chemical reactions Word Searches

Science 2025-01-16

89 Items: labatomcelldatafactlawsmassdatumflaskphasescaleweighbeakerbotanyenergyfossilfunnelmattermotionretorttheorytissuevolumebiologyburetteclimatecontrolcuvetteelementgeologygravitymeasuremineralobservephysicspipettescienceweatherzoologychemicalgeneticsmoleculeorganismparticleresearchtesttubevariableastronomychemistryevolutionglasswaremagnetismPetridish...

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substance.SOLUTEthe basic unit of a chemical element.ATOMenergy in the form of heat.THERMAL ENERGYable to dissolve other substances.SOLVENTenergy associated with motion.KINETIC ENERGYthe degree of compactness of a substance.DENSITYthe speed of something in a given direction.VELOCITY...

ADAP Chapter 3 Word Search 2025-12-17

15 Items: commonly called Ecstasy or Mollycommonly called Meth or Crystal Meththe most commonly used substance after alcoholleading cause of preventable deaths in the United Statesconsuming alcohol prior to the minimum legal drinking age of 21widely available, free or inexpensive, and falsely believed to be safer than illicit drugs...

Module 1C Processes in Plants and Animals (Regulation of Fluids, Chemical and Nervous Control) 2025-03-17

15 Items: axonponsurineAuxinskidneyneuronureterestrogenendocrinecytokininsepinephrineGibberellinschemotropismtestosteronephytohormones

Europe/ Eurasian Geography 2025-11-13

10 Items: TaxesEnemies entering by force.An old decayed plant materialMeaning little or no rainfallSupporting or advertising somethingDefined territory with its own governmentA forest area that provides valuable resourcesA chemical that kill harmful insects and weedsA country in the Eastern Europe and North Asia....

CHEMISTERY 2023-05-28

10 Items: Collect and analyze evidence from a crime scene.Are responsible for researching marine ecosystems.Study and analyze both natural and manmade items to learn more.Responsible for examining and monitoring the presence of chemicals in water.Study the appearance, movement, and effect of chemical compounds on the earth....

Nutrition assignment 2024-11-29

10 Items: not made by mannutritious substancesomeone with a high IQa substance added to foodsomething said that is falsesomething that provides energythe body has a chemical reactionwhat you do when you go to the storesomeone that only eats dairy and plant productssomething that enhances something when added to food

Fundamentals of Biology 2025-07-28

28 Items: The smallest unit of lifeThe smallest unit of matterThe building block of proteinsA building block of DNA and RNATwo or more atoms joined togetherA group of cells that work together.A package of DNA found in the nucleusA copy of DNA that helps make proteinsThe part of the cell that makes proteinsA substance made of two or more elements...

Spelling list 2022-08-07

10 Items: a place to keep fishto make a place cleana tool to sweep the floora place for eating picnicsthe written words of a playa plastic or glass containeran area where you buy presentssomething that stores chemical energypaper and other garbabe on the grounda letter containing messages of good wishes

Atom Word Search 2025-06-26

15 Items: charged particledissolves a solutebasic unit of mattermass per unit volumenegatively charged particleforce holding atoms togetheramount of matter in an objectresult of a chemical reactiongroup of atoms bonded togethersubstance that donates protonssubstance that accepts protonsmeasure of acidity or basicitypure substance made of one type of atom...

7th Grade Science 2024 2024-05-01

100 Items: gasmassmasspureheatrockfuelteentalkmuirmodelscalegramsgizmoclaimsolidatomscyclewaterfloodimpactmattervolumelitersstatesliquidenergyvolumesymbolpangeawegnerokeefefossilcarbonhazardmiddleschoolproductpatternconceptcelciusnearpodquizzizkineticformulamineralmixtureerosioncrystalpolymermonomerigneousaquifervolcanospeciesresourceevidencepressureelements...

Cat Word Search 2022-09-22

82 Items: ivcatappdnacellraysscanmarsmoonnasarisktoolzebrastormfieldfocusforcegaugeliverlunarfieldmetalmodelmotororganhippovesselattackimpairinducekidneymarkermusclePlanetrodentsystemtissuevacuumaspirinbladderchronicculturegravitymercurysymptomtropicsvitaminweatherelephantchemicalconstantdiagnoseengineerinternetmutationparticlepressuresoftwareastronaut...

