 Items: Connects third and fourth ventriclesMidline cavity between the two thalamiLies between pons, medulla, and cerebellumConnects the two anterior cerebral arteriesSupplies occipital and inferior temporal lobesJoins to form basilar artery; supplies medullaSupplies lateral cortex (face and upper limb areas)...

Exponent  2018-05-29

13 Items: ofindexpowerrootsgraphordersquaredecimalExponentequationorderpairoperationexpression

Falling Word Search 2023-10-05

13 Items: isofupyougetandpartonlywhenkeepgoingfallinggrowing

N/A 2026-01-07

13 Items: ofnoseknowscoastgrandheartwheelenemytypingcenturypresentbeautifulmisfortune

Christian Iconography Word Search 2025-12-04

32 Items: IHSEyeDoveFireWindLilyGoatHaloCrossCrossAnchorof GodBranchChristChi-RhoIchthysPeacockBaptismTrumpetSerpentAureoleShamrockShepherdof Judahand WineTriquetraand OmegaPentagramMonstrancePomegranateFleur-de-LisBronzeSerpent

Badass Book Babes 2026-01-21

24 Items: mestopstopridegreyKarmaof sinto sinWantedlet goor dieHitchedmistakeretreathappensScorpionPhantasmCaptureddecisionsUnethicalof the huntstate linesmy obsessionfor the ride

Word Search 2026-02-02

25 Items: The making of productsColonial New York industryWrote the Albany Plan of UnionAnother colonial New York industryFirst British governor of the colonyReason French Huguenots came to New YorkLarge estates where most colonists livedCountry that won the French and Indian WarLargest trading center in colonial New York...

bible 2020-02-29

20 Items: OFGODTHEARKNOTMOSTHIGHDOVELAKEFIRETHOUMOSESJESUSSHALTCOVETISRAELPRAISEKINGDOMANIMALSBLESSING

Gulf of Mexico 2021-05-28

21 Items: ofofredseaGulfJessTexasHotubMexicoAlonsosnapperturtlesAlabamaFloridacurrentJeffreyDespairfounderAlwarezLouisianaMississippi

Article of Faith #3 2025-03-01

23 Items: WeofbebytooftheallmaytheandthethatlawssavedChristGospelbelievethroughmankindAtonementobedienceordinances

List 10-14 circle 2025-05-08

20 Items: onofbedoupbighiswasgotarenotlothadtenbutgoodveryherelookwant

DAILY PUZZLE 9.3.25 NATIONAL SKYSCRAPER DAY 2025-09-02

21 Items: OfOnetallParkBankTowerSpaceStateWorldTradeWillisNeedleEmpireCenterCenterSeattleCentralAmericaHancockbuildingsskyscraper

Kaki 2025-11-24

20 Items: asisofonearetwofromgoesknowbeendoeshavemanyNinaaboutagaincouldHunterbecauseHarrison

Climate and weather 2023-05-15

15 Items: a warm water currentmeasures the air pressurechange in moisture contentmeasures the speed of the windmeasures the direction of the blowing windthe weight of the air pushing down on earthlarge bodies of air that have uniform temperaturemeasures the amount of precipitation that has fallen...

Patriot Day Word Search 2025-09-10

30 Items: Which building was taller?(2 words)The 9/11 Memorial has _____ memorial pools.September 11 is known as a Day of _________.The 9/11 Memorial pools are ____ _____ deep.The name of the location struck on 9/11.(3 words)The city where the one non-military plane flew to on 9/11.The length of time the fires at Ground Zero burned.(2 words)...

