chemical reaction Word Searches

Voca 6000 Lesson 5&6 Review 2025-09-12

18 Items: to direct or control (v)to fill something again (v)high public value or respect (n)to put off until a later time (v)without any question or doubt (adv)one step in the movement of walking (n)able to happen, exist, or to be done (adj)relating to people who do not have jobs (adj)to bring back from memory; remember; recall (v)...

Nervous System 2023-02-05

14 Items: action under our controlThe largest part of the brainregulates blood pressure and breathingconnects your brain to your spinal cordextends downward from the base of your brain.voluntary control of body movements via skeletal musclesbest known for its role in responding to dangerous or stressful situations...

Neuron Word Search 2025-09-17

14 Items: Basic nerve cell that transmits electrical and chemical signals.A neurotransmitter linked to reward, motivation, and movement control.Fatty insulating sheath around some axons that speeds neural conduction.— A neurotransmitter involved in muscle activation, attention, and memory....

First Aid 2025-04-17

54 Items: beneath the top layer of skinHeavy, uncontrollable bleedingA wound that is torn and raggedNot serious; on the surface;shallowDamp,soft,sticky, and unusually coolarrest The sudden stoppage of the heartA snug bandage used to control bleedingAn anti toxin used to counter act venomOintment and bandages applied to a wound...

Dillon Singleton Ch.16 Vocab 2025-04-16

14 Items: Horizontal row in the periodic table.Vertical column in the periodic table.Number of protons in an atom's nucleus.Particle in the nucleus with an electric charge of 1+.Particle of matter that makes up protons and neutrons.Atom of an element that has specific number of neutrons.Electrically neutral particle inside the nucleus of an atom....

Yorkie’s Wordsearch # 1 2023-12-18

42 Items: Water? (4)Cetacean (5)Loiterer (7,5)Steak type (5)I'm extinct (4)Who the ….? (5)Drunk again? (7)Hazel rodent (8)Chocolate bar (6)Aquatic horse (5)Whipping boy (3,5)Chimp perhaps? (6)Pets or spoons (7)Not this way! (2,5)A pan coating (3,5)Urticaria cause? (7)A bit of a pansy (5)Depressed equine (6)French instrument (4)European footwear (5)...

7th Grade Final Review 2025-12-16

34 Items: stored energyball on a hillenergy in motionall living thingsstored in nucleusall water on earthcauses earthquakesability to do workheating of objectsspring or rubber bandcurrents in a circuitwaves, voice, speakercauses seafloor spreadingpush or pull of an objectcar, skateboard, airplaneheat transfer through wavesfossil fuels, food, battery...

Classification of Matter 2026-01-31

20 Items: the smallest unit of an element.the amount of matter in an object.two or more atoms bonded together.the amount of space an object takes up.anything that has mass and takes up space.Change a change that forms a new substancea process where a liquid changes into a gas.the substance that is dissolved in a solution....

different types of energy 2026-04-23

200 Items: ArcGasIonBetaBondDarkWaveWindBeamBlueEddyFluxLambAlphaDecayFermiGammaJouleSolarSonicSoundTidalDriftFieldFluidGluonLaserAtomicFusionImpactPhononPhotonPlasmaStrainVacuumAuroraBiogasChargeDipoleLatentBindingBiofuelBiomassCasimirElasticEntropyExcitonFissionKineticLatticeNuclearOsmoticRadiantSeismicSurfaceThermalAerobicBrakingCaloricCoulombDeficit...

Chapter 6 Word Search 2026-03-26

11 Items: The process of using chemicals to "recharge" an exhausted resin bed.A negatively charged ion ($OH^-$, $Cl^-$) targeted by specific exchange sites.The small, spherical porous structure where ion exchange actually takes place.When organic molecules coat the resin surface, preventing the exchange of ions....

Estates Word Search 2023-11-24

18 Items: 1793, January 21: Execution of _____.1793, October 16: Execution of Marie _____.1789, August 4: _____ abolished in France.1789, May 5: _____-General convened in Versailles.1795: Establishment of the _____, a five-member committee.1799-1804: The Consulate period, with _____ as First Consul....

