states of matter Word Searches

Budgetdraft Word Search 2023-02-25

25 Items: cooking placeplace to showerbuilding supportunderground roomsafety on the stairthe face of buildingcost data used to designthe width of a rung is calleda loong pasage in the buildingthe height of a rung is calledis the topmost room of a buildingis where the entry of light and ventilationthe lowest part of the base of an architectural column...

Unit 11 APES review 2024-05-01

20 Items: Cancer causing agentsType of source pollution from a specific locationType of water with high biodiversity and productivityArea of permeable rock, gravel, or sand that holds waterCover 71% of earths surface and moderate earths temperatureType of water that is clear and has low biological productivity...

Waves 2016-03-21

33 Items: heatechoatomswavessoundgasesenergyenergyabsorbmattersolidsnucleusreflectliquidstransmitmoleculesfrequencywaterwavelightwaveswavelengthsoundwavesvibrationslightenergysolarenergysoundenergyseismicwavevisiblelightinfraredlightstateofmatterenergytransfernuclearreactionultravioletlightelectromagneticspectrum

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Science Terms 2024-09-24

31 Items: iongasatommassworkforcesolidweightenergymatterplasmavolumeelementgravitymeltingboilingmixturecompoundfreezingsubstancedepositionsublimationevaporationtemperaturecondensationvaporizationnuclearchangestateofmatterthermodynamicsphysicalchangechemicalchange

Non-Contact Forces 2024-11-14

30 Items: rubmasswirepolerepelNewtonweightmattervolumehammerchargegravitycurrentvoltagebatterycompassattractGalileofallingfeatherballooncircuitrevolvedistancepositivenegativemagnetismresistanceelectricityelectromagnet

Sociology Final Word Search (1) 2024-12-13

15 Items: data that you collect firsthandsomething that is usual, typical, or standardWorking towards ending or resolving inequalityWhen you internalize all the behaviors of a groupEvery individual evaluates behavior by that behavior’s worthPrior court decisions must be recognized as precedent case law...

PHYSICAL SCIENCE 2016-11-29

32 Items: GASMASSGRAMSOLIDMATTERVOLUMELIQUIDBEAKERBALANCEDENSITYELEMENTMIXTUREPRODUCTVARIABLEMENISCUSCYLINDERKILOGRAMBUOYANCYCOMPOUNDSOLUTIONPHYSICALCHEMICALREACTANTHYPOTHESISEXOTHERMICOBSERVATIONTEMPERATUREENDOTHERMICTEMPERATUREDISPLACEMENTPURESUBSTANCESCIENTIFICMETHOD

Earths formation 2024-08-21

25 Items: lawatommotevastshiftprotonphotonquasarcosmicgalaxymattergravitystellarinfiniteuniversecoalescepostulatecosmologysingularitycosmologistinadvertentbang theoryinfinitesimalelectromagnetismbackground radiation

Psychopharmacology Word Search 2022-09-29

19 Items: axonapneaanionsystemmidbraindendritemembraneintersexforebrainhindbrainserotoningray mattertestosteroneprogesteronenorepinephrinenervous systemneurotransmitterprefrontal cortexinsensitivity syndrome

Ether 1-5 2024-11-17

19 Items: VeilJaredEtherFaithBargePrayerSpiritshelemMoroniChastenof Babelof JaredGentilesJareditesWitnessesRevelationConfoundedWildernessMoriancumer

Med Terms Midterm Review 2023-04-03

20 Items: cell eatera bone cellsuture a tendondischarge of oildisease producingdifficult movementrecord of a vesselpertaining to bloodcutting into a veinfat tumor or swellingdestruction of a clotexcessively large heartlymph gland inflammationpertaining to against lifesurgical repair of a wrinkleinflammation inside the heartabnormal condition of no sweat...

Word search - States 2023-07-11

10 Items: utahohioidahomainetexasoregonarizonafloridamontanacolorado

Elves & Dwarves in Norse Mythology 2022-07-24

10 Items: Sif, Thor’s wife, has her hair cut off by ____ as a prank.In stanza 10, we have the names of two apparently powerful dwarves, ______and Durin, but little is known of them.However, for pagan ________, the lines drawn between these creatures must have been much blurrier than it is for us....

Vocabulary for Test 2023-05-16

25 Items: an egg or sperma form of a genea fertilized eggrequires one parentpart of a chromosomethe inherited allelessperm and egg combinethe study of geneticsa difference in a traita family tree for a traitan inherited characteristica change to genetic materiala type of asexual reproductionthe process that makes body cellsstructure made of DNA and protein...

