states of matter Word Searches

Lyric genre 2024-11-05

20 Items: stanza with six linespoem with nineteen linesname of a ten syllable line poemit compares by saying one thing is anotherpeople who created lyric poetry in medieval agenumber of verses in the poem Now close the Windowsnumber of stanzas in the poem The House on the HillA figure of speech composed of a striking exaggeration...

Understanding the Atom 2019-09-05

29 Items: ionionatomatomaprotonmatternucleusneutronisotopeelementelectroncompoundjjthomsonnielsbohrproportionjohndaltonmassnumbercathoderaysradioactiveenergylevelsspectrallineatomicnumberelectroncloudjameschadwickfootballstadiumernestrutherfordaverageatomicmassgoldfoilexperimentatomicforcemicroscope

H2O CYCLE 2021-01-12

31 Items: BECGASRUNOFFMASSDEEPCYCLESTATESOLIDOCEANWATERCYCLEMATTERSYSTEMLIQUIDPLASMARECYCLECURRENTSURFACECURRENTSCURRENTSCURRENTSPOROSITYWATERSHEDPERMEABLEPOLLUTIONEVAPORATIONCONDENSATIONACCUMULATIONTRANSPIRATIONPRECIPITATION

What is Weather? 2025-02-07

28 Items: gasairmasswindstateexpandmattersevereweightweatherpressurecompressforecasthumidityparticlevariablepermanentexosphereatmospheremesospherepredictionmeteorologytemperaturetropospherestratospherethermospheremeteorologistprecipitation

Evolution Word Search 2024-11-14

20 Items: LyellAnningLamarckFossilRecordSexualSelectionHomologousStructure"Survival of the fittest"type of bird Darwin studiedchange is a species over timea change in the sequence of DNApreserved remains of an organismselective breeding done by humansdifferences in traits of a speciesmost broad classification of organism...

2nd Quarter Literature 2022-11-25

28 Items: The main character of a story _____________A type or category of literature _____________Prose that tells of real people and events _____________A literary tool to make the audience laugh _____________An expression of one thing in terms of another _____________The major turning point for the main character _____________...

Countries in the World Cup 2022 2022-11-14

29 Items: RicairanqatarspainwalesghanaKoreaStatescanadaArabiamexicopolandbrazilserbiafranceecuadorenglandbelgiummoroccocroatiadenmarktunisiauruguaycameroonportugalargentinaaustralianetherlandsswitzerland

Saffron and Ashley OO 2024-09-17

25 Items: Groom hobbyMonth we metGroom hometownGroom Star SignBride star signBride eye colourFlower girl nameBride birth monthWhere did we meetGroom Middle nameBride middle nameGrooms high schoolNumber of best menMonth of engagementPlace of engagementMost recent concertMother of Bride nameMother of groom nameGrooms favourite carCouples first holiday...

Westward Expansion and Mexican-American War 2025-03-18

20 Items: people that investigate unknown regionsthe northwest section of modern day United Statesa system of mail-carriers that traveled west on horsebacka 2,000 mile trail leading to the west toward Oregon Countryan agreement in which Texas declared Independence from Mexicoa later name for the Church of Jesus Christ of Later-day Saints...

Units 3-4 Vocab 2024-09-24

29 Items: IonAtomMassheatShellChargeEnergyMatterProtonVolumefusionphotonNeutronNucleusOrbitalfissionElectronwavelengthIntelligencekineticenergythermalenergynuclearenergypotentialenergyvisiblespectrumphotovoltaiccellSubatomicparticlehydroelectricpowerelectromagneticspectrumelectromagneticradiation

Challenge 4 Words 2025-01-27

29 Items: readwithtribetheirwritescrewnativegeniusmattervolumedifferreallyheroeswishesapplaudscarvesinstallcultureminoritylanguageholidaysincreasecontinueresearchbiographyhandcraftcountriestemperatureorganization

Science Vocab 2025-03-03

12 Items: to sendto take into give offa substance that takes up spaceto be sent back off of a surfaceany object that lets off visible wavesthe ability to make things move or changethe maximum distance moved by a vibrating wavetransferring energy from one place to the nextdistance between one peak of a wave to the next...

