fourth of july Word Searches

Chep & Raquel 2025-01-24

21 Items: FakeFakeFakeFakeGroom's first nameBride's middle nameHoneymoon destinationLocation of engagementBride's birthday monthBride's favorite drinkGroom's favorite fruitGroom's birthday monthCouple's favorite pastimeBreed of Groom's first dogBreed of Bride's first dogCouple's anniversary monthCouple met during this eventCouple's favorite pizza store...

Aerial Word Search 2025-03-27

15 Items: Related to the air; often used to describe military operations conducted by aircraft.A type of military aircraft designed primarily for air-to-air combat against other aircraft.The quality of being open to attack or harm, often used in the context of military defenses....

Animal Adaptations 2025-03-05

18 Items: preyOceanSpinesDefensehabitatmimicryPredatorHedgehogsurvivalPorcupineInflationAdaptationPufferfishProtectioncamouflageenvironmentType of adaptation where the body changesType of adaptation where an animal changes the way it acts

Boonies 2025-12-10

10 Items: The OGFirst stepThird stepFas-to-fasIn the carWhat Eo isSecond stepFourth stepOn the couchWhen I'm the little spoon

Today's Word Search 2026-05-05

12 Items: FailedDeadlyBigotryGreat WarNazi SymbolMake Fun OfNazi LeaderAustrian CapitalThe End Of A WarMain Central PowerMarrying A RelativeBrother's Cause Of Death

Factors that Affect Motion 2024-05-13

15 Items: A p__________ is a place or location.A force that opposes motion is f_________.The force generated by a push is the t_______.An e_______ is what happens because of a cause.An object is in m________ when its position changes.The r____ of a particle is the speed of its movement.A point of view is also called a frame of r____________....

South Africa 2026-03-23

10 Items: South African currencyThe legislative capital of South Africa"The .... nation"- South Africa's nicknameThe number of capital cities South Africa hasSouth Africa's first post apartheid presidentThe number of official languages in South AfricaThe African ......... - one of the big five animals...

Eagles Independence Intellect 2024-09-30

20 Items: Galen's newest clubHow many districts is in Belize?What is the national bird of Belize?Who did Galen honor for service day?Galen's newest student body presidentWhat is the national animal of Belize?Galen's newest academic support serviceThe month Belize gained its independenceGalen's newest male student staff member...

2026-04-12: The Power of a Holy Vision 2026-04-12

19 Items: His power is…His praise is…His position is…The name of his churchWhat we can offer our cityThe good king who had diedThe name of today's book giveawayThe name of today's guest preacherThe vision ___ for eternal purpose.Isaiah describes God: His posture is…Something that seems relatively smallThe book where today's passage came from...

Lemon tree 2024-12-01

20 Items: Boring. (adj). Not interesting; causing boredom.Rainy. (adj). Characterized by rain or frequent rainfall.Feel. (v). To experience an emotion or physical sensation.Far. (adj). At or to a great distance in space, time, or degree.Fast. (adj/adv) Moving or capable of moving quickly; also refers to speed....

Anatomical Tooth Terms - Equine Dental 2025-03-31

20 Items: Apical: Towards the root tipReserve: Un-Erupted Portion of the toothClinical: Portion of the tooth that is ExposedDentin: Inner layer, softest material of the toothMolars: Teeth situated behind the premolars used for grinding forageRoot: Normally buried in bone as they serve to anchor the tooth in position...

Econ Word Search 2026-01-06

28 Items: This good is club and public.This good is private and common.Which group wants to maximize PROFIT?Which group wants to maximize UTILITY?Peoples change in preferences over timeWhat is the tax on imported goods called?___ good that means more money, LESS of that goodChanges in __ Prices will lower or increase costs....

Unit 8 2024-04-25

9 Items: Reprocessing of waste into new, useful productsFlow of all wastes produced by the average persontype of waste with mostly household and commercialtype of waste with mostly chemical and constructiontype of waste with manure, crop residue, dead livestocktype of waste with tailings, overburden, broken equipment...

skeletal wordsearch 2025-12-09

13 Items: Patella is a ___ boneTarsals are a ___ boneWhat joint type is the elbowWhat bone is the sternum classed asThe femur is classified as a ___ boneType of bone the vertebrae is classed asWhat joint is tough cartilage at bone ends___ joint is surrounded by a joint capsule___ skeleton forms the central axis of the body...