Elements Word Search 2024-01-17

19 Items: one cycle per minuteouter ring of electronssmallest units of an elementthe steps necessary in a processpositively charged elementary particleselementary particles with no electrical chargethe flow of electrons from atom to atom in a conductorthe movement of electrons being directed through materials...

Pathophysiology - Ch. 15 + 16 Terms 2024-11-05

20 Items: Double visionBlood glucose levels riseParalysis of the upper eyelidA ringing or buzzing in the earsExcessive thirst caused by dehydrationExcessive amounts of ketones in the bloodActivated by a change in chemical concentrationInvoluntary, abnormal rapid movement of one or both eyesStimulates appetite; lack of nutrients entering the cells...

Histology Word Search 2025-10-02

22 Items: inflammation of a glandproduces hormones; no ductsSurgical removal of a glandmicroscopic study of tissuesAbnormal hardening of a glandAny disease or condition of a glandSecretes chemical substances into ductsincrease in bulk of body part/organ due toMalignant tumor originating in glandular tissuecontains cells specialized to contract and relax...

Infection control 2025-10-27

30 Items: A microorganism capable of causing disease.Separating patients to prevent the spread of infection.Completely free of all microorganisms, including spores.A biological substance that poses a threat to human health.A chemical used on non-living surfaces to destroy pathogens.living organism (like a mosquito) that transmits infectious disease....

Let's See What You Know ;) 2024-11-27

17 Items: Uncontrolled cell growthThe body's basic fuel supplyEssential for healthy bones and teethPeople who only eat food from plant sourcesCauses bones to become weaker and break easilyNutrients people take in addition to the foods they eatPeople who eat eggs in addition to foods from plant sources...

Decision Making 2025-02-21

11 Items: to stop developing, growing, progressing or advancingcombination of surroundings, conditions or influencesa thing which is regarded as more important than othersstrategy in which a person goes with their first reactionstrategy in which a person hands over control or lets someone else decide...

6th Grade Final Review 2025-12-12

33 Items: stored energyball on a hillenergy in motionhow energy movesall living thingsstored in nucleusall water on earthcauses earthquakesheating of objectsability to do workspring or rubberbandcurrents in a circuitwaves, voice, speakercar, skateboard, walkingcauses seafloor spreadingpush or pull of an objectprocess of changing position...

Nutrition Word Search 2026-05-14

20 Items: Units that measure the energy in foodTissues that contract to help you moveThe study of how food affects your bodyDrinking enough water throughout the dayThe 206 bones that give your body its structureThe feeling of being overwhelmed or under pressureThe overall state of being healthy in body and mind...

Decision Making 2026-01-09

11 Items: To stop developing, growing, progressing or advancingCombination of surroundings, conditions or influencesA thing which is regarded as more important than othersStrategy in which a person goes with their first reactionStrategy in which a person hands over control or lets someone else decide...

Chemistry, Physics, and Energy 2023-05-14

20 Items: measured in Newtonsmeasured in mL or cm^3they make up the periodic tablemetals are good examples of thesethe first step in the water cyclethe formula for it is mass/volumeplastics are good examples of thesethe formula for it is distance/timea phase change, the opposite of depositionthere are two types of it-positive and negative...

6th Grade Final Review 2025-12-12

33 Items: stored energyball on a hillenergy in motionhow energy movesall living thingsstored in nucleusall water on earthcauses earthquakesheating of objectsability to do workspring or rubberbandcurrents in a circuitwaves, voice, speakercar, skateboard, walkingcauses seafloor spreadingpush or pull of an objectprocess of changing position...

Qualitative Word Search 2026-01-07

20 Items: Mass per unit volumeAmount of matter in an objectType of data that involves sensesA proposed explanation for an observationThe sub-atomic particle that has +1 chargeThe substance in which the solute dissolvesUsed to separate coloured substances in inkType of data that involves measurements being taken...

QUIZ 2025-11-28

15 Items: Who pioneered the technique of PCR?Who is known as the Father of Genetic Engineering?What type of tertiary structural protein is Keratin?Which is the least abundant Granulocyte in our body?Which family of organism does Dengue virus belongs to?Gout's disease is caused due to higher accumulation of?...

Chem-is-tree Holiday Word Search 2024-12-18

14 Items: Major flavor component of clovesMajor flavor component of cinnamonThe alkaloid compound found in mistletoeThis compound gives ginger its pungent odorThe chemical in peppermint that makes your mouth feel coldType of compounds that give poinsettia leaves their red colorThis Group 13 Period 4 metal is frequently found in LED lights...

