chemical reactions Word Searches

Pool Safety Word Search 2025-06-04

15 Items: Always read this before using any pool product. (5 letters)Important to have when handling chemicals indoors. (11 letters)What you use to keep the pool water clean and safe. (8 letters)A common disinfectant, dangerous if mixed with acid. (8 letters)A cool, dry place where pool products should be kept. (7 letters)...

Chem-is-tree Holiday Word Search 2024-12-18

14 Items: Major flavor component of clovesMajor flavor component of cinnamonThe alkaloid compound found in mistletoeThis compound gives ginger its pungent odorThe chemical in peppermint that makes your mouth feel coldType of compounds that give poinsettia leaves their red colorThis Group 13 Period 4 metal is frequently found in LED lights...

Melting, Word Search 2024-05-13

1 Item: FAMILY, COMPOUND, PROTON, PHYSICAL CHANGE, GAS, MATTER, CHEMICAL CHANGE, FREEZING, NEUTRONS, MOLECULES, ELEMENT, SOLID, PRODUCT, ATOMS, GROUPS, NUCLEUS, METALS, PLASMA, PERIODS, LIQUID

ENGINEERING + 2024-08-20

1 Item: AERONAUTICAL BIOMEDICAL SOFTWARE COMPUTER MECHANICAL ELECTRICAL CHEMICAL SAFETY DANGER FALL LOUD FIRE MEDICAL FORKLIFT GLOVES EYEWEAR HEARING BREATHING RADIATION RESPIRATOR EMERGENCY

1.02 2025-05-13

37 Items: Refers to fabric right off the loom.used on polyester and acetate fibers.Compounds that penetrate and color fibers.Combines both roller and screen printing methods.applied to the fabric make them inedible to moths.Ink jet based method of printing colorants onto fabric.Resistance resists the growth of mildew and other molds...

Muscles 2024-09-19

14 Items: The starting point of the muscleWhere the muscle inserts on the boneThick fleshy central part of the muscleJunction between the nerve fibre and the muscleConnective tissue sac filled with synovial fluidChemical that transmits the impulse across the gapWhen a muscle is used or exercised and becomes bigger...

Self Harm word Search 2026-01-04

14 Items: Emotional Self harm: is the act of constantly criticizing oneself.Self Harm: is the act of intentionally harming ones body in a non suicidal way.symptoms: a subjective feeling or experience indicating a specific health issueEmotional distress: is the act of mental suffering as an emotional response to an experience...

Greenhouseeffect Word Search 2023-06-13

30 Items: a place to dispose of waste\When fertile land becomes a desertloss of resources though soil erosiona species that is non native to an arearadioactive waste from nuclear reactorstravel and appreciation of nature areaspower obtained by harnessing of the windThe uncontrolled expansion of urban areasthe decrease in the ph levels in the ocean...

1. Word Search 2025-03-17

1 Item: Chemical Characteristics 2. Cladogram 3. Dichotomous key 4. domain 5. Genus 6. Kingdom 7. Physical Characteristics 8. phylum 9. species 10. taxonomy

Treaty of Versailles Ceviche Style 2025-09-04

21 Items: German airships used for bombing raids.Prevented supplies from reaching Germany.Peace treaty ending WWI; punished Germany.Union between Germany and Austria forbidden.Used by Germany to sink Allied supply ships.German emperor who abdicated in November 1918.(Nov. 11, 1918)Agreement to stop fighting WWI.Payments Germany owed to Allies for war damage....

Griffith Observatory Glossary 2023-11-14

20 Items: a fluid state of matterthe study of space & everything in itthe layer of gas that surrounds Earththe 6th element & chemical basis for lifea place for observing & studying objects in spacea pure substance containing only one type of atoma celestial body of gas that generates light & heata zone around a star where temperatures are just right...

May 2025 Wordsearch 2025-05-02

20 Items: the ability of an organism to resist diseasetreatment intended to relieve or heal a disorderthe invasion of the body by harmful microorganismsthe process of returning to a normal state of healththe identification of the nature of an illness or problemthe action of stopping something from happening or arising...