Prefixes and Suffixes 1 2025-03-18

26 Items: onetwomanyfourafterthreeagainagainstwithoutfear oftogetherstudy ofnot, noneable to beunder, belowa person whoround, aroundamong, betweenwithin, insideacross, throughbad, wrong, illbefore, in advanceunder, below, lessover, beyond, highabove, beyond, overstate or quality of

Part 1 Review 2024-10-23

16 Items: POTUS airplaneMin. age of POTUSPOTUS military leaderCeremonial job of POTUSThis person cannot be firedType of citizenship requiredPresident elected four timesNumber of electoral votes neededAn informal qualification (talking)Started the two term limit traditionAmendment that deals with successionWhat officially elects the President....

er 5 2026-02-13

10 Items: free from germsextremely angryfeeling hopeless and gloomyan unpleasant mix of loud soundsa temporary substitute for somethingin a way that shows devotion to religiona building used to house large numbers of peoplethe return of an illness after a time of recuperationboxes or crates used for hauling fruits and vegetables...

Summer 2025-09-12

20 Items: julide zonreizenfietsenzwemmenaugustusde bijenkamperenhet ijsjehet zweethet strandde hangmatzonnebadende schaduwde barbecuede vakantiede lemonadehet zwembadde vakantiede zonnebrand

Vocab 2 2023-02-13

29 Items: pendaybookyearweekmonthtodayfolderpencilmondayfridaysundaytuesdaynotebooktomorrowthursdaysaturdayclassroomwednesdayits the ofmale studentmale teacherstudent deskfemale studentsheet of paperfemale teacherwhat is the dateits the first ofwhat day is today

1.01 1.02 1.03 vocabulary word search 2024-08-23

30 Items: backsidewallcelllifeslowhalfapartskullabovewatercheekheartbloodmiddlewateryaroundcuttingdistantstudy ofspecialistin front ofbeside;nearpertaining tobronchial tubebluish in colorpertaining to allabnormal conditionpertaining to the tailthe study of body structure

How Animals Communicate  2016-09-28

12 Items: ofinhowwhydidsitsixbigsomemakewillanimal

Puzzle #3 3rd-5th grade 2020-04-15

12 Items: DOOFFORHASPUTSHECOMEGOODGIVEHEREWITHCANNOT

Name: _______________________ Lesson 17 2023-02-16

12 Items: onofissobuthowfindthisfromcamemanywhere

Romans 10.17 2025-09-08

13 Items: ofSoandtheWordfromfaithcomesChristRomanshearingthroughhearing

Hebrews 11:1 2025-12-21

15 Items: isofofNowtheforthenotseenfaithhopedthingsthingsevidencesubstance

Secret code 2026-01-23

13 Items: aorofYouyouaresonthethatshouldFatherdaughtercelebrate

Identity 2026-02-03

8 Items: The largest race in Singapore.History shared by a group of people.The biggest religious group in Singapore.The Muslims worship their God at this place.Shared practices and traditions of a group of people.The group of people I live with who can shape my identity.A religion that has the belief that God can take on three forms....

Jenny & Aldo 2025-05-06

25 Items: Town we live inBride's hometownStreet we live onBride's birth monthFirst date locationBride's middle nameEngagement ring cutMonth Groom proposedLocation of proposalFavorite hockey teamHoneymoon destinationYoungest horse's nameBrand of Groom's truckNumber of fish at homeCouple's favorite sodaGroom's dream dog breedFirst vacation together...

Paige & Jonathan 2025-08-04

25 Items: Knox's hometownGroom's siblingsGroom's hometownBride's hometownBride's professionGroom's professionBride's middle nameGroom's middle nameCouple's dog's nameMaid of Honor's nameTown couple lives inGroom's birthday monthBride's college mascotBride's favorite colorBride's birthday monthGroom's favorite colorMonth Jonathan proposed...

"THE GIVER" Vocabulary 2024-10-31

20 Items: ObviousShining; BrightTo beg urgentlyDangers; HazardsNervous; AnxiousWeak or SluggishThorough; DetailedTo spread throughoutImportant; Well-knownTo trespass or violateCareless; without orderA warning; (verb) To warnA violation of a rule or lawA perfect/ideal place; ParadiseEssential; Absolutely necessaryA strong feeling of disappointment...