Pool Safety Word Search 2025-06-04

15 Items: Always read this before using any pool product. (5 letters)Important to have when handling chemicals indoors. (11 letters)What you use to keep the pool water clean and safe. (8 letters)A common disinfectant, dangerous if mixed with acid. (8 letters)A cool, dry place where pool products should be kept. (7 letters)...

Energy Science Efficiency & Systems 2026-03-31

15 Items: What element is the primary component of coal and oil?Which Law of Thermodynamics states that energy is conserved?What is the unit of energy often used to measure heat in food?What is the unit used to measure the flow of electric current?What is the ratio of useful energy output to total energy input?...

No Backwards Parts of Speech Word Search 2026-01-14

12 Items: A general word used in sentences.A specific noun we already know about.A word before a noun that relates to any general item.Word or sound that shows a sudden feeling or reaction, like "Wow!"A word before a noun, beginning with a vowel relating to any general item.Words that connect, add to, or change sentences and add sentence structure....

Melting, Word Search 2024-05-13

1 Item: FAMILY, COMPOUND, PROTON, PHYSICAL CHANGE, GAS, MATTER, CHEMICAL CHANGE, FREEZING, NEUTRONS, MOLECULES, ELEMENT, SOLID, PRODUCT, ATOMS, GROUPS, NUCLEUS, METALS, PLASMA, PERIODS, LIQUID

ENGINEERING + 2024-08-20

1 Item: AERONAUTICAL BIOMEDICAL SOFTWARE COMPUTER MECHANICAL ELECTRICAL CHEMICAL SAFETY DANGER FALL LOUD FIRE MEDICAL FORKLIFT GLOVES EYEWEAR HEARING BREATHING RADIATION RESPIRATOR EMERGENCY

Nutrition 2026-03-26

18 Items: Eats both plant and animal productsDoes not consume any animal byproductsThe first meal after a period of fastingA potential unit of heat energy from foodConsumes animal meat and animal byproductsCompound that provides nourishment to the bodyMacronutrient that has lowest affect on insulinPlant based diet, but may consume animal byproducts...

Rhetorically 2023-11-09

15 Items: The author’s attitude when writingRepetition of a beginning phrase (“I have… I have… I have…”)Using highly detailed language that appeals to the five sensesOffering specific details or instances as a way to support a claimGiving compliments to someone in order to win their good favor/affection...

Persuasive Devices Word Search 2023-07-27

18 Items: “All teenagers are lazy and rude!”“We met in 1999 when I was at University”Gets an emotional reaction from the reader“The Prime Minister is a total raving idiot”“All famous people live rich and exciting lives”“A teenager swore at me on the train. How lovely!”Suggests the reader must always support their country...

1.02 2025-05-13

37 Items: Refers to fabric right off the loom.used on polyester and acetate fibers.Compounds that penetrate and color fibers.Combines both roller and screen printing methods.applied to the fabric make them inedible to moths.Ink jet based method of printing colorants onto fabric.Resistance resists the growth of mildew and other molds...

Week 3 Review by Sharli Syed 2023-09-25

17 Items: What a substance is when it has a pH of 7._______ compounds are compounds that contain carbon.Simple sugars; links together to form carbohydrates.Breaks down monomers, separating them by "adding water."Substances that have an excess of H+ ions; pH less than 7.Measure used to express how basic or acidic a substance is....

Muscles 2024-09-19

14 Items: The starting point of the muscleWhere the muscle inserts on the boneThick fleshy central part of the muscleJunction between the nerve fibre and the muscleConnective tissue sac filled with synovial fluidChemical that transmits the impulse across the gapWhen a muscle is used or exercised and becomes bigger...

1. Word Search 2025-03-17

1 Item: Chemical Characteristics 2. Cladogram 3. Dichotomous key 4. domain 5. Genus 6. Kingdom 7. Physical Characteristics 8. phylum 9. species 10. taxonomy

Treaty of Versailles Ceviche Style 2025-09-04

21 Items: German airships used for bombing raids.Prevented supplies from reaching Germany.Peace treaty ending WWI; punished Germany.Union between Germany and Austria forbidden.Used by Germany to sink Allied supply ships.German emperor who abdicated in November 1918.(Nov. 11, 1918)Agreement to stop fighting WWI.Payments Germany owed to Allies for war damage....