FFA CREED PARAGRAPH ONE 2025-12-05

9 Items: Ioffaithin thewith ain thewe now enjoy have comeof better days through better ways, even as the betternot of words but of deeds- achievements won by the present and past generations of

Ellipse 2025-12-02

11 Items: A measure of how stretched the ellipse is.The distance from the center to either focus.The midpoint of the major axis; the point exactly halfway between the two foci.The longest diameter of the ellipse; it passes through both foci and the center.Half of the major axis; the distance from the center to a vertex along the major axis....

Equations and Inequalities Word Search 2025-10-07

16 Items: A number without a variable.The “opposite” operation used.The number in front of a variable.A letter that stands for an unknown number.When both sides of an equation are the same.One part of the process of solving an equation.A math sentence that shows two things are equal.To multiply a number by everything inside parentheses....

Voca 6000 Lesson 17 & 18 Review 2026-05-13

14 Items: causing painto get or acceptwithout a curve or bendnot many, but more than twoacross any of the oceans; abroadlocated close at hand; not far awayto cover or fill with a flow of waterthe act of keeping watch or searchingthe act of traveling from one place to anotherto breathe in gasps; struggle for breath; pant...

World Landmarks 2025-08-15

19 Items: BENWALLITZÁTOWERMAHALPETRAPICCHUSQUAREFAMILIAKHALIFAPYRAMIDSRUSHMORECOLOSSEUMACROPOLISSTONEHENGEOF LIBERTYOPERA HOUSETHE REDEEMERTOWER OF PISA

Ecology 2023-04-20

13 Items: Organism that only eats meat.Organism that only eats plants.Animal hunted by another animal.Plants use _____ to make energy.______ eat dead and/or decaying matter.Organism that eats both plants and animals.______ break down dead and decaying matter.All of the energy on earth begins with the ____....

Reconstruction Vocab 2026-05-05

19 Items: a person freed from enslavementnumber of the amendment to the U.S. Constitution that abolished slaverythe period after the Civil War from 1865- 1876 when southern states were brought back into the Uniona system of agriculture in which a landowner allowed a tenant farmer to use land in exchange for a share of the crop...

Vocabulary 2023-02-02

12 Items: A green vegetable.It makes food sweet.You use them to see.It is a type of meat.A long and yellow fruit.People can hear with them.The opposite of beautiful.A type of food which is white.You need it when you make mistakes.A type of food that is made with milk.A person who has got lots of friends is......

vocab man 2026-01-29

27 Items: artlunchclassclassfirstthirdfifthsixthninthtenthsecondfourtheighthspanishscienceenglishto talkseventhschedulehomeworkto teachto studytechnologymathematicsin the hourcalculator|social studies

spanish 2026-01-30

27 Items: artlunchclassclassfirstthirdfifthsixthninthtenthsecondfourtheighthspanishscienceenglishto talkseventhschedulehomeworkto teachto studymathmaticstechnologycalculatorin the hourphysical education

Primary Word Search 2026-03-31

13 Items: built up towns and citiesvillages with not many servicesfeatures can be hills, mountains, lakesthis sector provides knowledge and skillsthe way people are spread out over an areathe movement of people from one are to anothera group of islands between north and south americathis sector turns raw materials into finished goods...

June Days 2025-07-01

18 Items: Clark KentFreedom dayVroom Vroom!Love is loveBundle of JoySeattle MuseumLand down underGlobal ChallengeSouth of the borderA family pizza shopA famous bowling teamWho needs one anyway?Does this guy even age?Where to share a recipeA national park and showOpposite of Mothers Day!Big Pharma vs Big ______A different kind of football

Genetics VS Environment 2026-04-13

17 Items: Weaker allele.Genetic makeup.Stronger allele.Unit of heredity.Change in DNA sequence.Environmental influences.A specific characteristic.Different forms of a gene.Actions learned or developed.Passed from parent to offspring.Food consumed, affecting growth.Observable physical characteristics.Surroundings influencing development....

english lesson 2023-03-28

10 Items: Kinds of Narrative Textstructure of descriptive textgeneral structure of recount textLanguage Features of Recount Textgeneral structure of narrative textLanguage Features of Descriptive Texttext that describes a particular object in detailrecount text whose contents tell historical eventstext which retells events or experiences in the past...