Bio 10 Lesson 2.1/2.2 Vocabulary Word Search 2025-10-05

23 Items: Center of an atomThe basic unit of matterBond that opposites attractBond that shares of electronsScale that values from 0 to 14Dissolving substance in a solutionNegatively charged subatomic particleSubstance that is dissolved in a solutionAtom that has a positive or negative chargeMixture of water and non-dissolved material...

hi 2024-05-17

14 Items: the circular motion of an object around its centerthe amount of space occupied by a sample of matterThe SI derived unit used to measure energy or work.a positively charged region at the center of the atoma chemical element with symbol Ag and atomic number 47.a force which tries to pull two objects toward each other...

4TH QUARTER SCIENCE VOCABULARY WORD SEARCH 2024-04-03

1 Item: SOIL, IGNEOUS, SEDIMENTARY, METAMORPHIC, WEATHERING, MECHANICAL, CHEMICAL, EROSION, QUARRYING, MINING, LANDSLIDES, WEATHER, CYCLONE, DEPRESSION, STORM, TYPHOON, MOON, PHASES, CRESCENT, GIBBOUS, WAXING, WANING, STARS, CONSTELLATIONS

Chapter 15 - Key Terms 2023-11-01

10 Items: Mucous membranes of the eyes.A process of cleansing to remove undesirable debris.Complete destruction of organisms after they leave the body.The complete destruction of organisms before they enter the body.Date after which a product is no longer effective and should not be used....

GENETIC AND ENVIRONMENTAL IMPACTS ON GROWTH 2025-10-04

15 Items: HOW GENETIC TRAITS ARE "SEEN"DIET, EXERCISE, STRESS, AND EXPOSURE TO TOXINSINCREASE OF RISK POSED BY A GENETIC PREDISPOSITIONREDUCTION OF RISK POSED BY A GENETIC PREDISPOSITIONCERTAIN CHEMICALS CHANGE THE CHEMICAL BEHAVIOR OF DNA _____THE PASSING DOWN OF CHROMOSOMES AND GENES FROM ONE GENERATION TO THE NEXT...

ch 4 vocab 2025-02-26

15 Items: Rate at which energy is converted.Energy that is due to chemical bonds.Machine that does work with only one movement.The ability to cause change, measured in joules.Energy a moving object has because of its motion.States that energy cannot be created or destroyed.Transfer of energy when a force is applied over a distance....

Health 2025-10-27

17 Items: A disease that destroys alveoliAn addictive drug found in tobaccoAir that has been contaminated by tobacco smokeA thick,dark liquid that forms when tobacco burnThe smoke that a smoker inhales and then exhalesThe blue in the throat that takes air to and from the lungsA colorless,odorless,poisonous gas produced when tobacco burns...

World War 1 2025-03-20

12 Items: An explosive used to destroy submarines.Monetary payment is used to right a wrong.Naval submarines used by Germany in World War 1.A position of remaining neutral in times of conflict.African-American Regiment that fought on the front lines of World War I with the French....

Human-Environment Settlement 2023-05-04

32 Items: to give support toremoval of all treesarea turns to a deserteffort to restore forestsraising of animals for foodelectricity powered by waterremoval of salt from seawaterwide variety of life on Earthhaze caused by chemical fumesresource that can't be replacedpermanently frozen layer of soilrich soil made up of sand and mud...

lab safety 2025-12-15

1 Item: goggles, lab coats, accidents, hazards, sink, eyewash stations, fire extinguisher, chemical storage, fire safety, No horseplay, label containers, professional behavior, walk always, no food, no drinks

Heat Word Search 2025-04-10

1 Item: waves, chemical waste, climate change, rising sea levels, deforestation, plastic debris, extinction, endangered species, smog, fossil fuels, renewable energy, carbon footprint, greenhouse gases, environmental pollution, recycling.

Social Studies Interim Review 2026-02-19

20 Items: branch that makes lawsbranch that enforces lawsbranch that interperets lawsgave all men the right to votethe unruly act of skipping schoolthe science or practice of farmingamerican white supremacist hate groupamendment that formally abolished slaveryyou have to be 21 to join this house in georgiaa crime that results in less than a year in jail...