WBGT and Heat Illness Prevention 2025-05-01

25 Items: a recommended strategy to avoid heat illness.the key recommendation when WBGT is moderate.The NATA statement on exertional heat illness.this term is associated with heat from the sun.an action needed when WBGT reaches Extreme Risk.component measured by a thermometer in the shade.The heat stress level that can lead to heat stroke....

Abandon, Word Search 2026-03-13

2 Items: ability, able, absolutely, academic, accept, access, accommodate, account, accurate, achieve, acknowledge, acquire, activity, adapt, addition, administration, adopt, advance, advantage, adventure, advice, afford, agency, aggressive, agree, aid, aircraft, ...

hi 2024-05-17

14 Items: the circular motion of an object around its centerthe amount of space occupied by a sample of matterThe SI derived unit used to measure energy or work.a positively charged region at the center of the atoma chemical element with symbol Ag and atomic number 47.a force which tries to pull two objects toward each other...

Griffith Observatory Glossary 2023-11-14

20 Items: a fluid state of matterthe study of space & everything in itthe layer of gas that surrounds Earththe 6th element & chemical basis for lifea place for observing & studying objects in spacea pure substance containing only one type of atoma celestial body of gas that generates light & heata zone around a star where temperatures are just right...

Force and Motion 2023-11-27

20 Items: Unit of ForceA push or pullDistance over timeThe amount of matter in an objectDistance over time with a directionAn object's resistance to change in motionthe measurement of paths taken by an objectthe action or process of moving or being movedSpeeding up, slowing down, or changing direction...

May 2025 Wordsearch 2025-05-02

20 Items: the ability of an organism to resist diseasetreatment intended to relieve or heal a disorderthe invasion of the body by harmful microorganismsthe process of returning to a normal state of healththe identification of the nature of an illness or problemthe action of stopping something from happening or arising...

Bio 10 Lesson 2.1/2.2 Vocabulary Word Search 2025-10-05

23 Items: Center of an atomThe basic unit of matterBond that opposites attractBond that shares of electronsScale that values from 0 to 14Dissolving substance in a solutionNegatively charged subatomic particleSubstance that is dissolved in a solutionAtom that has a positive or negative chargeMixture of water and non-dissolved material...

Aaaa 2025-12-01

40 Items: - first step of respiration-A molecule that helps form acetyl-An organism that can create its own food-Respiration that uses oxygen to make atp-Organisms that must have oxygen to survive-part of the light reaction that makes nadph-the energy molecule cells have which do work-Organisms that don’t quite need oxygen to live...

Unit 9 Vocab Review 2026-05-12

12 Items: _________ pushes and pulls electrons through a circuit._____ is also called ampere; the unit of current; symbol = A______ ____ is the buildup of electrical charge on a material_________ ______ are waves that can only travel through a medium___________ is a measure of energy in a wave; the more energy a wave carries greater amplitude...

Endocrine System word search 2026-05-04

10 Items: refers to the conditions outside an organism's body or its individual cells.a ductless organ that synthesizes and secretes hormones directly into the bloodstreamis a ductless organ that synthesizes and secretes hormones directly into the bloodstreama pair of small, triangle-shaped endocrine glands located on the superior aspect (top) of each kidney...

Science: Word Search 2024-08-18

19 Items: Living planetThe study of lifesignal to which an organism respondsthe variable that is deliberately changed.A single organism produces offspring identical to itself.all other variables should be kept unchanged, or controlled.logical interpretation based on what scientists already know....

4TH QUARTER SCIENCE VOCABULARY WORD SEARCH 2024-04-03

1 Item: SOIL, IGNEOUS, SEDIMENTARY, METAMORPHIC, WEATHERING, MECHANICAL, CHEMICAL, EROSION, QUARRYING, MINING, LANDSLIDES, WEATHER, CYCLONE, DEPRESSION, STORM, TYPHOON, MOON, PHASES, CRESCENT, GIBBOUS, WAXING, WANING, STARS, CONSTELLATIONS

ch 4 vocab 2025-02-26

15 Items: Rate at which energy is converted.Energy that is due to chemical bonds.Machine that does work with only one movement.The ability to cause change, measured in joules.Energy a moving object has because of its motion.States that energy cannot be created or destroyed.Transfer of energy when a force is applied over a distance....