Grace and Ben’s River Voyages and Trivia 2025-08-26

30 Items: FinDIYHydeFishHGTVLovePearlDrumsCoralBanditForeverWeddingAquariumMichiganTinyhouseWisconsinNewlywedsThe Mother of the BrideThe Mother of the GroomThe Bride’s favorite foodThe Grooms favorite sportThe name of the tiny houseThe first state we moved toWhere was our last vacation?The Bride’s undergraduate Alma materThe city the newlyweds now call home...

Jenna & Blake 2025-09-03

22 Items: Brides middle nameGrooms middle nameGrooms go to drinkWhere the couple metBlakes favorite foodThe couple lives hereJennas favorite colorName of the couples dogBrides favorite dessertBrides favorite holidayHoliday Blake likes mostBrides high school sportMonth of their first dateBrides childhood nicknameBlakes dream vacation spot...

Ornithology Not-Test 3 (Community Ecology) 2025-04-28

19 Items: The role a species plays in the environmentDiversity in birds decreases with increasing ___An interspecific relationship in which both or all species benefitA ___ niche is the resources and conditions a species actually makes use ofA ___ niche is all the possible conditions an resources a species could make use of...

Cycle 1 S2 Week 3 2025-01-29

10 Items: classified as chemical or physicalA shortened restatement of a text or passageA list of numbers or objects in a special ordera measure of the force applied over a unit area.a word used to describe an action, state, or occurrenceThe unlawful, random use of force or violence against persons or their property...

breaking bad episode 4 2022-10-06

17 Items: -absorb or clear-slang for a hand job-slang for crystal meth-a dark granular mineral-cause (someone) to feel exhausted-the study and treatment of tumours-Cancer that forms in the glandular tissue-a main or large bolt in a central position-feeling or expressing overwhelming happiness-corresponding in size or degree; in proportion...

Meteorology 2023-03-08

27 Items: when liquid becomes a gaswhen gas turns into a liquidused to measure air pressurea tool to measure wind speedprotects earth from UV radiationa tool to measure wind directionmost common gas in our atmosphereozone at earth's surface is calledclouds that are flat and sheet likeof atmosphere where meteors burn uplayer which contains the ozone layer...

PR 1 spelling 1 2018-05-27

52 Items: IboycatdogeggjaronepensixtwozoobookdoorfivegirlJulykingkneeleftninerainwalkappleeighthouseheartmousequeenquietrightseventablevowelx-rayzebraAugustcastleFridaygroundIndianMondaypurpleviolinwindowyellowoctopusladybirdNovemberumbrellaxylophoneyesterdayuniversity

Random Words 2025-01-08

50 Items: WaneJulyArrayZenithZephyrStrifeAscentAuroraTenableLaggardMeanderFatefulSurfaceTensionBiologyNeuronsOctoberDynamicGravityTestifyEwigkeitAccurateDaughtryDecemberNovemberInsanityHaphazardSeraphinaEmancipateFlamboyantConsecratePropagandaExorbitantAssessmentChromebookExtcalithyCross-OverLighthouseCross-SoulUltrasoundOdoriferousChronometerIntermittent...

Common and proper nouns. 2025-09-23

50 Items: BoyManCarDogCatCowBedSunDayGirlParkCityRoomFishBirdBallBookFoodMoonStarJohnMaryYorkJulyWomanHouseHorseChairTableAppleWaterPeterSarahParisSpainChinaFamilyFriendSchoolPencilMexicoLondonMondaySundayEasterTuesdayJanuarySaturdayChristmasHalloween

Dias de la semana, meses y estacioes del año 2026-01-23

26 Items: May _______________monday _____________tuesday ____________Today ______________March ______________June _______________July _______________Fall _______________Friday ______________Saturday ____________Sunday ______________January _____________April _______________August ______________Wednesday ____________Thursday _____________...