Sanremo artists 2024-05-21

108 Items: ldabugoemmagaiaModàollyrikiwillarisaclaraelisafasmafedezghaliiramalazzanoemirkomisethusharitoscayumanarieteblancoelodieghemonIl TreLa SadmadamemorganrandomultimobigmamadiodatogeoliergiorgiaIl VololevantemahmoodmaninnirancoretananaiAnna OxaannalisagazzelleGio EvanMåneskinMr. RainColla ZioComa_CosegianmariaMax GazzènegramaroRenga NekErmal Meta...

5. Cells & Energy 2022-11-02

22 Items: without oxygenSugar (C6H12O6)requires oxygenBasic unit of lifethe outer covering of a cell or organelleget their energy from the sun, example plantsplace in a eukaryotic cell where the DNA is locatedtiny structure that performs a specific job in a celladenosine triphosphate, a molecule that stores energy...

Sewer Word Search 2025-07-15

35 Items: Wet, soft earth.Dead body of an animal.Discarded items, refuse.Oily or fatty substance.Thick, gooey mud or waste.Internal organs, entrails.Black dirt, soot, or filth.Repulsive dirt or pollution.Deep excavation for minerals.Unwanted or unusable material.Slippery black liquid, often crude.Black, sticky road paving material....

Mike Rowe's Dirty Jobs 2025-07-15

35 Items: Wet, soft earth.Dead body of an animal.Discarded items, refuse.Oily or fatty substance.Thick, gooey mud or waste.Internal organs, entrails.Black dirt, soot, or filth.Repulsive dirt or pollution.Deep excavation for minerals.Unwanted or unusable material.Slippery black liquid, often crude.Black, sticky road paving material....

Mike Rowe's Dirty Jobs 2025-07-15

35 Items: Wet, soft earth.Dead body of an animal.Discarded items, refuse.Oily or fatty substance.Thick, gooey mud or waste.Internal organs, entrails.Black dirt, soot, or filth.Repulsive dirt or pollution.Deep excavation for minerals.Unwanted or unusable material.Slippery black liquid, often crude.Black, sticky road paving material....

GEOLOGIC PROCESSES 2024-08-25

1 Item: Exogenous Weathering Erosion Sedimentation Deposition Endogenous Process Chemical Physical Disintegration Rock Temperature Pressure Decomposition Compound Mineral Soil Atmospheric Oxidation Substance Oxygen Hydrolysis Water Acidification Organism Earth Gr

Unit 05 Health and safety in the uniformed services 2025-12-11

1 Item: Hazard Accident Safety PPE Fire Firstaid Emergency Legislation Compliance Training Reporting Supervisor Employee, Employer Manualhandling Infection Decontamination Evacuation Protectiveclothing Uniform Boots Gloves Helmet Hygiene Chemical Policy Procedu

Grade 3 Speaking Test 2023-05-25

1 Item: Albert, physical, chemical, changes, rollercoaster, quickly, slowly, solid, liquid, gas, exciting, enjoyable, summer, winter, float, electricity, annoying, sound, Science, students, teachers, English, Sinolink, Canada, South, Africa, China, experiment, sp

Particle model 2026-01-28

1 Item: Mass, Volume, Displacement,Irregular,Regular,Eureka,Measuring Cylinder,Particle,Solid,Liquid,Gas,Kinetic,Vibration,Arrangement,Random,Brownian,Collision,Intermolecular,Physical,Chemical,Reversible,Irreversible,Melting,Freezing,Boiling,Condensing,Sublimati

Safety and Sanitation 2023-01-23

22 Items: Maximum safe level in foodSpoilage due to breakdown of fats.Monoxide- Odorless highly poisonous gas.Prevention of illness through cleanliness.Immediate removal of a product from store shelves.Plug- Plug that has one blade wider than the otherBurn- Moisture loss caused by improper chilling out packaging...

Final Exam Review 2023-06-02

34 Items: SI for timeSI for distanceSI unit of forceEnergy of motion.SI unit for energy.Speed plus directionThe change of velocityThe ability to do work.Characteristic or qualityEnergy that will run out.Change of position in timeMercury, Venus, Earth, MarsEnergy of position or stored.Example of a renewable energyJupiter, Saturn, Uranus, Neptune...