Health 2025-10-27

17 Items: A disease that destroys alveoliAn addictive drug found in tobaccoAir that has been contaminated by tobacco smokeA thick,dark liquid that forms when tobacco burnThe smoke that a smoker inhales and then exhalesThe blue in the throat that takes air to and from the lungsA colorless,odorless,poisonous gas produced when tobacco burns...

Chapter 15 - Key Terms 2023-11-01

10 Items: Mucous membranes of the eyes.A process of cleansing to remove undesirable debris.Complete destruction of organisms after they leave the body.The complete destruction of organisms before they enter the body.Date after which a product is no longer effective and should not be used....

World War 1 2025-03-20

12 Items: An explosive used to destroy submarines.Monetary payment is used to right a wrong.Naval submarines used by Germany in World War 1.A position of remaining neutral in times of conflict.African-American Regiment that fought on the front lines of World War I with the French....

GENETIC AND ENVIRONMENTAL IMPACTS ON GROWTH 2025-10-04

15 Items: HOW GENETIC TRAITS ARE "SEEN"DIET, EXERCISE, STRESS, AND EXPOSURE TO TOXINSINCREASE OF RISK POSED BY A GENETIC PREDISPOSITIONREDUCTION OF RISK POSED BY A GENETIC PREDISPOSITIONCERTAIN CHEMICALS CHANGE THE CHEMICAL BEHAVIOR OF DNA _____THE PASSING DOWN OF CHROMOSOMES AND GENES FROM ONE GENERATION TO THE NEXT...

Human-Environment Settlement 2023-05-04

32 Items: to give support toremoval of all treesarea turns to a deserteffort to restore forestsraising of animals for foodelectricity powered by waterremoval of salt from seawaterwide variety of life on Earthhaze caused by chemical fumesresource that can't be replacedpermanently frozen layer of soilrich soil made up of sand and mud...

lab safety 2025-12-15

1 Item: goggles, lab coats, accidents, hazards, sink, eyewash stations, fire extinguisher, chemical storage, fire safety, No horseplay, label containers, professional behavior, walk always, no food, no drinks

Social Studies Interim Review 2026-02-19

20 Items: branch that makes lawsbranch that enforces lawsbranch that interperets lawsgave all men the right to votethe unruly act of skipping schoolthe science or practice of farmingamerican white supremacist hate groupamendment that formally abolished slaveryyou have to be 21 to join this house in georgiaa crime that results in less than a year in jail...

Motion Word Search 2026-05-14

20 Items: The rate of change of velocityMass per unit volume of a substanceA push or pull acting upon an objectthere is an equal and opposite reactionThe maximum displacement or height of a waveThe number of waves passing a point per secondThe speed of an object in a specific directionEnergy stored in an object due to its position...

Heat Word Search 2025-04-10

1 Item: waves, chemical waste, climate change, rising sea levels, deforestation, plastic debris, extinction, endangered species, smog, fossil fuels, renewable energy, carbon footprint, greenhouse gases, environmental pollution, recycling.

5. Cells & Energy 2022-11-02

22 Items: without oxygenSugar (C6H12O6)requires oxygenBasic unit of lifethe outer covering of a cell or organelleget their energy from the sun, example plantsplace in a eukaryotic cell where the DNA is locatedtiny structure that performs a specific job in a celladenosine triphosphate, a molecule that stores energy...

Year 7 so far! 2023-05-26

28 Items: Organelle that contains DNA (n)The smallest unit of matter (a)The force caused by gravity (w)Multiple atoms bonded together (m)Different atoms bonded together (c)Used to separate soluble solids (c)Change of state from solid to gas (s)Type of energy linked to movement (k)The unit of measurement for force (n)Change of state from gas to liquid (c)...

Sewer Word Search 2025-07-15

35 Items: Wet, soft earth.Dead body of an animal.Discarded items, refuse.Oily or fatty substance.Thick, gooey mud or waste.Internal organs, entrails.Black dirt, soot, or filth.Repulsive dirt or pollution.Deep excavation for minerals.Unwanted or unusable material.Slippery black liquid, often crude.Black, sticky road paving material....