Moose Lodge 509 Nov 2023 Word-Search 2023-10-11

20 Items: Our Lodge MascotMan's best friendCurrent US PresidentCurrent Chapter Senior RegentFirst name of the LOOM ChaplainNumber of barstools we have in useEditor of Anderson Moose HighlightsLast name of our Lodge AdministratorThese Members deserve our many THANKSThe largest planet in our solar systemLast name of our 2022/23 LOOM President...

Unit 2: Spelling Test 2 2022-09-27

25 Items: scenicembarrassedin a loud mannerin a curious mannerparticular; definitea two-wheeled vehicleto get rid of; removea large, ornate houseone who replaces anotherto consist of; be composed ofexcessive; unrestrained; imprudentto clarify the meaning of; to translatein a manner indicating great weightinessconsistently; with little or no variance...

Stress, Anxiety and Bullying 2023-05-15

25 Items: too muchbe afraid ofslightly angryfeeling of annoyancea feeling of physical tensionworry, unease, or nervousnessa feeling of emotional tensionelapsed time between two eventscausing or likely to cause harmextreme anxiety, sorrow, or painthe condition of being anonymous.responsible for flight, flee, freezemake or become less tense or anxious...

Mont Y8 Statistics 2023-10-10

15 Items: The process of collecting data.Entities that collect different types of data.Selected without a particular order or pattern.A series of questions used in a survey or census.Information collected for the purpose of analysis.Data collected from a selection of a larger group.Data collected from the entire group being studied....

Secondary Economic Activities 2024-11-15

25 Items: – MNC stands for.– where rubbish is burnt.– Is an example of a light industry in Cork.– consists of inputs, processes and outputs.Alumina – Example of a heavy steel industry in Shannon.- What primary activity involves catching fish and other seafood?- What is the process of extracting minerals from the earth called?...

Spelling practice English 2023-10-11

19 Items: The _______ of a owlThe _______of a snakeOpposite to many ________A baby horse ____________Rhymes with wish___________Opposite of few____________A shark is ______ (large) a man.The horse is kept in a ___________He can hear the buzz of the _________The kitten is kept in a _____________The puppy is kept in a _______________...

Cell Cycle and Mitosis 2024-12-15

17 Items: The phase of interphase where DNA replication occursOne of two identical halves of a duplicated chromosomeA structure of DNA and protein that contains genetic informationThe region of a chromosome where sister chromatids are held togetherThe stage of mitosis where chromosomes align in the middle of the cell...

Ambiguity Word Search 2024-12-04

12 Items: This exists when something can have more than one interpretation.______Ambiguity is present when a sentence has two possible tree structures.occurs when a word that has different meanings that derive from a common originthe aspect of a verb which indicates that an event/action is proceeding or on-going...

Sea Word Search 2023-06-28

17 Items: rowgodboatwindrainsavepeterstormdoubtshorejesusof Godandrewpulledtwelvebelieveof Galilee

Reconstruction 2024-02-20

8 Items: Lincoln's successorThis is what happened to Lincolnperiod of reunifying the country between 1865-1877The amendment the ended slavery except as penalty for a crime.The 15th Amendment protected the right to this regardless of race.prohibited Black people from owning property, firearms, occupying certain places, and testifying in court...

Unit 9: Energy Sources and Consumption 2024-04-25

16 Items: energy from the sunburning wastes for energycoal, oil, and natural gasburns in the presence of oxygenmost common form of water powerusing fuel for both efficiency and heatlocation of the worst meltdown in historyreducing the overall amount of energy neededthe process of building the bonds of an atomthe process of breaking the bonds of an atom...

Famous Landmarks 2024-03-20

20 Items: petrabig-bentaj-mahalcolosseumacropolisstonehengeangkor-wateiffel-towermachu-picchugrand-canyonburj-khalifamount-everestmount-rushmoresagrada-familiapyramids-of-gizastatue-of-libertysydney-opera-housegreat-barrier-reefgreat-wall-of-chinachrist-the-redeemer

Ray optics part-1 2024-08-14

21 Items: PoleReflectionPlane-MirrorFocal-LengthOpaque-MediumConvex-MirrorMagnificationOptical-MediumConcave-MirrorPrincipal-AxisMirror-FormulaPrincipal-FocusSpherical-MirrorTransparent-MediumTranslucent-MediumLaws-of-ReflectionCentre-of-CurvatureRadius-of-CurvatureParaboloidal-MirrorSpherical-AberrationImage-Characteristics

Focus on Greek Roots 2024-03-04

19 Items: Study of living organismsEarly sound-reproducing machinePerson trained for space travelA person's signature, often as a mementoA sudden event causing great damage or lossVisual representation of data or informationAn account of someone's life written by someone elseAn account of a person's life written by that person...