SAFESTART STATES - FRUSTRATED 2016-05-11

12 Items: STRESSERRORSRUSHINGACCIDENTSAFESTARTAWARENESSCLOSECALLLINEOFFIRECOMPLACENTFRUSTRATIONCRITICALERRORSINJURYPREVENTION

AI and AML 2024-10-09

7 Items: ActStatesQualitySubjectiveCloud-basedMorgan Chasepublic-private

Roof Word Search 2023-02-24

26 Items: highest limitdivide into parts.Top of the buildingheavy base supportingsupport building structurecontact two vertical levelsextend from side to side ofthe entrance to a building, roomplace giving temporary protectionvertical brick or stone structurebuilding materials used ascoatingsthe top surface of a step or stair....

Holocaust 2023-03-23

20 Items: Hitler's ideal raceintolerance of others' beliefsa person present but not involvedlawfully removing a group of peoplean act of extreme cruelty and wickednesslacking humanity, pity, kindness, compassionsecret state of police of Nazi occupied Europethe act of getting rid of, especially by killingthe opposition to and discrimination against Jews...

Southeast Region States 2024-11-04

12 Items: GeorgiaFloridaAlabamaVirginiaKentuckyArkansasTennesseeLouisianaMississippiWestvirginiaNorthCarolinaSouthCarolina

Current Events 4-3-25 2025-04-03

34 Items: warallNATOGazatolltradeheavyRubiodeathrisesUnitedStatesstockstumbledamageIsraelgroundviolenttornadoforeigntariffsimportstradingMyanmarArkansasBrusselspartnersresponseSecretaryministersexpandingoperationearthquakenortheastern

Months of the Year 2022-10-16

12 Items: Fill in the blank: April, May, June, ________, AugustWrite the name of the last month of the year. __________Write the name of the third month of the year. __________Write the name of the sixth month of the year. __________Write the name of the first month of the year. ___________Write the name of the second month of the year. __________...

United Word Search 2023-12-10

30 Items: peruiranjapanegyptindiaitalychinaKoreakenyaStatescanadabrazilrussiaAfricamexicofranceturkeyArabiaswedengreecepolandgermanynigeriavietnamZealandthailandcolombiaaustraliaargentinaindonesia

ENVIR 302 Final Project - Technology and its Environmental Impacts 2022-12-08

23 Items: The use of resources.The creation of gases or radiation.The act of getting rid of something.The amount of energy used per unit time.Using less energy to perform the same task.A form of energy resource like coal, oil, and natural gas.An energy resource that is not able to grow again or be made again....

christmas history 2022-12-03

15 Items: A Roman feast celebrating children.In the early years of Christianity, ______ was the main holiday.Christmas wasn’t declared a _______ holiday until June 26, 1870.For some Romans, this god's birthday was the most celebrated day of the year.This reindeer was created to advertise for the Montgomery Ward stores in 1939....

Coloum 2022-09-15

25 Items: A rounded roofThe pillar of a buildingA person who designs buildingsHorizontal member of step (stair)Vertical member of a step (stair)A structure that has a roof and wallsA design plan or other technical drawingA fence or balustrade made of rails and postsThe lower surface of a room that people walk on...

Rojo Word Search 2023-03-07

20 Items: color of grasscolor of the sunMan's best friendcolor of the oceanking of the junglefruits grown on vinestom from tom and jerrySpongeBob lives in onejerry from tom and jerrymonkeys ¨favorite¨ fruithad a color named after itthe color of cirrus cloudsbiggest animal in the worldthe color of stratus cloudsfruit that rhymes with tango...

Pathophysiology, Word Search 2024-09-09

20 Items: something that is subjectivedefects that are present at birththe form and structure of organismsobjective and observed manifestationthe likely outcome or course of a diseasethe increase in severity signs or symptomsthe decreased in severity signs or symptomsthe study of reasons for certain decease phenomena...