S2 Science word search 2025-05-22

20 Items: A living thing. (O, 8 letters)The smallest unit of matter.(A, 4 letters)The flow of electric charge. (C, 7 letters)A group of atoms bonded together.(M, 8 letters)A push or pull acting on an object. (F, 5 letters)The ability to do work or cause change. (E, 6 letters)A pure substance made of only one type of atom.(E, 7 letters)...

Mike Rowe's Dirty Jobs 2025-07-15

35 Items: Wet, soft earth.Dead body of an animal.Discarded items, refuse.Oily or fatty substance.Thick, gooey mud or waste.Internal organs, entrails.Black dirt, soot, or filth.Repulsive dirt or pollution.Deep excavation for minerals.Unwanted or unusable material.Slippery black liquid, often crude.Black, sticky road paving material....

Mike Rowe's Dirty Jobs 2025-07-15

35 Items: Wet, soft earth.Dead body of an animal.Discarded items, refuse.Oily or fatty substance.Thick, gooey mud or waste.Internal organs, entrails.Black dirt, soot, or filth.Repulsive dirt or pollution.Deep excavation for minerals.Unwanted or unusable material.Slippery black liquid, often crude.Black, sticky road paving material....

Young Thomas Edison 2026-04-06

30 Items: the state of being alonea small mechanical devicein the end after some timea person who makes new thingsa sudden uncontrolled movementfeeling let down or discouragedsomeone who was something beforea device that makes sounds louderto give all attention to somethinga machine that plays recorded soundto stop someone from doing something...

Body Systems 2026-04-17

37 Items: master glandstores urineend of bonestop layer of skinproduce antibodiesresponds to stresscontrols metabolismremoves liquid wastefirst line of defenseorgan that pumps bloodattaches bone to musclewhere bones meet togetherfat layer to keep you warmmuscle that helps you movefilter blood and make urinereleases urine from the body...

Abnormality Word Search 2026-03-04

250 Items: egobiasfeargoalhopemoodcaregritcalmbraindrivefocushabitlogicpanicshamesleeptrustworrydreamdriveaffectapathybeliefcopingdenialesteemlibidomemorymentalneuronphobiapsycherecallrewardstresssymboltraumavaluesvisiongrowthwisdomanxietyarousalbipolarbondingdefenseemotionempathyfantasyfeelinggestalthealingimpulseinsightneglectopiniontensiontherapythought...

Sanremo artists 2024-05-21

108 Items: ldabugoemmagaiaModàollyrikiwillarisaclaraelisafasmafedezghaliiramalazzanoemirkomisethusharitoscayumanarieteblancoelodieghemonIl TreLa SadmadamemorganrandomultimobigmamadiodatogeoliergiorgiaIl VololevantemahmoodmaninnirancoretananaiAnna OxaannalisagazzelleGio EvanMåneskinMr. RainColla ZioComa_CosegianmariaMax GazzènegramaroRenga NekErmal Meta...

Young Thomas Edison 2026-04-06

30 Items: the state of being alonea small mechanical devicein the end after some timea person who makes new thingsa sudden uncontrolled movementfeeling let down or discouragedsomeone who was something beforea device that makes sounds louderto give all attention to somethinga machine that plays recorded soundto stop someone from doing something...

Unit 05 Health and safety in the uniformed services 2025-12-11

1 Item: Hazard Accident Safety PPE Fire Firstaid Emergency Legislation Compliance Training Reporting Supervisor Employee, Employer Manualhandling Infection Decontamination Evacuation Protectiveclothing Uniform Boots Gloves Helmet Hygiene Chemical Policy Procedu

ACT Aspire - Vocabulary 2026-04-07

152 Items: heat energystored energya push or pullnumerical dataa change in DNAenergy of motionthe middle valueto judge or assessmass per unit volumethe height of a wavea statement or answerthe numerical averagethe basic unit of lifethe ability to do workheat transfer by wavesEarth orbiting the Suna factor kept the sameconsistency of results...

Chroma Color Workplace Safety 2026-03-11

7 Items: PPE - equipment worn to minimize exposure to hazards that cause serious workplace injuries and illnessesEar Plugs - protective devices inserted into the ear canal to reduce noise, prevent water from entering, or block dust/wind...