Sabah Oxygen - P1TA18 2024-07-08

102 Items: tophoseventtesttripzeroworkareadownlevelicingtopupnightshiftinertentryvalveplantspacesmokephonespeedlimitalarmcraneshoesupdateonlinebypassliquidbottomweightdialogvacuumoxygenhealthsafetyleaderpermitenergyheightsourcemobileglovesofflineisotankstandbymorningpurgingreactorstartupprocessdrivingvehicleprojecttoolboxliftingcoolingglassesleathernitrogen...

Physics Term 1 Revision 2024-01-12

16 Items: Heat energyInside atomsOpposes motionEnergy of motionEnergy from the sunStored energy in foodPulling force in a ropeEqual forces, no motionReturns to original shapeForce that pulls things downForce that attracts or repelsThe planet closest to the SunThe planet furthest from the SunEnergy because of flow of electrons...

Fundamental Forces 2022-10-25

5 Items: force that holds together the protons and the neutrons.force that determines the orbits of the planets around the Sun.force responsible for the attraction and repulsion of opposite electric charges.any of the four basic forces that govern how objects or particles interact and how some particles break down....

spelling list 2024-09-13

14 Items: having 2 leaveshaving 8 leavesto strip of leaveshaving five leavesa three leaf cloverhaving only one leafpages of a manuscripta thin sheet of metalall the leaves of a plantthe process of forming a leafa leaf composed of four leafletsa chemical that causes green leaves to dropa portable case for carrying sheets of paper...

Unit 4 Key Terms (Question/Answer Style) 2025-11-04

20 Items: Strain or straining force.Changing from a liquid to a vapor or gas.An interacting group of living individuals.The shortage or absence of something essential.An organism that is capable of making its own food by photosynthesis.The act, art, or manner of managing or handling; controlling or directing....

annie's word search 2024-05-16

15 Items: atomic mass unithigh temperature gasprotons and neutronsprotons and electronspostively charged atomsneutrally charged atomsnegativelty charged atomsa table of chemical elementsa mass of atom of a moleculeessential to living organismscharging a object without touching ita way of representing atoms or molecules...

Homeostasis 2024-11-28

11 Items: a chemical messengera change in the environmentmuscles or glands, make changesthe control of blood water levelsthe control of blood glucose levelswhat enzymes do in high temperaturesthe control of internal body temperaturecells that detect a change in environmentdetect, correct (HORMONE), back to normalthe organ with the highest glucose consumption...

Sci 2024-05-21

10 Items: of, worked by, charged with, or producing electricity.energy which a body possesses by virtue of being in motion.the chemical element of atomic number 30, a silvery-white metala coherent, typically large body of matter with no definite shape.the energy contained within a system that is responsible for its temperature...

Bed Bug 2023-01-06

15 Items: Treatment MethodsTreatment methodsBlood sucking pestPrepay Invoice for BBInvoice for oneshot BBInvoice for incasementsHow do K9's detect Bed BugsWhat document has the k9 pricingHours we schedule a BB eval withinWhat is needed in order to scheduleWhat must be completed before treatmentEvidence of BB, even if not seeing them...

Final Review Word Search 2024-05-16

15 Items: solid to a gasgas to a solidEnergy of motionMr.Ferdinandi's birthdayhow tightly packed atoms arethe building blocks of matterwhen thermal energy is releasedwhen thermal energy is releasedhow much space an object takes upthis goes on the y axis of a graphthe ability to do work or cause changechange in the chemical structure of matter...

Biological molecules 2024-12-18

10 Items: I contain three fatty acidsI am the pentose sugar inside RNAI am a base only in a DNA nucleotideI am what an active site is to the substrateI contain a phosphate group and two fatty acids.I transfer genetic information from the DNA to the ribosomes.I break hydrogen bonds between bases and unwind the double helix....

Physics Challenge 104 words 2025-07-14

104 Items: ohmlawsungastimeAtomBetaloopheatmarsstardustraysForcespeedForceWavesHertzAlphaGammavoltsgraphspaceearthvenusplutopolesNewtonProtonGMtubeampereseriesEnergyjouleschargesaturnuranusnebulacometsgalaxyGravityDensityNeutronIsotopecurrentvoltagecircuitkineticnuclearelasticaveragecoulombdisgrammercuryjupiterneptunemagnetsVelocityMomentumdistanceFriction...