MATMAL 25th Anniversary Celebration! 2025-05-29

30 Items: A legendary Malay warrior.Cranio-maxillofacial surgery.The national fruit of Malaysia.The national animal of Malaysia.The empirical formula of glucose.The Empirical formula of Vitamin C.The chemical formula of tin(IV) oxide.The year which Materialise was founded.Malaysian national infused coconut dish.A famous mummy that Materialise printed....

STEM Chronicles 2025 Word Search 2025-12-14

20 Items: The planet 55 Cancri is made up of…First Asian to receive a Nobel prize in physicsThe process through which your brain eats itselfFounder of the Indian Space Research OrganisationTiny particles of pollutants suspended in the airAn amphibian that vomits out its stomach to clean itThe environment which stores majority of carbon underground...

Grade 3 Speaking Test 2023-05-25

1 Item: Albert, physical, chemical, changes, rollercoaster, quickly, slowly, solid, liquid, gas, exciting, enjoyable, summer, winter, float, electricity, annoying, sound, Science, students, teachers, English, Sinolink, Canada, South, Africa, China, experiment, sp

First Aid Basics 2024-09-23

25 Items: Burns caused by heat exposurePain reliever and fever reducerBurn which damages the epidermisVaccine given to prevent tetanusAutomated external defibrillatorsBurns caused by friction on the skinInitial care given for an illness or injuryWhen a poisonous substance contacts the skinWhen a poisonous substance contacts the eyes...

Unit 8 APES review 2024-04-30

20 Items: Where over 50% of MSW ends upA common exposure route through the airA common exposure route through the skinA common exposure route through food/ waterIncrease in death rate occurs over a large areaType of waste that is mostly chemical and constructionType of disease not caused by pathogens and can be genetic...

Chapter One Vocab 2025-10-17

20 Items: diseasemicroorganismsmicroscopic living organismscapable of growing and livingsubstance that kills or destroys bacteriaasepsis removal or destruction of microorganismsmicroorganism that requires oxygen to live and reproducehighly pathogenic and disease-producing; describes a microorganism...

Naturalworld Word Search 2023-06-02

34 Items: SI for timeSI for distanceSI unit of forceEnergy of motion.SI unit for energy.Speed plus directionThe change of velocityThe ability to do work.Characteristic or qualityEnergy that will run out.Change of position in timeMercury, Venus, Earth, MarsEnergy of position or stored.Example of a renewable energyJupiter, Saturn, Uranus, Neptune...

Caffeine Word Search 2024-11-25

20 Items: a severe allergic reactionproduced from the formation of beetsa stimulant found in coffee, tea, and cocoanutrients people take in addition to the food we eat.a type of vegetarian that eats plant sources and eggsa type of vegetarian that only eats food from plant sourcespopular diets that claim to offer a quick fix to health issues...

MATMAL 25th Anniversary Celebration! 2025-05-27

30 Items: A legendary Malay warrior.Cranio-maxillofacial surgery.The national flag of Malaysia.The national fruit of Malaysia.The national flower of Malaysia.The national anthem of Malaysia.The national animal of Malaysia.The empirical formula of glucose.The national monument of Malaysia.The Empirical formula of Vitamin C....

Types of Engineering 2026-03-04

9 Items: Designs and builds essential infrastructure including buildings, bridges, tunnels, dams, highways, airports, and water/sewer systems.Uses an understanding of electricity, electronics, and electromagnetism to design systems that process information and transmit energy....

Esthetician Vocabulary 102.02 2023-01-18

22 Items: safety data sheetHazzard communication standardenvironmental protection agencySodium Hypochlorite 5.25% ConcentrateDispose of items that can no longer be usedMethicillin-resistant Staphylococcus aureusUsually able to disinfect within 10 minutesoccupational health and safety administrationmaterial that allows liquid or air to pass through...

Dillon Singleton Ch.15 Vocab 2025-03-18

15 Items: substance with atoms that are all alikechange of one substance into a new substanceheterogeneous mixture whose particles never settlesubstance in which its different components are easily distinguishedtendency for a beam of light to scatter as it passes through a colloid...

ch 15 vocab 2025-03-18

15 Items: substance with atoms that are all alike.change of one substance into a new substance.heterogeneous mixture whose particles never settle.substance in which its different components are easily distinguished.tendency for a beam of light to scatter as it passes through a colloid....