GEOLOGIC PROCESSES 2024-08-25

1 Item: Exogenous Weathering Erosion Sedimentation Deposition Endogenous Process Chemical Physical Disintegration Rock Temperature Pressure Decomposition Compound Mineral Soil Atmospheric Oxidation Substance Oxygen Hydrolysis Water Acidification Organism Earth Gr

Grade 3 Speaking Test 2023-05-25

1 Item: Albert, physical, chemical, changes, rollercoaster, quickly, slowly, solid, liquid, gas, exciting, enjoyable, summer, winter, float, electricity, annoying, sound, Science, students, teachers, English, Sinolink, Canada, South, Africa, China, experiment, sp

Particle model 2026-01-28

1 Item: Mass, Volume, Displacement,Irregular,Regular,Eureka,Measuring Cylinder,Particle,Solid,Liquid,Gas,Kinetic,Vibration,Arrangement,Random,Brownian,Collision,Intermolecular,Physical,Chemical,Reversible,Irreversible,Melting,Freezing,Boiling,Condensing,Sublimati

Safety and Sanitation 2023-01-23

22 Items: Maximum safe level in foodSpoilage due to breakdown of fats.Monoxide- Odorless highly poisonous gas.Prevention of illness through cleanliness.Immediate removal of a product from store shelves.Plug- Plug that has one blade wider than the otherBurn- Moisture loss caused by improper chilling out packaging...

Final Exam Review 2023-06-02

34 Items: SI for timeSI for distanceSI unit of forceEnergy of motion.SI unit for energy.Speed plus directionThe change of velocityThe ability to do work.Characteristic or qualityEnergy that will run out.Change of position in timeMercury, Venus, Earth, MarsEnergy of position or stored.Example of a renewable energyJupiter, Saturn, Uranus, Neptune...

MATMAL 25th Anniversary Celebration! 2025-05-29

30 Items: A legendary Malay warrior.Cranio-maxillofacial surgery.The national fruit of Malaysia.The national animal of Malaysia.The empirical formula of glucose.The Empirical formula of Vitamin C.The chemical formula of tin(IV) oxide.The year which Materialise was founded.Malaysian national infused coconut dish.A famous mummy that Materialise printed....

STEM Chronicles 2025 Word Search 2025-12-14

20 Items: The planet 55 Cancri is made up of…First Asian to receive a Nobel prize in physicsThe process through which your brain eats itselfFounder of the Indian Space Research OrganisationTiny particles of pollutants suspended in the airAn amphibian that vomits out its stomach to clean itThe environment which stores majority of carbon underground...

Pathophysiology word search 2025-02-10

15 Items: The result of an invasion by a miteThick and leathery patches on the skinAn inherited tendency toward allergic conditionsassociated with allergic responses and causes itchiness of the skinCommon infection in infants and children but can also infect adultsBenign lesions that are usually associated with aging or skin damage...

Grade 3 Speaking Test 2023-05-25

1 Item: Albert, physical, chemical, changes, rollercoaster, quickly, slowly, solid, liquid, gas, exciting, enjoyable, summer, winter, float, electricity, annoying, sound, Science, students, teachers, English, Sinolink, Canada, South, Africa, China, experiment, sp

Unit 2 Module 1 Review 2026-03-26

1 Item: energy, nuclear energy, thermal energy, sound energy, light energy, vibration, medium, sound wave, longitudinal wave, kinetic, potential, solar cell, radiation, conduction, convection, electromagnetic spectrum, electric current, circuit, conductor, insula

Alcohol Laws 2026-04-03

12 Items: chemical breakdown by bacteria, yeast or other microorganismsbusiness which sells alcohol for consumption at a different locationbusiness which sells alcohol for consumption at the location of sale(ABV) measure of how much alcohol (ethanol) is in a given volume of a beverage...

First Aid Basics 2025-09-02

25 Items: Burns caused by heat exposurePain reliever and fever reducerBurn which damages the epidermisVaccine given to prevent tetanusAutomated external defibrillatorsBurns caused by friction on the skinInitial care given for an illness or injuryWhen a poisonous substance contacts the skinWhen a poisonous substance contacts the eyes...