Safety Terms Word Search 2025-09-02

55 Items: OVAfiresmokehazardcogentincidentcontrolssecuritycode-redconvergecode-greyspill-kitwork-safecommitteeevacuationleadershipfire-doorsmock-codeselectricityinspectionscode-purplearea-wardenchief-wardenfire-curtainconsultationde-escalationcommunicationgas-cylinderssafety-cultureriskman-reportmanual-handlingdangerous-goodssafe-work-limitrisk-assessment...

The Building Blocks of Biology 2026-01-22

20 Items: Which polysaccharide stores energy in plants?Which polysaccharide stores energy in animals?What lipid forms the main structure of cell membranes?What reaction breaks polymers into monomers using water?What large molecules are made of repeating monomer units?What small molecular units join together to form polymers?...

a to z 2023-01-18

27 Items: EngineerEngineer radio noiseControl Engineer Their typical duties include assessing the production process,Tunnel Engineer y making careful measurements of the forces on a model of the aircraft.Engineer Electrical engineering is an engineering discipline concerned with the study, design,...

Lesson 1-4 2025-07-13

4 Items: bacteria, waste, produce, chemical, raise, celebrate, experience, try, staypermission, comment, etiquette, nervous, interested, filter, expression, bother, awesome,vegetable, recipe, salad, appetizer, culture, recommend, balanced, nutrients, ingredients,tradition, meaning, gesture, respect, greeting, environment, recycle, pollution, conserve,

Fahrenheit 451 Word Search 2024-01-16

10 Items: Montag's selfish wifeThe girl who was killedA device used to shoot fireA retired English professorA chemical used to burn thingsThe captain of all the firemenThe main character of the storyA group of people who burned the booksA fireman who is responsible for burning other people's houses...

Bond Word Search 2023-08-14

9 Items: It's a type of clayDon't do drugs kids!"What's the ______ dear"the names ____ James ____Einsteins______ of relativityYou can put them on your fridge(of a reaction or process) accompanied by the release of heat.each of two or more different physical forms in which an element can exist...

Kitchen Scientist 2025-01-13

9 Items: Heat from the sunBacteria converts sugars to acidTogetherness due to movement and energyMeasure of a fluid's resistance to flowWheat protein that gives a chewy texturesubstance found in the cell walls of algaeFluids that break Newton's law of viscosityMixture of two liquids that normally do not mix...

Atom Word Search 2025-04-16

15 Items: Particles with an electric charge of +1Particles with an electric charge of -1The vertical columns in the periodic tableSmall positively charged center of the atomElectrically neutral particles in the nucleusThe horizontal rows of elements in the periodic tableThe number of protons in an atom’s nucleus is equal to...

Mineral Word Search 2024-12-02

6 Items: Land won ore, Marine won ore, Sustainable, Parent material, PhysicalOrganic, Composition, Luster, Streak plate, Mohs, Cleavage, Fracture,Sheet, Rill, Ephemeral, Gully, Streambank, Conservation tillage, CropContour plowing, Conservation buffers, Windbreaks, Terracing, WetlandsParent rock, Bedrock, Erosion, Runoff, Irrigation, Salinization, Creep,...

health 2024-12-16

13 Items: bigskinnynon-meat eatersugar moleculesyou are thirstycapable of dissolving in waterolive, safflower, and sunflower oila solid chemical element or compoundinformation of the number of grams of fat etcthe act or process of nourishing or being nourishedthe things that a person has to do or deal with at one time...

Vocab 1.1 2024-09-06

16 Items: A brief, indirect referencethe universal message or big ideaof View the type of narration usedappeals to our five physical sensesRepresenting a thing or idea as a personthe main problem or struggle within a storyAn expression that must be learned as a whole.the sequence of events that take place in a story...

CELL CYCLE 2025-01-07

18 Items: double helixresting phasemeans "one part"means "many parts"life activities of a cellbuilding block of proteinprovides quick energy for cellcarries DNA message to ribosomecarries amino acids to ribosomebuilding block of nucleic acidsDNA replicates during Interphasecell divides into 2 identical cellsa structural component of ribosomes...

Vocab 16 ICP 2025-04-24

15 Items: Particles with an electric charge of +1Particles with an electric charge of -1The vertical columns in the periodic tableSmall positively charged center of the atomElectrically neutral particles in the nucleusThe horizontal rows of elements in the periodic tableThe number of protons in an atom’s nucleus is equal to...