Abgeordnete Word Search 2025-01-31

19 Items: lawto forbidto breachjudgementfemale mayorfemale judgeConstitutionto recommendrepresentativefemale citizenmale chancellormale head of stateFederal Armed Forceslower house of parliamentupper house of parliamentFederal Constitutional courtprotection of the ConstitutionGerman Basic Law, constitutionrule of law, state under the rule of law

Voters and Voter Behavior 2022-10-04

25 Items: having an influence on politicsa person with no party affiliationillegal voting or tampering in an electiona person who has been convicted of a serious crimethe practice of voting for candidates from only one partythe practice of voting for candidates of more than one partya set of basic beliefs about life, culture, government, and society....

Unit 4: Spelling Quiz 1 2022-11-29

30 Items: comicaltruthfulnessshowing mercymarking a distinctiona physical disabilitydefiance of authoritythe operation of aircraftto set or keep apart; dividenasty or disgusting in naturean overseer or head of a groupto grasp suddenly and forciblyof a particular person; privatethe pouch which encases a letterthe biological science of animals...

Fourth Grade Rules 2024-06-05

5 Items: mathbandrecessscienceand capitals

8th grade Jillian Griffith 2024-05-15

15 Items: temperature at which a solid meltsCharging an object without touchingtemperature at which liquid freezestype of Matter with fixed compositioncannot be separated by physical meanschange from a liquid to a gaseous statepoint temperature at which gas condenseschange from a solid state to a liquid statechange from a liquid state to a solid state...

Term 1 RE 2024-03-26

16 Items: Ordersspiritbaptismof workcatholicreligionpresenceeucharistmatrimonyimmersionsacramentssimplicityof the Sickconfirmationreconciliationthe way of Mary

Discover Italy 2024-09-03

21 Items: Capital of ItalyItaly's currencyMeans "Cathedral"Italian famous cheeseItaly's national sportSea to the east of ItalySea to the south of ItalyLives in the Vatican CityCity famous for its fashionVolcano that destroyed PompeiTasty meal originated in Naples95% of Italians are this religionA country that borders with Italy...

Jake and Bailey OO 2024-07-10

27 Items: Bailey’s talentName of the bandMother of the brideMother of the groomFather of the brideFather of the groomCouple’s street nameBailey’s maiden nameCity Bailey was bornMonth the couple metLocation of proposalNumber of bridesmaidsHoneymoon destinationJake’s birthday monthNumber of venues touredBailey’s birthday monthJake’s favorite wrestler...

World War 1 Aftermath 2025-01-30

20 Items: founder of fascismeconomy slows downbook Adolf Hitler wroteGermany, Italy, and Japanleader of German Nazi partyfather of modern physiologyJapan longest serving monarchknown for Theory of Relativitystrong leader has full controlfounder of modern macroeconomicsmajor influence of existentalistspresident during Great Depression...

Chapter 3 Vocabulary 2023-10-19

41 Items: Earth's outer layer _____________Earth's thinnest layer______________Earth's innermost layer______________layer beneath the crust __________________when magma reaches the surface _____________layer above the troposphere _____________________water vapor forms water droplets on dust particlesLayer beneath the lithosphere ____________________...

Cleaning/ Word Search 2022-11-01

20 Items: dispose of an itemhow well a product worksan item that cannot be reusedpotent disinfectant chemicalsa chemical used to whiten or sterilizethe process of removing dirt and debristhe process of killing all bacteria and microbesthe process that kills most bacteria and microbesan item that is able to be disinfected and reused...