Firstaid Word Search 2025-09-02

25 Items: Burns caused by heat exposurePain reliever and fever reducerBurn which damages the epidermisVaccine given to prevent tetanusAutomated external defibrillatorsBurns caused by friction on the skinInitial care given for an illness or injuryWhen a poisonous substance contacts the skinWhen a poisonous substance contacts the eyes...

Chapter One Vocab 2025-10-17

20 Items: diseasemicroorganismsmicroscopic living organismscapable of growing and livingsubstance that kills or destroys bacteriaasepsis removal or destruction of microorganismsmicroorganism that requires oxygen to live and reproducehighly pathogenic and disease-producing; describes a microorganism...

Naturalworld Word Search 2023-06-02

34 Items: SI for timeSI for distanceSI unit of forceEnergy of motion.SI unit for energy.Speed plus directionThe change of velocityThe ability to do work.Characteristic or qualityEnergy that will run out.Change of position in timeMercury, Venus, Earth, MarsEnergy of position or stored.Example of a renewable energyJupiter, Saturn, Uranus, Neptune...

MATMAL 25th Anniversary Celebration! 2025-05-27

30 Items: A legendary Malay warrior.Cranio-maxillofacial surgery.The national flag of Malaysia.The national fruit of Malaysia.The national flower of Malaysia.The national anthem of Malaysia.The national animal of Malaysia.The empirical formula of glucose.The national monument of Malaysia.The Empirical formula of Vitamin C....

Work Place Safety 2026-04-10

41 Items: Harm caused during workStumbling over an objectPosted safety informationA potential source of harmKeeping work areas orderlySignal that warns of dangerLoss of footing on a surfaceChance that harm could occurLeaving an area due to dangerUncontrolled release of liquidChecking for unsafe conditionsEquipment used to prevent falls...

Unit 8 APES review 2024-04-30

20 Items: Where over 50% of MSW ends upA common exposure route through the airA common exposure route through the skinA common exposure route through food/ waterIncrease in death rate occurs over a large areaType of waste that is mostly chemical and constructionType of disease not caused by pathogens and can be genetic...

Cells 2025-09-25

23 Items: Organisms with a nucleus.Organisms without a nucleus.Image taken through a microscope.Double membrane that surrounds the nucleus.Organelles that digest and recycle cellular waste.DNA and proteins inside the nucleus in a loose form.Small sacs that transport materials within the cell.Proteins that speed up chemical reactions in the cell....

Cell Word Search 2026-02-14

11 Items: This organelle contains the cell’s DNA and controls gene expression and overall cellular activities.This organelle contains digestive enzymes that break down macromolecules, damaged organelles, and pathogens.This structure is a network of protein fibers that maintains cell shape, enables movement, and organizes organelles....

Types of Engineering 2026-03-04

9 Items: Designs and builds essential infrastructure including buildings, bridges, tunnels, dams, highways, airports, and water/sewer systems.Uses an understanding of electricity, electronics, and electromagnetism to design systems that process information and transmit energy....

Dillon Singleton Ch.15 Vocab 2025-03-18

15 Items: substance with atoms that are all alikechange of one substance into a new substanceheterogeneous mixture whose particles never settlesubstance in which its different components are easily distinguishedtendency for a beam of light to scatter as it passes through a colloid...

Esthetician Vocabulary 102.02 2023-01-18

22 Items: safety data sheetHazzard communication standardenvironmental protection agencySodium Hypochlorite 5.25% ConcentrateDispose of items that can no longer be usedMethicillin-resistant Staphylococcus aureusUsually able to disinfect within 10 minutesoccupational health and safety administrationmaterial that allows liquid or air to pass through...

ch 15 vocab 2025-03-18

15 Items: substance with atoms that are all alike.change of one substance into a new substance.heterogeneous mixture whose particles never settle.substance in which its different components are easily distinguished.tendency for a beam of light to scatter as it passes through a colloid....

Stage 3 A -->F 2025-04-22

31 Items: to pull towardsa very light metalwhat a place is likea young butterfly or mothan animal soon after birthsoak up or take on a liquidstopped from passing throughorganising things into groupsone intake of air by the lungsone push of blood from your heartanimals which eat other living thingswhat your body needs to make you move...