Science Word Search - Trisha 9B 2024-06-11

15 Items: NADNcioiAbtathiTsiceengOlvatencTulaiopopnDaptiaotnaRosommeochused to measure voltageused to measure currentare the basic particles of the chemical elementsis the process by which a liquid turns into a gasthe energy that moves from one place to another in a form that can be described as waves or particles...

Cat Word Search 2024-10-10

8 Items: Battery-operated vaping device.Plays a role in memory and learning.The primary addictive chemical in tobacco.Is the residue left after tobacco is burned.Smoking tobacco is the leading cause of this disease.This increases consumption and reinforces the addictive behavior.Hand-rolled tobacco in a tamburi leaf tied with colorful strings on its ends....

Chemistry and Water Cycle 2024-10-13

29 Items: Group 1 Metalsreactions with oxygenAll frozen water on the EarthSum of all water found on EarthSubstances containing non-metalsSubstances only containing metalslayer of the planet where life existsthe substances produced in a reactionThe horizontal row of the Periodic Tablemeasure of the amount of water in the air...

Names from the Class 2024-05-21

12 Items: Snowy's humanStockroom heroMakes RCO₂H from ROHMore substituted alkeneViktor's C-C bond forming name reactionThe other voice in the IR video tutorialAte the edible chemical in a safety demoSilent scientist in the always in the labOne of the voices in the IR video tutorialDraw this projection to visualize E2 anti-beta H...

Illuminated Books 2024-09-30

11 Items: Pens used by the MonksMonks who wrote the TextsNatural Chemical used for ColouringMarks made in the Margins of a BookRich Aristocrats Commissioning WorksThe Person who Invented The Printing PressDistinctive style of Illuminated ManuscriptsBeing Unrelated or Neutral in regards to ReligionByzantine Illuminated Manuscript dating from the 10th Century...

Psych/Psyche 2025-12-08

9 Items: mind spirithuman soul or mindoccurring within the mindstrange and weird, like hallucinationsa spiritual guide for souls to the place of the deadaffecting the mind, especially a medicine or chemical substancedescribing illness with physical symptoms but apparently mental causes...

Seasonal Affective Disorder 2026-01-12

19 Items: Sleeping more than usualTrouble thinking clearlyLow energy or sluggishnessTool used in light therapyBrain chemical tied to moodConstant feeling of tirednessFeeling opposite of energizedDaily habits that support moodEmotional heaviness or low moodStrong desire for certain foodsLack of this can trigger symptomsProfessional mental health support...

Energy Transformations & Transfers 2024-10-16

14 Items: Energy in atomsEnergy of motionEnergy stored in breadEnergy at the top of a hillA middle point on a pendulumKinetic plus potential energyA form of electromagnetic radiationEnergy changing from one type to anotherEnergy moving from one object to anotherEnergy that an object gives off as it movesWe cannot make more energy or _________ any...

CJ 1 Chapter 2 Vocab 1 2023-06-23

11 Items: group exhibiting certain valuessociety creates crime and criminalstreats drug abuse as a mental illnesscriminal who commits multiple offensescriminal laws are designed by those in powerdrug offenders harm society by their actionsthoughts and actions are attributed to unconscious motives...

Common Drug Classifications and Names 2026-02-10

14 Items: Prescription neededExact molecular formulaGeneral name assigned by USANNo purchasing restrictions by FDAAppears in the official referenceConditions drug shouldn't be givenUsed in a way not indicated by FDADescription of cellular changes that occurCopyrighted and used exclusively by that companyOther drugs or food that may alter effect of drug...

7th Energy Word Search 2025-11-18

21 Items: Stored energyBall on a hillEnergy in motionFossil fuels, foodEnergy through heatSpring or rubber bandCurrents in a circuitStored in the nucleusCar moving, skateboardPart that is being studiedMovement of thermal energyHeat transfer through fluidsEverything outside the systemHeat transfer through direct contactLight, electromagnetic waves from sun...

Infection Control 2022-11-02

20 Items: To dispose ofSafety Data SheetAn item that is reusableAn item that is disposableAmount of time to disinfectQuaternary Ammonium CompoundsThe ability to produce resultsEnvironmental Protection AgencyThe transfer of harmful bacteriaCaused by streptococcus bacteriaCan be used again and disinfectedKills certain pathogens on surfaces...