Golden Words 2014-03-19

12 Items: Iainisitoftobetheandwasthat

U.S. Constitution Vocabulary Word Search  2015-01-10

12 Items: ofbillrightspreamblerepublicpetitionarticlesamendmentbicameraldemocracyfederalismconstititution

Word Search 2023-02-15

12 Items: atoftoinisithetheandcancatsit

Gold Words 2023-06-23

12 Items: iabeinisitoftoandthewasthat

October 8, 2023 2023-09-17

13 Items: ofatthethecostdeliwellcrossnightsundayprayerworshipdiscipleship

Sight Word Word Search 2024-04-24

12 Items: doofmeheseeareyouforthatlooktheywith

Article of Faith #8 2025-01-18

13 Items: WetobeofthetheGodwordalsoBookBibleMormonbelieve

m100 search 2025-05-22

13 Items: ofitisinwasandyouwhythatthatwhatwhenwhere

Wk. 2 2025-09-10

12 Items: ofherseeyouthechatwhattheyshopswhipstheirsunset

List 8 2025-09-29

12 Items: ofdoshyshethisthatthenwithshadesheepbrushfresh

Word Search - Week of Oct. 20 2025-10-18

12 Items: ofwenogetputeatseewhyhelpworkdoeslive

Cuff Word Search 2025-10-21

12 Items: ofyoucuffpuffwillwellbelldollstuffsniffcrossbless

Heart Word Hunt 2025-12-04

12 Items: todoofmebeheasistheseeandsaid

Cleaning/ Word Search 2022-11-01

20 Items: dispose of an itemhow well a product worksan item that cannot be reusedpotent disinfectant chemicalsa chemical used to whiten or sterilizethe process of removing dirt and debristhe process of killing all bacteria and microbesthe process that kills most bacteria and microbesan item that is able to be disinfected and reused...

Landforms & Bodies of Water 2024-11-26

20 Items: Florida for exampleLike the Hawaiian IslandsMaine sits along one of these featuresTampa Florida has one of these featuresThe Caribbean & Norwegian are two examplesShapleigh School sits atop of this featureAn area of wet land with grasses and few treesThe Urals, Carpathian and Alps are good examples...

Really? 2025-01-10

22 Items: What fruit is slightly radioactive?What is Cookie Monster's real name?What animal sleeps with one eye open?One in 18 people have this extra body part.What were chainsaws originally invented for?The speed of a computer mouse is measured in?What is the hashtag symbol technically called?What is the most shoplifted food in the world?...

Chapter 13 (Prichard) 2025-11-05

30 Items: Business risk-takerfaire Hands-off policybridge Cable-held roadwayInventor's exclusive rightEdison Light bulb inventorprocess Steel-making methodzone Standardized clock areatariff Import tax for home goodsproduction High-volume manufacturingPark Government-protected nature areaExclusive market control; total power....

Freedom Word Search 2026-02-02

25 Items: The making of productsColonial New York industryWrote the Albany Plan of UnionAnother colonial New York industryFirst British governor of the colonyReason French Huguenots came to New YorkLarge estates where most colonists livedCountry that won the French and Indian WarLargest trading center in colonial New York...

Persuasive Vocab 2025-01-29

12 Items: The reason behind the argumentA rhetorical appeal to logic and reasonThe choice of words used in an argumentAcknowledging a point made by the opposing sideA rhetorical appeal to the emotions of the audienceInformation, facts, examples, or data that support a claimThe logical explanation that connects the evidence to the claim...

Culture & Capitalism 2025-11-30

10 Items: A circle of evergreenThe holiday we just celebratedAfrican American winter holidayA holiday celebrating Jesus' birthThe world's largest online retailerThe biggest shopping day of the yearThe biggest online shopping day of the yearJewish holiday known as the Festival of LightsYou might have one of these in your house (real or artificial)...