Vocab Word Search 2023-01-24

19 Items: scorecomplementedtaking care ofbringing forthhide somethingfading quicklypleasant feelingpart of the wholesudden revelationnot taking too muchhostile or unwelcomingshedding leaves anuallyavoid doing or go aroundhave legalized by a notarynot made through natural meansvoicing your opinion for changeshy due to lack of self-confidence...

AP Seminar Vocab 2022-09-03

58 Items: choicesevidencereferencebe examinedendeavor/work— A condition or exceptionand/or explain relationshipsA possible future effect or resultInvolving two or more areas of knowledge— The act of solving a problem or disputeImportant problem for debate or discussionA belief regarded as true and often unstated— A point of view conveyed through an argument...

Acromegaly 2024-09-12

13 Items: Causes a ( ) of the voiceCauses the skin to be ( )What is a secondary symptom?pituitary Released from which gland?what is a complication of the condition?What category of tumour (hint: glandular)Most commonly caused by a ( ) tumourAfter the growth plates have closed or opened?Excess production and release of ( ) hormone...

Earth Day: The Wonders of Water 2025-04-22

12 Items: Frozen rain.Tiny sheets of ice.Water in the form of gas.The outside part or top layer.Taking care of what's important.Something that lives in the water.Everything around us in the world.Clear, wet liquid important to life.Layer of air that surrounds the Earth.Any kind of water that falls from the sky.A day we show love and care for our planet....

WWII Leaders and Ideologies 2023-12-13

12 Items: founded on the principle of elected officials representing a group of peoplea form of government in which the monarch has absolute power among his or her peoplean authoritarian and nationalistic right-wing system of government and social organization...

Vocabulary Word Search 2025-10-29

10 Items: A horizontal row on the periodic tableA vertical column on the periodic tableThe electrons found in the outermost energy levelThe number of valence electrons that a neutral nitrogen hasThe number of protons in an atom; it identifies the element.The total number of protons and neutrons in an atom’s nucleus....

Bone Words and Definitions 2025-11-06

10 Items: Process of bone formation.Cavities in bone matrix that house osteocytes.Compact bone making up most of the bone's length.Small needllelike pieces of bone that make up spongy bone.Flat plate of hyaline cartilage seen in young, growing bone.Concentric circles of lacunae situated around the central canal....

4.5 Electricity and Magnetism 2023-08-25

12 Items: push awaypull towardends of the magnetan unbroken path for electronsany object that is able to attract ironmaterial that allows electricity to flow through ittype of electricity with continuous flow of electronsproduces electricity by using a coil of wire and a magnetmaterial that does not allow electricity to flow through it...

BEARING CAPACITY 2025-09-29

12 Items: Weight / volumeThe force applied to the soil.The downward movement of a structure.The type of material supporting a structureThe level of water below the ground surfaceA factor related to water content in the soil.A property that resists deformation or failure.The structure that transfers the load to the soil....

La date 2025-09-05

22 Items: MayJuneJulyYearMarchAprilMonthIt isMondayFridaySundayAugustTuesdayJanuaryOctoberThursdaySaturdayFebruaryNovemberDecemberWednesdaySeptember

All About Us 2025-11-24

45 Items: BBQBabeHugsKPotFartLoveLunaJulyHomeDateHoneyGeckoQuesoPizzaLeroyCutieSnackHeartSweetLoversKissesSnacksSleepyStinkyFutureYoohooAlwaysCoupleFoodiesCuddlesReptileSnugglePartnerCookiesForeverOctoberMarthasHideawayIntimateIloveyouFebruarySoulmateBoyfriendSleepoverGirlfriend