Sociology Chapter 4 Vocabulary 2025-01-28

13 Items: the process of learning to participate in a groupthe part of the self formed through socializationset of individuals of roughly the same age and interestschildren begin to imitate behaviors without understanding whychildren begin to act in ways they believe other people wouldmeans of communication designed to reach the general population...

Ch. 6 word search 2025-04-11

10 Items: ____ is a another word for your feelings.People who have ____attitudes are more likely to be active.Moderate physical activity is equal in intensity to brisk ____.The MET is a term used to describe the ____ of physical activity.Getting enough regular physical activity is important in maintaining a healthy ____....

Relativeatomicmass Word Search 2025-09-21

38 Items: two or more atoms bonded togetheratoms with the same number of protonscolumns going down the periodic tablerows that go across on the periodic tableA spherical orbital found in all energy levels.Outer most shell that is occupied by electrons.Electrons occupy orbitals singly before pairing up.A substance formed as a result of a chemical reaction....

Most Common Words That Start With C Part 1 2025-05-02

119 Items: cancapcarcatCEOcakecallcampcardcarecasecashcastcellchefchipcitecityclubcluecabincablecarrycatchcausechainchairchartchasecheapcheckcheekchestchiefchildcivilclaimclasscleanclearclimbclockclosecloudcameracampuscancercarboncareercenterchancechangechargecheesechoicechoosechurchcircleclientclinicclosercabinetcapablecapitalcaptaincapturecarefulcarrier...

Culture shock in an unlikely situation: Australia to Canada 2025-06-05

5 Items: Kind or pleasant, as Canadians are known for.A chemical used for washing dishes or clothes.Not ready (how Emily felt when she moved to Canada).Easy to see or understand (Where garbage bags were not)A large group of people (it can be hard to get in THIS)

Writer 2022-11-05

11 Items: the lower jawsurgical removal of bone or tissueswelling; usually secondary to infectionsubstance that joins two or more surfacesa relatively narrow tubular passage or channelthe hard and soft tissues forming the roof of the mouthlightening of the teeth using a chemical oxidizing agentmissing tooth structure due to decay, erosion or abrasion...

Food Safety Chapter 1 2025-08-28

11 Items: a bad microorganisma hazard like bleacha type of temperature abusea hazard like hair or plasticbacteria like parasites or moldanything in your food that doesn't belong therepoor personal _____, not washing hands regularly____illness, an illness you can get from eating bad fooda very small living thing only seen through a microscope...

Health and Wellness 2025-05-30

10 Items: The state of being in good health.The body's ability to resist diseases.Emotional and psychological well-being.Practices that keep you clean and healthy.A shot that helps protect you from diseases.The process of absorbing enough water for health.The condition of being physically strong and healthy....

Neurons!!! 2023-11-30

13 Items: places on axon with no myelinmain control center of a neuronsends message from cell body to knobgap between a neuron and another cellwhen the axon briefly becomes positivefingers of cell body sending message incovering on axon that speeds up messagessends chemical message across the synapsepotential when the axon is negative inside...

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substanceenergy in the form of heatenergy associated with motionable to dissolve other substances.the basic unit of a chemical element.the degree of compactness of a substancethe speed of something in a given direction.the rate of change of velocity per unit of time.the ability to be dissolved, especially in water....

Intro to Physics and Matter & Interactions 2023-06-15

7 Items: Career related to Physics.Any quality or characteristic.Physics studies the ________ world.Everything around us is made of _______.Is used in Physics to model observations and make predictions.An example of a chemical property of matter. Related to how dangerous a substance can be....

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substanceenergy in the form of heatenergy associated with motionable to dissolve other substances.the basic unit of a chemical element.the degree of compactness of a substancethe speed of something in a given direction.the rate of change of velocity per unit of time.the ability to be dissolved, especially in water....

LC Food Safety Word Search 2026-02-04

20 Items: Keeping TCS foods at 135°F or aboveA microorganism capable of causing diseaseFood proteins that cause allergic reactionsReducing pathogens on a surface to safe levelsTracking food through all stages of productionUsing acidity to prevent or slow pathogen growthEnsuring devices like thermometers measure accurately...

Mass Word Search 2024-05-17

13 Items: The main liquid on our planet.The point at which liquids boil.A chemical reaction that is very hot.The things that make up our universe.Vaporized liquid as a result of boiling.How much gravity pulls down on something.the degree of compactness of a substance.How fast something or someone is traveling.The resistance that stops objects from moving....