Weather vs Climate 2025-11-26

10 Items: day to day variationmeasures air pressurestudies/predict weathermeasure air temperaturegases that surround a planetmeasures how fast wind is blowingmeasure rainfall over period of timeatmosphere surrounds Earth and pushes downvariations of weather of long periods of timedevice used to show direction wind is blowing

G7 WWI Vocabulary from The Great War Dr. E 2025-01-15

13 Items: EasternFrontA formal agreement of peace or trade between countriesThe murder of someone for political reasons, often a political leaderAn agreement made by opposing sides in a war to stop fighting for a certain time; a truce.Also known as the Central Empires or the Quadruple Alliance (Germany, Austro-Hungarian Empire,...

Class VII Water 2025-03-30

15 Items: The sun’s heat causes evaporation of water into vapour.When the water vapour cools down, it condenses and forms clouds.Oceans contain 97.3% of the total water on Earth, which is mostly salty.The rhythmic rise and fall of ocean water twice in a day is called tide.The major sources of fresh water are rivers, ponds, springs and glaciers....

Republic 2015-11-05

18 Items: ofofwethelawsGeorgeunitedstatespeopleamericarepublicpresidentWashingtongovernmentdeclarationindependenceconstitutionalself-government

Traumatic Brain Injuries 2025-04-14

10 Items: How did Brett obtain his TBI?Damage limited to one area of the brainThis area has more TBI incidents than Urban areasAt what stage of childhood are sports related TBI's are most likely to occur?Diagnostic Test used to identify the location and severity of the Brain Injury...

Metamorphicrocks Word Search 2024-04-09

11 Items: lack plates or stripesbands, sheets or platesform by the precipitation of mineralsform by the compaction of rock fragmentsform by accumulation of animal or plant debrishave large grains and cools for millions of yearshave small to medium grains and cools for thousands of yearshave invisible or microscopic grains and cools for seconds to months...

Community Word Search 2026-02-13

11 Items: Face-to-face contact with the family in their residence.The specific setting of our 3rd-day community immersion.The ongoing evaluation of nursing care and interventions.The method by which the nurse provides care using the PHN bag.The process of imparting knowledge to improve health literacy....

Gulf Amitriptyline 2023-08-23

13 Items: managed in divided ?is the tablet film coated ?Gulf Amitryptiline is used for?what is the colur of the label?hundred - what is the pack size?what is the strength of the tablet?true or false , has sedative effectscolour of the Gulf Amitriptyline tabletwe are on formulary with what med aid ?what type of antidepressant is Gulf Amitryptiline...

Unit 1 Vocab Review 2025-08-21

14 Items: Trade over oceans or seasThe study of stars or spaceA writing system for numbersFrench followers of John CalvinTo disagree with official opinionThe belief in the good of humanityCharging extremely high interest ratesA movement to change the Catholic ChurchA period of cultural rebirth started in ItalyPeople should be able to make their own choices....

parkers manwuel amaral 2024-04-26

12 Items: a commandfront of buildinga line of soldiersdecent from ancestorsattach a boat to a ropeplants with shiny leavesa nose or jaw on any animalstand upright from the skina intense feeling of longing someonea word used when something is fallingsimple laws for any type of governmentsomething being stretched or mental pain

On Every Street - July 12th to August 9th, 2023 2025-06-30

35 Items: AshHornAsherAspenAsterGiliaPontoRoxbyArthurBarnesDubbinSuttonZinniaBenmoreBoxwoodCantinaVickersAthalmerBarberryDrysdaleEdgemontMarigoldMcDonaldSagehillWildRoseArrowleafDonhauserInvermereViewcrestMontgomeryWindermereSilverberryWintergreenFrancescuttiMcKinleyBeach

Eyeball Word Search 2025-04-04

12 Items: – A word Shakespeare invented.– A famous play by Shakespeare.– The name of Shakespeare’s wife.– One of Shakespeare’s famous plays.– The town where Shakespeare was born.– A character from the play "Romeo and Juliet."– A character from the play "Romeo and Juliet."– A cool way of walking that Shakespeare created....