Estates Word Search 2023-11-24

18 Items: 1793, January 21: Execution of _____.1793, October 16: Execution of Marie _____.1789, August 4: _____ abolished in France.1789, May 5: _____-General convened in Versailles.1795: Establishment of the _____, a five-member committee.1799-1804: The Consulate period, with _____ as First Consul....

chemistry 2 2019-03-18

29 Items: phmattersolutephscaleprotonssolventmisciblemoleculeneutronssolutionlogarithmoxidationsiliconessurfactantssuspensionspuresubstancereducingagentoxidizingagentphysicalchangestatesofmatterphysicalmixtureorganicchemistrythioglycolicacidvolatilealcoholsoxidationreductionphysicalpropertieswaterinoilemulsionoilinwateremulisionvolatileorganiccompounds

Business Words 1 2024-04-03

29 Items: taskbringbranddelayadjustwrapupmatterremarksrevenueperhapsconfirmofftrackworkflowgoodtogoearningsdeadlineshipmentexpensesschedulefollowupestimatepurchaseelaboratetouchbasedisregardmakesensecirclebacktrainofthoughtgetbackontrack

Odin Word Search 2023-06-21

34 Items: EyeGodGododinthorgeriyuleHuntymirwodanbaldrfrekimimirof Warfenrirwolvesravenswisdomhuginnmuninnasgardmidgardsleipnirmagicianof poetswandererwednesdayand Emblayggdrasilberserkerallfatherof Wisdomof Vili & Veof Bestla & Borr

Energy & Matter in an Ecosystem 2025-01-11

34 Items: atompreyalgaefungimatterenergyfoodwebmicrobeglucoseaquaticproductorganismproducerconsumeromnivoremoleculepredatorreactantecosystemfoodchainherbivorecarnivoredecomposerterrestrialconservationorganicwasteenergypyramidtrophiclevelsmicroorganismorganicmatterlimitingfactorphotosynthesisinterdependentchemicalreaction

Density and Matter (Try to define all the words) 2017-03-09

30 Items: gassinksizemasswaterfloatsolidcolorshapematterliquidvolumedensitymeltingboilingtexturemixturefreezingpropertydissolvesolutionchemicalphysicalparticlemoleculesevaporatemagnetismcondensatesolubilitycharacteristic

Biology Word Search 2024-02-29

30 Items: cellatomforcetheoryenergymatterbiologyphysicselementorganicecologyspeciesnaturalgeneticsmoleculecompoundreactionresearchanalysischemistryevolutioninorganicecosystemexperimenthypothesismicroscopeartificiallaboratoryconclusionbiodiversity

Chemical Processes & Thermal Energy WORD SEARCH 2024-11-12

30 Items: heatflowmuirmodelinputarrowenergysystemoutputmatterokeefechangeabsorbthermalprocessreleasesciencetransferproductsequationreactionradiationparticlesreactantscomponentsconductionconvectionexothermictemperatureendothermic

Week 10 Spelling 2024-11-14

30 Items: actorhumorangermajormayorpolarlunarenterhonormirrorpowderbannerpillarflavorfingerclovermatteranswercollardoctorclamortremortheaterburglartractorquarterscholarchamperthuundercharacter

Photosynthesis 2025-01-07

30 Items: leafgreensugarwaterenergymatteroxygenplantsgrowthglucoseproductconvertstorageradiantreactionreactantsunlightcytoplasmabsorptionchloroplastcalvincyclechlorophyllchloroplastrespirationmitochondriareproductionmicroorganismphytoplanktoncarbondioxidephotosynthesis

Rocks Word Search - Bonus 2025-02-06

30 Items: rocklavaheatmeltcoolcyclemagmamatterenergybasaltcementlayersOKeefemineralcrystaligneousgranitecompacterosionScienceobsidianpressureconserveintrusiveextrusiveweatheringdepositionsedimentarymetamorphicunderground

Balak 2024-07-13

18 Items: Son of Beor.Balak’s fatherThe Prophet of the HaftarahThe last station of the ExodusHe was once a priest of MidianA son of Abraham’s wife Keturahthe art of black magic; witcheryThese were the descendants of LotHis name means “Devastator” or “Waster”Balaam was a role model for spiritual _____.commonly used to describe the trumpet blast....