Unit 8 2024-04-25

9 Items: Reprocessing of waste into new, useful productsFlow of all wastes produced by the average persontype of waste with mostly household and commercialtype of waste with mostly chemical and constructiontype of waste with manure, crop residue, dead livestocktype of waste with tailings, overburden, broken equipment...

Skin Disorders 2025-02-11

15 Items: An intense itching sensation.Small, flat, discolored spots on the skin.Skin abrasions caused by repeated scratching.A collection of pus that forms due to bacterial infection.An oily substance secreted by glands to keep skin hydrated.Immature parasitic insects or worms, which can cause skin infections....

Karina and Coffee Facts 2026-01-13

20 Items: Her ageA green nutHer favorite colorEspresso with hot waterHer favorite type of foodEspresso with steamed milkAnimal she is allergic tooI am a dog who loves to eatI am a dog who hates to eatPoet who's known for ravensA tiny strong shot of coffeeFavorite Disney princess movieWho's birthday are we celebratingHer favorite slow and lazy animal...

Photosynthesis Word Search 2024-11-27

41 Items: , What gas is taken into the lungs during inhalation?, What are substances that absorb light energy called?, What is the voice box that contains the vocal cords?, What gas is released as a by,product of photosynthesis?, What is the tube that connects the throat to the lungs?, What is the primary source of energy for photosynthesis?...

Equalforces Word Search 2025-12-16

17 Items: to take inwhen light bendsto bounce off a surfacea form of energy we can seean object that stores energya form of energy we can hearthe stored energy an object hasforces that have the same strengthforces that have different strengthsa device that opens and closes a circuita form of energy measured by temperature...

Biology S1 Exam Review 2024-12-11

31 Items: water lovingself feederssplitting wateradding phosphatesplitting glucoseenzyme that makes ATPaffinity for electronsmore stiff fatty acidsreaction releases energyorganelle that holds DNAcycle with Acetyl CoA inputtransport that requires energybreaking down larger moleculesNADH and FADH2 are electron...organelle that synthesizes proteins...

Dynamics Word Search 2022-06-18

98 Items: machohmspowervoltsrangetensioninertiavoltagecurrentamperesammeterdynamicscircuitsvectors-distancenet-forceradiationhalf-lifeharmonicsohm’s-lawvoltmeterkinematicsbeta-decaysoundwavessupersonicresistancemax-heightforce-fieldlatent-heatatomic-massalpha-decaygamma-decayreflectionswavelengthselectricitynormal-forcetrigonometrydisplacementacceleration...

Atoms & Molecules 2025-11-06

14 Items: The study of matterAtoms joined by sharing electronsMade when atoms join with other atomsAbbreviations for the names of elementsType of reaction where molecules combineAnything that has mass and takes up spaceThe number of protons in an atom's nucleusAn atom that has gained or lost an electronA system of classifying the various elements...

Energy Review Word Search 2025-05-12

9 Items: Energy possessed by hot objects.Form of energy possessed by moving objects.Energy stored by doing work against a force.Energy stored in chemical elements and compounds.A way energy is transferred in the form of sound.A way to transfer energy using an electric current.Energy stored by lifting an object against gravity....

education 2025-10-27

19 Items: Synonym of test.The study of numbers.To study for an exam.A mark on an exam or course.School after primary school.The opposite of public school.The days and times of classes.The opposite of pass (a test).After an exam, you get the _____.University graduates have a _____.A period of time in a school year.The study of novels, plays, poetry....

Health and Wellness 2025-04-14

10 Items: WELLNESS : The state of being in good health.IMMUNITY : The body's ability to resist diseases.HYGIENE : Practices that keep you clean and healthy.MENTALHEALTH : Emotional and psychological well-being.VACCINATION : A shot that helps protect you from diseases.HYDRATION : The process of absorbing enough water for health....

Energy Word Search 2025-11-17

24 Items: Heat energyLight energyTop of a waveHow energy movesHeight of a waveBottom of a waveHow energy movesEnergy due to motionBaseline for the wavesBall rolling down a hillEnergy in food and batteriesEnergy in moving machine partsHow often a wave passes a pointDistance between repeating pointsEnergy stored in the nucleus of atoms...