Vocab Review 2026-06-04

45 Items: mapmopeatbedthedogMaywashhavecombhairhomeplaywalkbathJuneJulyhelpnevercleanbrushteethstudylunchMarchAprilalwaysdishesschoolsoccerdinnerAugustusuallygarbageEnglishJanuaryOctoberhomeworkFebruaryNovemberDecembersometimesbreakfastnewspaperSeptember

Summer Fun 2026-06-19

44 Items: seacrabboatJuneJulybeachwavessunnyoceanhoteltowelislandsunhatsummershortsshellsdivingaugustbikiniparasolt-shirtcampingholidayairportfishingsailingsurfingsandalsicecreamicelollybarbecuestarfishvacationplaytimebeachballjellyfishSeptemberflipflopssandcastlesunglassespaddlesurfsnorkelingswimmingpoolbucketandspade

sierra 2026-06-27

45 Items: NYCSamCakeGownJulyLovePinkVowsBlissGroomPartyRingsUnityBelizeChapelEdmondFamilySierraTuxedoBouquetDancingDiamondElegantFlowersFriendsPeoniesRomanceSpringsWeddingDevotionMarriageOklahomaSoulmateTogetherChampagneGroomsmanBridesmaidFlowergirlInvitationMargaritasPhotographPistolPeteStillwaterSweetheartCelebration

Time 2026-07-28

46 Items: maydayagejunejulyhourweekyearspanracefallmarchaprilmonthscorewatchclockmondayfridaysundayaugustsecondminutedecadeperiodsummerwinterspringtuesdayjanuaryoctobercenturycenturyancientseasonsthursdaysaturdayfebruarynovemberdecembercalendarwednesdayseptemberfortnightantiquitymillennium

Third Word Search 2022-11-28

36 Items: believable; reliablea story that is not true or is made uprepetition of initial consonant soundsa story written to be performed by actorsa word that imitates the sound it representsthe writer's position on an issue or problema story containing unreal, imaginary featuresthe primary position taken by a writer or speaker...

Search and Seizure 2025-12-17

27 Items: Conducted at or near the time of arrest_________Cause Fair probability or substantial chance _____ _____Evidence that will change over time is described as ______Evidence that will NOT change over time is described as____Evidence that proves a fact without an inference is _____ evidence...

Unconventional conventional hobbies 2025-07-10

10 Items: the art of carving shapes out of raw wood; w-preserving food in a vinegar or salt solution; p-a variant of ball golf, but with special frisbees; d-a form of rock climbing at lower heights without ropes; b-dressing up as a character from a preexisting work of fiction; c-...

Chapter 4F - The Healthy Professional 2026-07-16

18 Items: hypersensitivity disorders of the immune systemnutrients needed for energy to run every function of the bodynutrients important for building muscle and cell repair/replacementhelps protect the skin from the harmful effects of the sun's UV lightsubstances that kill or slow the growth of bacteria and other microorganisms...

Kinetic-Theory, Word Search 2025-04-07

13 Items: Force exerted per unit areaThe resistance of a fluid to flowingAn explanation of how the particles in gases behaveThe temperature at which at which a solid becomes a liquidAn increase in the size of a substance when the temperature is increasedThe process of a solid changing directly to a gas without forming a liquid...

Recovery 2022-10-15

12 Items: non-use of any addictive psychoactive substance.A dysfunctional state resulting from the use of psychoactive substances.A state in which an increased dosage of a psychoactive substance is needed to produce a desired effect.A process of withdrawing a person from a specific psychoactive substance in a safe and effective manner....

Seafloor Spreading 2026-01-30

12 Items: Who proposed the idea of continental drift?What theory explains the movement of Earth’s plates?What part of Earth spreads apart at mid-ocean ridges?What is the age of rock closest to a mid-ocean ridge?What property of rocks records Earth’s magnetic field?What is the switching of Earth’s magnetic poles called?...

dynamic ecosytems study tool 2026-04-21

12 Items: it takes a couple of decades or centurysit may take thousands to millions of yearsthe processes many ecosystems go to to existthis makes and breaks what an animal can eatanimals fighting over food is an example of thisthe amount of variety of organisms in an ecosysytemevery organism eventually experiences this no matter what...