Vocab 9 Practice 2025-05-12

30 Items: Not allowed by law.Not logical or reasonable.The state of being a father.The belief in more than one god.A person who helps others learn.A tool used to see very tiny things.Medium in size; not too big or small.Related to a mother or like a mother.Having more power, force, or ability.The study of a person’s family history....

cell terms 2025-11-24

28 Items: more than one cellcell with a nucleuspreforms photosynthesissimple cell, no nucleus“the powerhouse” of a cellconsisting of one single cellbasic unit of all living thingshooke discovered the first cellgreen pigment implants used to make food“the brain” of a cell, the control centerprocess used to convert light into energy...

Anatomy & Physiology: N 2026-02-12

22 Items: Opening of the nostrilsSupportive neural cellsCell's central organelleMonomer of nucleic acidsAccidental death of cells/tissuesReceptor cell that sense pain stimuliBrush border enzyme that digests nucleotidesRod-like structure along dorsal side of the early embryoInactivation of a virus by the binding of specific antibody...

How Your Body Works Wordsearch 2025-06-25

14 Items: – The muscle that pumps blood around your body. (H, 5 letters)– A blood vessel that carries blood back to the heart. (V, 4 letters)– The process your body uses to turn food into energy. (R, 11 letters)– A blood vessel that carries blood away from the heart. (A, 6 letters)– A tube that carries air from the windpipe into the lungs (B, 8 letters)...

UNIT 4 VOCAB 2023-10-06

26 Items: A period of time.A long span of time.A specific area in time.A place for storage of fluids.Earliest era in earths history.Remains of a prehistoric animal.A break in the continuous rock record.Numeric age of a layer of rocks or fossilsRecord of rock layers over a period of time.Living organism that shapes its environment....

Physics word search 2025-06-14

28 Items: - When atoms decide to form a group chat- How often you check your phone per minute- How loud your neighbor's music is at 2 AM- What your body has to waking up on Monday mornings- What happens to your heart rate during a physics exam- The reason you're still on the couch watching Netflix- Why your room gets messy faster than you can clean it...

All About Antibodies 2026-02-25

18 Items: Is one or two types of light chains present in ~1/3 immunoglobulins.Is one or two types of light chains present in ~2/3 of immunoglobulins.Is One of the polypeptide units that make up an immunoglobulin molecule.Is a two-dimensional structure consisting of 2 heavy chains and 2 light chains....

Unit 3 Vocab 2023-09-14

20 Items: (adj) roundabout, not direct(v) to make amends, make up for; to avert(v) to make easy, cause to progress faster(v) to have an intense dislike or hatred for(v) to assign or refer to (as a cause or source), attribute(adj) bitter, sarcastic; highly caustic or biting; acerbic.(n) a natural inclination or tendency; penchant or propensity....

First Aid 2025-04-17

54 Items: beneath the top layer of skinHeavy, uncontrollable bleedingA wound that is torn and raggedNot serious; on the surface;shallowDamp,soft,sticky, and unusually coolarrest The sudden stoppage of the heartA snug bandage used to control bleedingAn anti toxin used to counter act venomOintment and bandages applied to a wound...

Twenty One Pilots MOSTLY songs clues 2025-02-12

41 Items: to floata red gemto go backto get darkera tight necklaceto decorate againthe day after Fridaya door that is a trapthe place you were bornwhat a forest is made ofto sink in water quicklyyou watch TV shows on thisa compromise between peoplea really really bad headachemany tiny peices of somethinga bunch of trees in one place...

Science Pathogen Word Search 2025-05-23

23 Items: treat viral illnesstreat bacteria illnessesThe ingestion of pathogensDispatches antibodies (proteins)Organisms or viruses that can cause diseaseDefensive cells that eat pathogens to get rid of themProteins used by the immune system to neutralize pathogens____ Line of defense (External): Skin and Mucous membranes...

AT THE BEAUTICIAN 2025-02-05

17 Items: DefinitionThe process of replenishing the skin with moisture to keep it soft, plump, and healthy.The process of removing dead skin cells from the surface of the skin to improve texture and appearance.A product used to hydrate and lock in moisture to the skin, helping to prevent dryness and keep skin smooth....