Camp Tucker Week 7 - Science Week Word Search - 2 2025-07-17

132 Items: DNAATOMCELLDATAFACTHEATIDEALAWSLIFEMASSCLAIMEARTHFORCEGENESGRAPHLIGHTMODELPHASEPLANTSCALESOUNDSPACEANIMALBEAKERBONDEDBOTANYBURNERENERGYFOSSILFUNNELLIVINGMAGNETMATTERMOTIONRECORDRETORTTHEORYTISSUETRACESANALYZEBIOLOGYBURETTECLIMATECUVETTEDIAGRAMDIORAMAELEMENTGEOLOGYGRAVITYMEASUREMINERALMIXTURENATURALOBSERVEPHYSICSPIPETTEREMAINSRESULTSSCIENCEZOOLOGY...

Acidrain Word Search 2026-02-25

129 Items: AirOilSeaLakeLifeRainReefSaveSeedSmogSoilWindAlgaeEarthFaunaFloraGlassOceanPaperPlantPolarPowerReuseSolarToxinTrashWasteCanopyCarbonDesertEnergyFilterFlowerForestGardenGlobalHazardIcecapImpactJungleLitterMarineMeadowNativeNatureOxygenPlanetReduceBalanceBiofuelBiomassClimateCompostDroughtEcologyErosionGarbageGlacierHabitatHarvestMethaneNatural...

Spelling list 2024-05-23

20 Items: nation wideattracts metalan act of movingand area of groundany basic substancenonmechanical deviceright now or presenta process in the bodyto represent somethinga way to measure energyphysical force on somethingspeaking between each othersomething that happens anuallyconnect with someone or somethingused in ordinary or basic conversation...

The Great Big Search - Yr 8 2025-12-18

134 Items: GoldZincAtomIronMeltHeatFlowRateCoreRingFireLavaRockGroupWaterMetalLightSoundWasteWavesCellsHeartLungsNasalVilliSmallLargeCrustOuterInnerFieldScaleFocusVentsMagmaCyclePeriodSilverVolumeDiluteMatterSankeySystemSexualSeptumLarynxCavityPlasmaMantlePlatesElementMixtureProductMercuryDensityKineticElasticDiagramThermalNervousTendonsBronchiTracheaPharynx...

Unit 1 Review 2024-09-03

10 Items: When energy is movedThis is stored energyThis is the energy of motionThese carry energy from one place to anotherType of energy stored in the bonds between atomsWhat it's called when energy changes from one form to anotherThis is done to an object to give it Elastic potential energyGravitational potential energy is affected by these two things...

Chemical compounds 2025-12-11

1 Item: acid

The carboniferous period 2023-10-05

10 Items: Lasted about 60 million yearsthe big land mass before pangeabefore it was called just oxyegeneplant from the carboniferous perioda supercontnant formed from gondwanaa sea animal during the carboniferous periodcorals One of the carboniferous periods animalsa reasource from the earth that is nonrenweable....

October Safety Puzzle 2024-10-02

10 Items: Manifests contain 4 key (8).Retain manifests for (4) years.DOT stands for Department of (14).RMW stands for regulated medical (5).All hazardous material must be accompanied by (9).The name of the company that takes our sharps is (10).There are (4) classifications for hazardous materials....

Aaron Word Search 2024-09-03

73 Items: MeOTSOrbSrlYouModsGuysBabyDanaDaveSormFarmjackSprayBocksTowerHeHowRiverPtreeRealmSwockMelonsFUCKERSpringTraceyFasterLinmanPhaserSorm'sTrenchAtlantaChromerFramingGluemanHatreonHuntersPodcastRealmerof LarryChemicalFabriciaMeMoreTVWilliamsWagstaffSkelCorpBeastingAndersonCurtainsCivil WarBleichnerNewsWorldQuikLinksTeaseballTurkeymenBong GamesStephenson...

Chemical Engineering 2025-10-20

1 Item: the unit of measurement

Atoms 2024-01-07

13 Items: The fundamental unit of a chemical element.High-energy photons generated by radioactive decay.A solid material made of atoms arranged in a geometric pattern.A chemical element with the same number of protons but different numbers of neutrons.An atom or molecule with a net electric charge due to the loss or gain of an electron....

Proteins and Fats 2026-01-19

12 Items: A fat-protein unitThe main part of a fatty tissueHelps body grow and repair itselfThe basic building blocks of fatsA food that lacks one or more animo acidsAn animo acid your body needs but cannot moveA food that contains all nine essential animo acidsA chemical process that turns vegetable oils into solids...