Choice Word Search 2024-11-11

19 Items: an apartment buildinghow heavy something isstories, poems and playsdepartment that sells productspersuade someone to by somethingunit of measuring liquid in Europeopportunity to decide between optionsowned/ used by someone else before meworried that something bad will happenunit of measuring liquid in the UK and US...

Renewable Energy 2026-05-28

12 Items: Energy type that we will run out of eventuallyThis is how we obtain natural gas from the EarthEnergy type that we can get forever in the futureFormed from the remains of ancient marine organismsRenewable energy source that harnesses the power of the sunProduces lots of electricity, but generates radioactive waste...

Lily's Word Search 2022-11-28

10 Items: lowest part of a transverse wavehighest part of a transverse wavethe frequency is measured in thisthe measurement of maximum displacementthe distance from of one complete wave cyclemoves the medium parallel to the wave motionis the maximum displacement in a longitudinal wavearea of maximum displacement in a longitudinal wave...

WORD HUNT 2024-12-06

10 Items: The author of Peter PanThe author of "The Gopi Diaries"The author of Diary of a Wimpy kid.Geronimo Stilton's adventurous sisterThe clever witch who helped Harry and Ron.The author of of the narrative poem "The Raven".The doctor who writes about Sherlock's adventures.Four children along with their dog uncover mysteries....

Music 2026-06-04

17 Items: The speed of a pieceMain Hogwarts characterHarry Potter's companionA lower string instrumentA higher pitched woodwindAn upper string instrumentPatterned movement of soundA large, low register instrumentA lower pitched double reed oboeThree or more notes played togetherA lower pitched, warm, velvety fluteA simple woodwind instrument for beginners...

Emma Lantz 6th Grade 2024-05-16

15 Items: The hottest planet in spaceNo longer considered a planetClouds that are low in the skyClouds that are high in the skyClouds that are light and fluffyWhen a liquid turns into a solidA tidal wave that can flood a cityA natural disaster that spits out lavaWhen lava hits water it melts instantlyThe measure of reflectivity of a surface...

EEOC Enforcement Guidance Word Search on ADEA 2025-08-20

13 Items: O'Connor is the....What does ADEA apply toHow old was the plaintiffWhat is the minimum age for ADEAWhat Month was final decision madeWho issued this Enforcement GuidanceFinal Decision was made by what courtWhat Act is specific to this decisionWhat evidentiary Model was used(first word)Consolidated Coin Caterers Corp. is the ........

Banking Terminology 2025-09-04

24 Items: disbursement of fundsa bank account with no financial activitypayment into a retirement savings or pension planthe act of removing money from a financial accountan interest-earning deposit account that is liquid.something pledged as security for repayment of a loanelectronic movement of funds from one bank account to another...

Banking Terminology 2025-09-04

24 Items: Disbursement of fundsA bank account with no financial activityPayment into a retirement savings or pension planAn interest-earning deposit account that is liquidThe act of removing money from a financial accountMovement of funds from one bank account to anotherSomething pledged as security for repayment of a loan...

Character/Any Word Search 2025-10-08

21 Items: time, and mood of a storybroad idea, message, or moral of a story.story that is made up from someone’s imagination.feeling of a story: eerie, spooky, celebratory, etc.Mountain/A diagram that details the parts of a story’s plot.true story that uses real-life characters, setting, and events....

Indoor Word Search 2024-11-12

17 Items: Water test station72" Air hockey tablePromo foosball tableStock shuffleboard tableApp for a few sauna modelsOur special order stool programMaker of our new 4 person SaunaName of our ping pong table lineMaking billiard tables since 1845Centennial cloth's version of WineSunny Design bar with two finishesName of a putting green we can order...

Week 12 Word Search 2025-10-31

10 Items: Sufficient; enoughBasic; forming the foundationAct of making laws; law-makingReached its highest point or climaxAccumulation and storage of suppliesEncourage; contribute to the growth ofAccepting; free from bigotry or prejudicesEnd of separation of cultural and racial groupsSomeone who takes the most hopeful view of matters...