Colors! 2025-02-06

11 Items: The color of the skyThe color of most dirtThe color of fresh grassAnother word for purpuraThe color of an elephantThe color of most cloudsThe color of most carrotsThe color of ripe bananasThe color of most flamingosThe color of most firetrucksThe color of the street (mostly)

Main Sciences Word Search 2024-12-14

3 Items: The study of matter (9 letters)The study of living organisms (7 letters)The study of the natural world (7 letters)

Unit 4 Review 2025-02-06

18 Items: way of Romanizing the Chinese wordsthe Latin spoken by the common peoplearticulator engaged to nasalize a soundsounds made without the use of the lungssound made with little obstruction of airthe forcing of air through the nasal cavitywhat the letter "h" is on French and Spanishlangauge family to which French and Spanish belong...

Waves and Their Behaviors 2023-10-09

11 Items: A form of radiation wave that travels though the universe.To cause (light, heat, sound, etc.) to pass through a medium.The number of waves that pass a fixed point in unit time (Hertz).A point on a wave where the displacement of the medium is at a maximum.The distance between identical points in the adjacent cycles of a waveform....

Nominating Word Search 2025-02-16

23 Items: HawkPartyPartySystemCrisisCabinetWebsterof 1837SequoyaOsceolaDoctrineof TearsDemocracyVan BurenTerritoryC. Calhounv. GeorgiaConventionsv. MarylandRemoval ActHenry Harrisonof Abominationsof Indian Affairs

The United States: A Nation of Immigrants 2014-01-14

12 Items: censustreatyreformattitudeCatholicgovernmentProtestantreservationimmigrationBeringStraitLatinAmericadiscrimination

Historical documents 2023-12-23

10 Items: newspapermagna-cartaconstitutionbill-of-rightsframed-documentsabolition-of-slaverytreaty-of-versaillesemancipation-proclamationarticles-of-confederationdeclaration-of-independence

Aerial Word Search 2025-03-27

15 Items: Related to the air; often used to describe military operations conducted by aircraft.A type of military aircraft designed primarily for air-to-air combat against other aircraft.The quality of being open to attack or harm, often used in the context of military defenses....

Year 7 Science 2022 2022-12-07

18 Items: Not depleted when used.An animal lacking a backbone.An organism that makes it own food.An imaginary line about which a body rotates.Any substance that has mass and takes up space.The process of turning from liquid into vapour.A substance made by mixing other substances together.A system of interlocking and interdependent food chains....

the great depression 2024-10-08

14 Items: when you do not have a jobgetting a loan from your brokeragethere it a not much water and no rainthe United States stock market crashedwas a bad drought during the depressioncorps conserve the country's natural resourceschanges were made to make the U.S. banking systemone of the worst natural disasters in American history...

bones 2024-05-21

15 Items: the jaw or jawbone.any bone of the wrist.protect your internal organsThe area of the body below the abdomen.located in the central part of the chest.the skeleton of a person's or animal's head.lower limb extending from the hip to the kneeouter of two bones of the lower leg or hind limbone of the three bones that make up the hip bone...

Oculator Word Search 2024-09-26

23 Items: "Grandpa" SmedryAlcatraz's motherfather of Alcatraza Librarian defectormakes the Translator's Lenseshas the Talent of breaking thingsa literary critic for the Nalhallan Dailyare a sapient species in the Free KingdomsLeavenworth's daughter and Attica's sistereditor of Alcatraz Smedry's autobiographiesknight of Crystallia and princess of Nalhalla...

World Heritages 2023-06-24

15 Items: WatFujiMahalpetraPicchuof GizaIslandscolosseumof Athensof LibertystonehengeBarrier ReefWall of ChinaNational ParkCanyon National Park

Age of Enlightenment 2025-03-12

23 Items: LawsLockeLogicof GodRightsNewtonChangeMozartVermeerFrancisFarmersMonarchyChurchesRousseauVoltaireof Powersof ReasonPrincipiaRevolutionRevolutionEarthquakeEnlightenmentWollstonecraft

American Revolution 2024-10-25

24 Items: ActActsArmyPatriotBoycottof 1763MilitiawarfareCongressLoyalistMassacreFranklinMonarchyRedcoatsMinutemenTea PartyJeffersonDemocracyRevolutionParliamentof SaratogaMercenariesConfederationof Independence

Building Components 2023-02-20

30 Items: upper surface of a roomjointed device on a doorLowest member of the baseWhere two roof slopes metframing around the windowOther terms for plasteringhorizontal part of the stepdivider between space or roomnarrow bar to hold on a stairpattern between stile and railhorizontal structural in the roofa complete locking system for a door...