Science Word Search 2023-05-24

144 Items: phgaseoneradnaatommasscoalsoilacidbasemoldcastgenecellpreysolidsolarshoreepochtracetoxinvirusfunginicheliquidenergyturbidperiodfossilhazardvectormarinescienceelementformuladensitythermalnuclearsolventaquiferestuarygeologyspeciesextinctproteindiseaseprotisthygienecaloriehabitatfoodwebmoleculesolutionequationchemicalsalinitygeneticsgenotypegenetics...

Semester 1 Review 2025-12-16

29 Items: Stored energyEnergy of motionHow shiny an object isElements that are malleable and ductileSum of all forces that act on an objectForce that pulls towards the center of massType of force that attracts or repels metalsThese elements are brittle and bad conductorsWhen energy is moved from one place to another...

PIP PPE Safety Experts? 2025-03-28

20 Items: PIP ______ SafetyLightweight 40 Cal suitDynamics full brim hard hatElectrical glove protectionOldest Glove Brand in the U.S.Pre-curved finger welding glovePIP Brand for new 21 gauge glovesWorld's first sustainable earplugPIP's proprietary engineered yarnsHigh performance protective footwearPIP's top brand of protective eyewear...

Coating Vocab 3 2025-06-17

9 Items: A flaw or imperfection in a product.Cutting a wide web into narrower rolls.Material that is discarded during production.Bonding two or more layers of material together.Periods when equipment is operating and productive.Applying a liquid or semi-liquid material to a substrate's surface....

Silence Word Search 2026-02-01

1 Item: – imagined – visible – improvement – patience – individuals – immediate – effort – frustration – outcomes – weakens – maintain – focus – impulsive – steady – reactions – resilience – consistency – regularly – meaningful – sustainable – achieve

Recycling Word Search 2025-09-10

7 Items: something that is suitable or safe to eatto reuse or make (a substance) available for reusesomething that is impure or makes something else impureliving, active, or occurring only in the presence of oxygenprecipitated solid matter produced by water and sewage treatment processes...

Matter Vocabulary 2026-02-08

19 Items: a characteristic of matteran individual particle of an elementon a scale that people can see with their eyesthe connection between atoms in more complex particlesa property that describes the mass of a certain volume of mattermatter that has a constant chemical composition and characteristics...

Joint Commission Readiness Word Search 1 2023-12-14

13 Items: You can find policies on __ ___.A code black is called for a ___.Informed consent is obtained by the ____.If a patient is suicidal you call a ____.The SDS for any chemical is found in ___.Glucometer test strips are good for ___ ___.What is the wet kill time for purple top wipes?How long do you have to report critical results?...

Energy 2023-06-14

20 Items: Energy linked to fuelThe rate of work doneVariable that you changeEnergy linked to movementVariable that you measureAlso know as thermal energyEnergy linked to luminous objectsPotential energy in raised objectsThe unit of measurement for energyEnergy cannot be created or _________Energy found in the nucleus of an atom...

Chapter 1 - Organ systems 2025-12-01

10 Items: The ... system coordinates the body's actions.The ... system moves the body and produces heat.The ... system exchanges O₂ and CO₂ in the lungs.The ... system supports the body and produces blood cells.The ... system filters toxic waste materials from the blood.The ... system secretes hormones, which act as chemical messengers....

Chapter 1 - Organ systems 2025-12-01

10 Items: The ... system coordinates the body's actions.The ... system moves the body and produces heat.The ... system exchanges O₂ and CO₂ in the lungs.The ... system supports the body and produces blood cells.The ... system filters toxic waste materials from the blood.The ... system secretes hormones, which act as chemical messengers....

Mole Day 2023-10-23

10 Items: a mole is like a chemical '_____'a single unit of an ionic compoundthe mass of one mole of a substancea single unit of a covalent compounda unit used in chemistry to count particlesthe smallest particle of a substance that is not bondedthe scientist that the number 6.022x10^23 is named after...

Biology final review 2022-12-15

24 Items: Center of cellBasic unit of lifeNegatively charged ionsolute is dissolved inIndividual living thingconcentration of H ionsProduces hydroxide ionsSubstance that dissolvedforms H ions in solutioncontains one type of atomDiffer in number of neutronsEvenly distributed componentsSmallest functional unit of lifeElectrons are shared between atoms...