Contagious Word Search 2023-05-28

22 Items: Adnormal hair lossThe highest point of the headRod-shaped, spore-producing bacteriaBacteria that are harmful and cause diseaseThe study of hair and its diseases and disordersCovers the top and sides of the head and consists of six bonesThe process of converting living skin cells into hard proteins...

deffinitions 2023-11-23

10 Items: critical or mocking in an indirect or sarcastic way.needing much effort or skill to accomplish, deal with, or understand.a nuclear weapon improvised from radioactive nuclear waste material and conventional explosives.heavy material, such as gravel, sand, iron, or lead, placed low in a vessel to improve its stability....

Unlocking Vocabulary: "The Danger of Silence" 2026-02-27

10 Items: Pacifying or placating someone by acceding to their demands, often to avoid conflict or further escalation.To allow oneself to enjoy a particular pleasure, often to an excessive degree, or to yield to a specific desire or whim....

Study Guide Crossword 2024-04-17

31 Items: viewed from all sidessoft or workable materialclay is fired once in kilnclay is NOT fired in kiln yetrepetition of one or more elementhigh water content, most workablea single material an artist may useliquid material is poured into moldhard less water, but still workablecompletely air dried & very brittlea difference in the use of two elements...

Twenty one pilots 2025-07-29

165 Items: NedTopTwoEmoRubyRideBassNicoDemaGonerTreesDoubtTruceClearDrumsPianoKeonsListoAndreNillsBikesTrenchClancyCancerLovelyBreachVesselArcaneReggaeGuitarLisdenVetomoGravesBishopsAnthemaBanditoLeapingPop-RapR-And-BRappingAnxietyUkuleleReisdroSeizingVialismVoldsøyAntlersRed-EyeJosh-DunShy-AwayShy-AwayMy-BloodLevitateChlorineTrapdoorHeathensLane-BoyJumpsuit...

Water 2023-05-24

29 Items: Xylem or phloemNegatively charged ionPositively charged ionlow enough for ice to floatAllows water to form its bondsPolar and ionic molecules; asymmetricalReaction where water molecule is releasedBonds where two non metals share an electronNon-polar and non-ionic molecules; symmetricalwater sticks to itself; the same as surface tension...

Aaaa 2025-12-01

40 Items: - first step of respiration-A molecule that helps form acetyl-An organism that can create its own food-Respiration that uses oxygen to make atp-Organisms that must have oxygen to survive-part of the light reaction that makes nadph-the energy molecule cells have which do work-Organisms that don’t quite need oxygen to live...

Psychoactivedrugs Word Search 2026-02-09

35 Items: known for being relaxinggives an incredible sense of euphoria, highly addictivecatagorized by slurred speech, clumsy movements, and a bad recovery timethe diminishing effect of a psychoactive drug resulting from repeated usedepressant and opiate tha rushes euphoria after pain relief and relaxation...

TSFA 2 2025-12-09

21 Items: the level of light received on a plant surfacethe storage or shipment of flowers out of watersells florals good and services to the consumerthe impression of the design being stable and self supportedin Flowers is due to the inability of water to enter the stemgrowers wholesalers and retail florist must process their flowers...

DNA Isolation Methods 2024-12-15

30 Items: A buffer designed to lyse cells and release DNA.Biological macromolecules that include DNA and RNA.Using alcohol to make DNA insoluble for easy recovery.A chemical used in phenol extraction to reduce foaming.The amount of DNA recovered from an extraction process.A membrane material in spin columns used to capture DNA....

EPD Word Search 2022-09-10

35 Items: Protocol 128112 _______ PersonDeterminant 105-B-4Determinant 113-B-3Determinant 118-D-3Determinant 123-B-1Determinant 132-D-1130 Theft (________)Gross and wanton indecency110 _____ (break and enter)119 Harassment / _______ / Threat102 Abuse / Abandonment / ________Examples are needles, syringes, bongs, and pipes...

Unit 1 Key Terms 2025-05-30

22 Items: A person who designs any of a variety of things.An idea that produces a similar idea or an enhanced idea.A limit to a design process. ; A limitation or restriction.The ability to make or bring a new concept or idea into existenceA person using the services of a professional person or organization....