Advanced Science and Future Technologies 2025-05-30

10 Items: A planet that orbits a star outside our solar system.The study of materials at extremely low temperatures.Designing technology inspired by nature’s models and systems.The science of using light (photons) to transmit information.An unmanned flying device controlled remotely or autonomously....

SIX THE MUSICAL 2023-03-15

17 Items: sixWAYPARRDOWNbradWIVESposadaOF STONEcatherinekatherineanneboleynOF HOLBEINjaneseymourannaofclevesLOSE UR HEADYOUR WANNA DODON'T NEED YOUR LOVE

Adjectives 2022-11-08

15 Items: happy and cheerful.evil or morally wrong.(of a person) feeling cold.unable to understand; perplexed.in a vulnerable position or situation.(of an object) easily broken or damaged.lasting or existing forever; without end.capable of or tending towards murder; murderous.(of a person) unfriendly and unwelcoming towards people....

U.S. History Word Search 2024-04-25

15 Items: December 7th 1941Your 2nd Amendment RightFirst African American PresidentMusic genre made during the 1920's1st Medal of Honor winner during WWIKilled in Dallas on November, 22nd 1963Creator of The Smartphone and founder of AppleProgram made under FDR during the Great DepressionCivil Rights group that will use force if necessary...

Elliot Turns 25 2026-06-09

15 Items: The birthday boyThe age Elliot is turningThe color of Elliot's eyesThe month of Elliot's birthdayThe high school Elliot attendedThe car company of Elliot's truckThe TV show involving an FBI agentThe event that brings us here todayThe sport Elliot played in high schoolThe name of the street our house is on...

countries 2024-07-19

10 Items: The authority of a state to govern itself.The art and practice of conducting negotiations between nations.The official residence or offices of an ambassador in a foreign country.The status of belonging to a particular nation by origin, birth, or naturalization.The official line separating two countries, administrative divisions, or other areas....

Grammar Review & Roots 2026-02-06

12 Items: ACTION WORDDESCRIPTIONTHE STUDY OF LIFEFOUNDATION OF WORDSMEANING OF ROOT "BIO-"PERSON, PLACE, OR THINGSTORY OF SOMEONE'S LIFEBEES POLLINATE ___________FISH THAT FOLLOWS SHARKS AND RAYSCLOWNFISH LIVE IN AN ____________PLACE WHERE MANY DIFFERENT SPECIES LIVERELATIONSHIP WHERE 2 CREATURES LIVE TOGETHER

Summer of the Mariposas 2023-03-16

17 Items: Spanish for mermaidNarrator of the storySpanish for butterflyDelia and Velia are _____Youngest of the Garza sistersColor of the dead man's houseUS state where the Garzas live"Too much cream spoils the ____"Model of Papa's car the girls tookLast name of the author of the bookEnchanting hostess who served treatsLa Llarona's role in the Hero's Journey...

July 23rd Word Search 2025-07-23

7 Items: PEMDASDivisionAdditionExponentsParenthesisSubtractionMultiplication

DDPD July 2025 FR 2025-08-05

7 Items: PersonaCurationStratégieNavigationRétroactionPerspectivesCollaboration

Spelling & Vocabulary Wk 12 2025-11-06

10 Items: difficulty or problemsat a fast speed; rapidly.(verb) form a mental image ofa group of related people or thingsthe substance of the land surface; soil.past tense of can; used to indicate possibility.in or to a place or situation in back of or to the rear ofthe condition of being protected from or unlikely to cause danger, risk, or injury....

Political Party 2025-12-09

25 Items: DebtBankBondsLooseTreatyTreatyAffairCollegeBannekerHamiltonPresidentJudiciaryRebellionPoliticalJeffersonPrivateersFederalistRepublicanSpeculatorsConstructionProclamationof Greenvilleof Fallen Timberand Sedition Actand Virginia Resolutions

Les Pays Francophones 2026-01-12

29 Items: FasoChadMaliTogoBeninGabonNigerHaitiFranceMonacoGuineaGuineaRwandaCanadaBelgiumBurundiComorosSenegalVanuatuCameroond'IvoireDjiboutiof CongoLuxembourgMadagascarSeychellesSwitzerlandAfrican RepublicRepublic of the Congo

christmas history 2022-12-03

15 Items: A Roman feast celebrating children.In the early years of Christianity, ______ was the main holiday.Christmas wasn’t declared a _______ holiday until June 26, 1870.For some Romans, this god's birthday was the most celebrated day of the year.This reindeer was created to advertise for the Montgomery Ward stores in 1939....