Outer Space Objects 2024-03-20

20 Items: cometmeteornebulagalaxyquasarasteroidwormholesatellitesupernovaplanetoidred-giantblack-holesolar-flaredark-matterwhite-dwarfstar-clusterdwarf-planetconstellationcelestial-sphereinterstellar-dust

Boyd/Magnus Science Buddies 2024-11-18

29 Items: BOYDPULLPUSHMASSCROCSGASESENERGYFORCESMAGNUSMOTIONWHALESNEWTONMATTERSTATICSOLIDSBUDDIESGRAVITYPICKLESSCIENCELIQUIDSBALANCEDFRICTIONMIXTURESMAGNETISMHYPOTHESISUNBALANCEDPROPERTIESSUBSTANCESEXPERIMENTS

ch 4 vocab 2025-02-26

15 Items: Rate at which energy is converted.Energy that is due to chemical bonds.Machine that does work with only one movement.The ability to cause change, measured in joules.Energy a moving object has because of its motion.States that energy cannot be created or destroyed.Transfer of energy when a force is applied over a distance....

Roaster Word Search 2023-02-20

25 Items: a wall to distribute windflooring composed of woodenthe capacity of being prolongedmake we cand see outside or insidea place to put glass / window on ita structure like lego to build a wallhandle used to open and close a door.the lower square slab at the base of a column.the lower surface of a room, on which one may walk....

Chapter 2 Word Search by Harrison Patten 2023-10-26

30 Items: a binding agreementa professional writerthe belief in one godthe belief in many godsan organized set of lawsa pyramid made of terracesthe name of a powerful Assyrian rulera religion developed in ancient Persiaa group of travelers journeying togethera market selling different kinds of goodsto force someone to live in another country...

Age of Enlightenment 2025-03-12

23 Items: LawsLockeLogicof GodRightsNewtonChangeMozartVermeerFrancisFarmersMonarchyChurchesRousseauVoltaireof Powersof ReasonPrincipiaRevolutionRevolutionEarthquakeEnlightenmentWollstonecraft

genetics Rogan 2025-03-24

25 Items: versionssame speciesmade up of DNAa genetic phenomenonbelongs to one persona variant form of a geneone numbered chromosomeshas two different allelesit isn't a expressed traita family tree or genealogya diagram used in geneticsan offspring of two animalshaving two identical allelesan organism's genetic makeupan individual has two different...

Practice of Science 2016-09-07

30 Items: cupfivetapedataworldtoolsrulerinfermattersensesrecordnaturalobservemeasurebalancemeasureexplainresultscylinderclassifyfindingsevidencemeasuringgraduatedmaterialsprocedurepredictionhypothesisinvestigatecommunicate

science 2024-09-19

29 Items: CellHeatMassForceAbsorbEnergyFossilMatterCircuitClimateDensityErosionGravityHabitatDissolveFrictionPredatorCarnivoreConductorEcosystemFoodchainLifecycleMagnetismAtmosphereDecomposerWatercycleEvaporationBiodegradablePhotosynthesis

A Matter of Trust voc. 1-5 2023-10-18

10 Items: glaredcorpserippledfitfullyconcededpersistedcondimentsobservatoryhumiliationsophisticated

Muses Word Search 2025-03-28

9 Items: Muse of musicMuse of hymnsMuse of danceMuse of comedyMuse of historyMuse of tragedyMuse of astronomyMuse of epic poetryMuse of love poetry

Greenhouseeffect Word Search 2023-06-13

30 Items: a place to dispose of waste\When fertile land becomes a desertloss of resources though soil erosiona species that is non native to an arearadioactive waste from nuclear reactorstravel and appreciation of nature areaspower obtained by harnessing of the windThe uncontrolled expansion of urban areasthe decrease in the ph levels in the ocean...