Swachhta Pakhwada 2025 01st July – 15th July 2025 2025-07-10

37 Items: H1: Used in gardens H2: Removes leavesH1: Water outlet H2: Must be uncloggedH1: Falls from tree H2: Often swept awayH1: Throw garbage here H2: A dirty placeH1: Comes from soap H2: White and bubblyH1: Opposite of dirty H2: Rhymes with meanH1: Use cloth to do this H2: Cleaning actionH1: Must be unclogged H2: Drains dirty water...

brain regions 2026-01-13

19 Items: deals with visiondeals with touch, spatial orientationdeals with planning, speaking, personalityOne of the major subdivisions of the cerebral cortex:deals with auditory processing, language comprehension, memoryA limbic structure critical for forming and consolidating new long-term memories and for spatial navigation....

Illicit Drugs - Daily Review 2023-08-22

22 Items: The most common reason why people start to take illicit drugs. (9)Drugs that alter or distort the brain's perception of reality. (13)Drugs that speed up the Central Nervous System (CNS) responses. (10)Drugs that slow down the Central Nervous System (CNS) responses. (11)Drugs with multiple effects on the Central Nervous System (CNS). (5-6-5)...

Coating Vocabulary 2025-06-17

28 Items: License Plate Number.A flaw or imperfection in a product.Cutting a wide web into narrower rolls.Material that is discarded during production.Bonding two or more layers of material together.Periods when equipment is operating and productive.Applying a liquid or semi-liquid material to a substrate's surface....

Animal Behaviors for Reproduction 2025-09-24

28 Items: One female mates with one maleOne male mates with multiple femalesOne female mates with multiple malesThe behavior patterns related to how animals mateAmphibian larvae that develop into adults without parental helpThe amount of time and resources given to the care of offspringSome animals migrate to a better environment for _____________....

Anatomy & Physiology: D 2026-02-05

34 Items: ToothSet of teethFreely mobile jointExcess production of urineThree-stage process of swallowingPancreatic enzyme that digests DNACompound that increases urine outputDownward motion of the scapula/mandibleMolecule that activates protein kinasesBruch border enzyme that acts on proteinsDecrease in the number of hormone receptors...

asdf 2024-09-11

32 Items: D=m/vRock that forms as magma coolsRock that forms from heat and pressurebuilding Process of creating mountainsboundary Where two tectonic plates meet.Most sedimentary rocks form in layers known as ________.The process that turns any rock into magma by adding heat.Occurs when sediments settle on the ground or a body of water...

Search and Seizure 2025-12-17

27 Items: Conducted at or near the time of arrest_________Cause Fair probability or substantial chance _____ _____Evidence that will change over time is described as ______Evidence that will NOT change over time is described as____Evidence that proves a fact without an inference is _____ evidence...

Vocabulary Quiz Three (50 Terms) 2026-02-27

50 Items: Being trustworthy or believableThe time, place, and context of a plotTo examine parts of a text in more detailThe intended readers for a piece of writingA conversation between characters in a textTo explain how two or more items are similarTo explain how two or more items are differentOne or two words that describe the focus of a text...

Anatomy & Physiology: A 2026-02-04

70 Items: Sense of hearingLipid storage cellsSlightly mobile jointProgrammed cell deathFirst cervical vertebraTip of the external noseSecond cervical vertebraAbsence of urine producedLoss of mass and functionLoss of the sense of smellLargest artery in the bodyWhere two bone surfaces meetCoiled tube attached to the cecumEnzyme that hydrolyzes ATP to ADP...

US MILITARY 2024-12-29

44 Items: Focused on air and space operations.The newest branch, established in 2019, focusing on space operations.The largest and oldest branch, responsible for land-based military operations.A term used to describe military personnel who die during combat operations. (abbr)...

Series 6 Review 2023-07-19

75 Items: accountA radio interview is a public _________Rule 147 is regarding _______ offeringsSelling group members are paid a selling ______A final prospectus is also known as a _______ prospectusThe firm in which must complete the transfer of an accountThe “A” under discretionary orders that describes buy or sell...