Ancient Greek Biology 2025-10-08

14 Items: The Study Of Lifethe study of animalsGreek word for "cell"Greek word for "self"Greek word for "water"Greek word for "color"Greek word for "House"Greek word for "plant"A Name For Body StructureGreek word for "The Study Of"Greek word for "form" or "shape"Famous Greek biologist and philosopherAnimals that live in both water and land...

Mental Health Crossword 2024-02-21

15 Items: A cause of stress.Causes extreme mood swings.The act of harming ones self.Way to take a break from feelings.The act of causing ones own death.A feeling of fear, uneasiness, or dread.Expression or release of strong emotions.The reactions on what to do when stressed.Emotional, physiological, and social well-being....

Republic Word Search 2023-02-28

17 Items: kingnoblespeasantsa popular votethe right to voteto the law or to rulesa political compromisea sudden overthrow of the governmentto formally give up control of a country or stateto incorporate into an existing political unit, such as a city or countryhe middle class, including merchants, industrialists, and professional people...

5.1-5.3 CR 2025-09-23

12 Items: word choiceWriting stylelook over workput stress on subject matterWhat should there be no mistakes of?Type of figurative language, no like or aswords that carry strong or emotional weightType of figurative language, uses like or asKnowledge that has been selected to be presentedType of language writers should use to convey ideas...

Photo Imaging 2025-03-04

30 Items: ISOCARDFILEZOOMLENSWHEELADOBELIGHTSPEEDTRIPODIMPORTEXPORTREADERFILTERNUMBERMANUALCAMERAIMAGINGBALANCESUBJECTAPETURECONTRASTEXPOSUREOF FIELDAUTOFOCUSLIGHTROOMOF THIRDSBACKGROUNDPHOTOGRAPHYCOMPOSITION

adobe in 26-50 terms 2025-10-29

25 Items: ModeTypeLoopFormGridWorksDatesGamutProofExampleof ViewFramingGestaltHarmonyof FieldEmphasisHandlingGradientDitheringHierarchyForegroundGuidelinesHighlightsScreen ModeUse Doctrine

Arson 2026-01-21

30 Items: LoadCharArsonPointSourceOriginLiquidDebrisPatternPatternof CharResidueIgnitionTriangleStainingCocktailEvidenceCatalystFlammableof OriginV-PatternShadowingBackdraftFlashoverIncendiaryAccelerantCombustionCombustionTetrahedronAlligatoring

Lesson 28 2026-04-29

30 Items: LoveJesusSheepGOATsSignsJudasSpiritEldersThirtySilverTalentsScribesAnxietyFreedomBehaviorJealousyCrucifiedAddictiveSynagogueAuthorityRebelliousEnd,of,ageSelf,worthPersecutionHoly,SpiritTime,of,endHigh,priestsChief,priestsFinal,warningsThree,parables

Immigrate Word Search 2025-10-30

15 Items: - to move to a country- to move from a country- the spreading and mixing of cultures- something that encourages people to move to a new place- something that encourages people to leave a place behind- an unusually long period in which little or no rain falls- a severe shortage of food that results in widespread hunger...

Famous Landmarks 2026-05-16

18 Items: ColosseumTaj MahalStonehengeBurj KhalifaEiffel TowerGrand CanyonMachu PicchuBurj KhalifaNiagara FallsMount RushmoreStatue of LibertyGolden Gate BridgeSydney Opera HouseThe Hollywood SignGreat Wall of ChinaNotre Dame de ParisEmpire State BuildingGreat Pyramid of Giza

Nyctophobia Word Search 2026-01-04

19 Items: The goddess of nightThe opposite of darkWhere death road is locatedPhobia name for Fear of the darkThe way trees look in the winterYour prikily spikey plant friend!What might be haunting your house.The spooky holiday. Trick or treat!Monster blood. Usually green in movies.Last name of a famous horror author from maine....