Literary Terms, Elements & Devices Word Search 2022-10-05

40 Items: A voice behind the peomThe objective meaning of a wordThe choice of words a writer usesThe Central character and a storySomething is given human attributesThe classification of literary workThe perspective a story is told fromThe highest point Tension in the plotThe use of informal language in writingThe struggle between two opposing forces...

Physical and chemical changes 2022-09-27

5 Items: statematterchangephysicalchemical

schwa sound /er/spelling list 2013-05-27

30 Items: actorhumorangermajormayorpolarlunarenterhonormirrorpowderbannerpillarflavorfingerclovermatteroysterclamortremoranswercollardoctortheaterthunderburglartractorquarterscholarchamber

Science Word Search 2023-06-02

30 Items: sungasbiomheatsolidearthatomsforceliquidmatterphasesvolumeenergyscienceprotonsdensitysolutionneutronsevidencedissolveconsumergeosphereecosystemmoleculesparticleselectronsatmospheredecomposerhydrospherecondensation

Science Practices & Crosscutting Concepts 2023-08-31

30 Items: dataplanmodelcausescaleeffectenergymatterchangeengagedsystemsdevelopanalyzethinkingargumentpatternsquantityfunctioncarryoutquestionsstructurestabilityinterpretconstructconceptualproportionexplanationcommunicateinformationinvestigation

Grade 3 Science - Scientific Method 2024-09-11

30 Items: datahelpspaceearthrecordmatterenergylivingbiologygeologyresultszoologyvariablediscovercomputerinterpretscientistquestionspersevereequipmentcooperatebrainstormentomologyexperimentlaboratorypredictioninvestigateconclusionsobservationsinterconnected

The Search 2024-10-26

30 Items: blutriobaolpelolevimaterleechdeityliderflakesnowymaskyhingerainermatterheraldentitypyritepicklebasuraintentstewardrasgadobracketmanifestvestatronindividualglowsterioantimatterthirdentity

space 2024-12-18

25 Items: WayStarHoleYearCometOrbitGalaxyPlanetNebulaMeteorSystemRocketCosmosQuasarMatterEclipseGravityAsteroidSatelliteTelescopeAstronautExoplanetSupernovaAndromedaSpacecraft

first 3 topics 2025-02-05

30 Items: DenseAtomsGroupcellsStainMatterLiquidEnergyBrittleMagnifyInfraredElementsHalogensParticlesNonmetalsStrontiumconductionInsulatorsTransitionMicroscopeEvaporationElectricitySpecialisedCellmembraneRedbloodcellEyepiecelensLivingthingsDoubleglazingPeriodictablephotosynthesis

Plinth Word Search 2023-02-20

25 Items: Base of a columnDivide into partsRoom under the RoofLevel part of buildingAllow Water to flow downLower part of window frameDevice giving protection from the sunColumn or pillar for supporting a RailShorter rafters used in a hip or valey roofThe pitched triangular end of a hipped roofA horizontal beam along the length of a roof...

~Science Vocab Search~ 2023-05-22

20 Items: Change in moisture contentMeasures the direction of the blowing wind.Intense tropical storm formed over warm ocean water.Measures the amount of precipitation that has fallen.The weight of the pressure of air pushing down on Earth.When cold air moves under warm air and forces warm air up.Narrow bands of high winds near the top of the troposphere....

Champion Speller 2025-03-18

25 Items: Not squamuloseA yarn or fabric of spun silkA fabric made of spun-rayon yarnA flaky rich crescent-shaped rollThe act of looking forward : foresightThe webbing on the feet of aquatic birdsTo work out or express by studious effortCapable of being understood or comprehendedOf or relating to the beginning : incipient...

Vaccine Locations 2021-05-24

35 Items: HynesHotelBangsFenwayBostonStatesSeniorCenterMiddleSchoolPalmerFoxboroCollegeAmherstEasternCapeCodOrleansGilletteConverseFalmouthEastfieldDartmouthCommunityConventionNatickMallDoubleTreeMarshfieldExpositionReggieLewisSpringfieldSpringfieldCircuitCityFairgroundsNorthamptonNorthborough

Abraham Lincoln 2024-10-11

35 Items: WarWarFreeCivilHouseMoralOrderPartySlaveUnionPeriodStatesUnitedDividedJanuaryLincolnPurposeSlaveryAmericanNorthernPreserveSouthernAmendmentExecutiveAbolishingChallengesLeadershipRepublicanConfederacyConfederateIndividualsTerritoriesEmancipationProclamationAccomplishments

Ag lesson 13.1 2024-02-08

15 Items: parts that provide supportlargest part of most plantspart that does reproductiondirection xylem brings stuffdirection phloem brings stuffpart that does photosynthesistype of root that is strait downpart of plant that provides supporttype of tissue that xylem and phloemtype of flower with all of the partsflower with only 3 of the main parts...

LA 2023-11-20

28 Items: perfusion impairmentSerious bone infectiontissue death and/or necrosisOpen reduction internal fixationUsed to classify diabetic foot ulcersA burn that only affects the epidermisProcess of securing muscle to bone after an amputationDiabetes where the body develops resistance to insulinUsed to classify degree of peripheral arterial disease...

The Musculoskeletal System 2022-12-05

25 Items: the arms and legsbones in the palmmiddle of the boneword-root for necka type of bone cellbone-building cellsbone-breaking cellsthe ends of the bonessoftening of the skullword-root for vertebrathe Word-root for skullinflammation of the neckthe framework of the bodythe word root for fingersinflammation in the vertebrapain in the arm or upper arm...

The Musculoskeletal System 2022-12-06

25 Items: the arms and legsbones in the palmmiddle of the boneword-root for necka type of bone cellbone-building cellsbone-breaking cellsthe ends of the bonessoftening of the skullword-root for vertebrathe Word-root for skullinflammation of the neckthe framework of the bodythe word root for fingersinflammation in the vertebrapain in the arm or upper arm...

Unit 7, Chapter 19 Solutions 2023-11-07

22 Items: fog, mayonnaisemixture of metalsunable to dissolvehomogeneous mixturesour to taste 0-6 pHdissolves the solutethe power of hydrogenbitter to taste 8-14 pHdissolved by the solvent0-14, 0-6 acid, 8-14 basemolecule has charged endsratio of solute to solventmoles of solute divided by liter of solutionmass of solute divided by total mass of solution...

Balak 2024-07-13

18 Items: Son of Beor.Balak’s fatherThe Prophet of the HaftarahThe last station of the ExodusHe was once a priest of MidianA son of Abraham’s wife Keturahthe art of black magic; witcheryThese were the descendants of LotHis name means “Devastator” or “Waster”Balaam was a role model for spiritual _____.commonly used to describe the trumpet blast....

Scientific Word Search 2025-03-11

23 Items: LawsBaconLockeLogicof GodRightsNewtonChangeMozartVermeerFarmersMonarchyChurchesRousseauVoltaireof Powersof ReasonPrincipiaRevolutionRevolutionEarthquakeEnlightenmentWollstonecraft

Classify Matter 8.P.1.1 2023-09-13

20 Items: atomsprotonneutronnucleuselementsmixturessolutionelectroncompoundssubscriptmoleculesatomicmasscoefficienthomogeneousenergylevelatomicnumberheterogeneouselectroncloudchemicalformulavalanceelectron

Unit 6 Matter Vocab & VMO 2025-01-22

32 Items: GasIongasmassrulemetalAnionModelGroupMetaltableSolidmetalnumberCationIstopeLiquidperiodProtonIsotopeHalogenNeutronNucleusElectronNonmetalParticleElectronConductorMetalloidReactivityearth Metaldot diagram

Cardiovascular System Word Search 2023-12-20

18 Items: The pacemaker of the heartRelaxation of the myocardiumoutermost layer of an arteryContraction of the myocardiumA blood clot is known as a(n)Middle muscular layer of the heartThe internal tubular structure of a blood vesselCongestive heart failure is most commonly caused byMicroscopic vessels that connect arteries and veins...