SPOOKY! 2026-01-04

19 Items: The goddess of nightThe opposite of darkWhere death road is locatedPhobia name for Fear of the darkThe way trees look in the winterYour prikily spikey plant friend!What might be haunting your house.The spooky holiday. Trick or treat!Monster blood. Usually green in movies.Last name of a famous horror author from maine....

geometry dash main levels 2024-04-07

22 Items: dashxstepjumpercyclesdry-outclubsteppolargeistdeadlockedfingerdashcant-let-goclutterfunktime-machineback-on-trackhexagon-forcestereo-madnesselectrodynamixbase-after-baseblast-processingtheory-of-everythingelectroman-adventuresgeometrical-dominatortheory-of-everything-2

history word search 2025-06-11

30 Items: USAussrnukeaxistanksitalyhitlernazismpolandfascismgermanydugoutsallliestrenchescold-warnagasakiswasticamissilesmussolinicommunismhiroshimaworld-warholocaustproxy-warsdepressionSpace-raceatomic-bombpearl-harborLeague-of-Nationstreaty-of-versailles

Population Word Search 2025-01-17

13 Items: All of the food chains in an ecosystemOrganism that breaks down dead organic materialAn individual animal, plant, or single-celled life formMake their own food, which creates energy for them to growAn interacting group of various species in a common locationA non-living part of an ecosystem that shapes its environment...

Wedding Word Search 2024-04-18

10 Items: Symbols of never ending lovePerson of the Bride's bridal partyThe annual celebration of marriagePerson of the Groom's wedding partyFlowers arranged for the Bride to holdPromises made between the Bride and GroomTraditional dessert of wedding receptionsVacation the married couple take post weddingThe celebration of love between the Bride and Groom...

Unit 2 Key Terms and Vocabulary Word Search 2025-10-05

25 Items: Weapons portable towers and catapultsChinese sailing ship that developed during the Song Dynastya very wealthy and world-renowned center for Islamic learningSaddle saddles developed by South Arabians as the use of the camel spreadHorde Batu’s army that pushed westward through Russia and then into Europe...

Unit 3 Vocabulary 2025-10-31

13 Items: The flip of a fractionReduce or make simplerComparion of a part to partA comparison of two quantitiesRatios with equal cross productsMeasurement system used in the USComparison of the section to totalComparison of the total to a sectionA rate that compares a quantity to oneMeasurement system based on multiples of 10...

office 2025-02-26

19 Items: A piece of work to be done or undertaken.Working together to achieve a common goalA plan for carrying out a process or procedure.The process of organizing and storing documents.A machine used to make paper copies of documents.A written message, especially in a business settingA plan or suggestion put forward for consideration....

World Landmarks 2025-08-15

20 Items: BENWALLITZÁTOWERMAHALPETRATOWERPICCHUSQUAREFAMILIAKHALIFAPYRAMIDSRUSHMORECOLOSSEUMACROPOLISSTONEHENGEOF LIBERTYOPERA HOUSETHE REDEEMERTOWER OF PISA

Early Autumn Word Search 2023-01-19

20 Items: Mel's WifeFrightenedA detectiveAn investigatorPatty's HusbandOpposite of strongPatty is Mel's ___ready to give helpSpensers GirlfriendMel is Paul's fatherHaving no one presentSpensers favorite drinkA stupid foolish personThe son of Patty and Melnot having made a decision.raise one's shoulders slightlybeing certain of your abilities...

Final Word Search - Latin 1b 2025-06-09

25 Items: my farm _______________my anger ________________greedy men _______________many roses _______________to the boys ______________of the girls ______________in your life ______________my son! ___________________of my men _________________for the sons _______________your daughters _______________for a Roman man ______________...

M3 Unit 1-3 vocabulary 2023-09-01

11 Items: the ovule becomes this partmany food chains linked togetherthe ovary of a flower becomes thismethod of identifying an unknown organismtype of process where humans control traitspollen moving from the anther to the stigmathe passing of features from parents to offspringtype of process where the environment controls traits...