Respiratory System 2024-10-14

29 Items: The movement of air into and out of the lungs.The double-layered membrane surrounding the lungs.The space between the parietal and visceral pleura.Pneumocytes-cells in the alveoli that produce surfactant-A ring-shaped cartilage located below the thyroid cartilageThe first branches of the trachea that lead into each lung....

Your Occupation 2024-04-11

16 Items: uscisasylumServiceOfficerapplicantOF STATUSOF SUPPORTPROCESSINGderivativebeneficiaryACTION DATEadjudicationOF CITIZENSHIPinadmissibilityregistration NUMBERACTION FOR CHILDHOOD ARRIVALS

Harry potter 2023-06-12

14 Items: Scared of spidersHeir of slytherinA Hufflepuff girlFriends with GoyleFriends with CrabbeA twin brother of FredHe killed Nagini the snakeA Chinese girl from RavenclawThe main character of the movieA Weasley that died in the last movieThe smartest one out of the group of 3A lovegood member taken by the death eater...

U.S.A states 2022-02-12

7 Items: NewYorkHawaiiAlaskaMarylandOklahomaColorado

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Universe Word Search 2023-11-27

26 Items: wayvoidtimecometyearsaliendwarfastralsystemapollocosmicmattershuttleuniversegalacticgalaxiesredshiftcentauricentauriandromedasatellitessupergiantouterspaceinterstellarconstellationextraterrestrial

9 weeks 2 test review 2023-12-07

31 Items: japan.- Factories and farms produce more goods than people can buy.Young women of the 1920s that behaved and dressed in a radical fashionNew Deal program which gave electricity and jobs to rural Appalachia, including ALGovernment programs passed by Congress to help the U.S. get out of Great Depression...

Middle Ages Review Word Search 2024-03-01

19 Items: Mr. Murphy's catsFirst Holy Roman EmperorA mix of two distinct culturesCommon targets of Viking raidsA code of laws based on Roman lawThe capitol of the Byzantine EmpireThe social system of the Middle AgesLeader of the Eastern Orthodox ChurchThe economic system of the Middle AgesReligious wars that lasted for 200 years...

Word Search 2024-04-05

34 Items: corefogscrusthazesveilspallsmistscavummuruscaudamantlematterflumencirrusshadowsshroudsmantlesvolutusvolutusfluctusculumusstratusbiospheregeosphereatmosphereconvectionhydrospherelithospheresilvagenituscumulonimbusasthenosphereflammagenitusphotosynthesiscataractagenitus

science 2024-09-20

30 Items: GasSolidForceChainCycleMatterLiquidEnergySystemGravityMeltingMixtureHabitatWeatherClimateFrictionFreezingSolutionProducerConsumerOrganismMagnetismEcosystemPollutionDecomposerAdaptationEvaporationElectricityCondensationPhotosynthesis

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

Salon Skin Care 2023-07-10

20 Items: Foul-smelling perspirationCapable of destroying fungiA large blister containing clear, watery fluidThe study of muscles - their structure, function and diseasesAny material that allows or supports the flow of electric currentSmall, red elevated protrusion of the skin, usually containing no pus...

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

UAE 2021-10-20

37 Items: OilYasAbuDatePalmGulfBurjArabArabTreesHajarDubaiDhabiCamelAjmanStatesIslandSpicesHummusIslandDesertUnitedTrucialPersianTourismFalafelBeachesKhalifaSharjahSaadiyatEmiratesFujairahMountainsArchitectureUmmal-QuwainModernizationRasal-Khaimah

JoiningThePak Wedding Word Search 2022-11-01

19 Items: Amber's jobwhere we methoneymoon locationfirst date activitywhere Alex proposedAlex's favorite foodone of Alex's hobbiesname of our first dogsomebody once told mename of our first catAmber's favorite foodone of Amber's hobbiesname of our second dogblue flower red thornsname of our second catmonth we started datingyears we've been together...

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

Female Inventors Who Changed the World 2023-08-02

15 Items: First name Marie, discovered radioactivity.First name Margaret, creator of the paper bag.First name Mary, creator of the windshield wiper.First name Melitta, creator of the coffee filter.First name Ayla, creator of the Kindling Cracker.First name Maria, creator of the pop up life raft.First name Katharine, created non-reflective glass....

Chapter 16 - Key Terms 2023-11-01

29 Items: A legally enforceable agreement.The cost of the coverage provided by an insurance policy.Payment by the insurer or by the patient of more than the amount due.A person designated by an insurance policy to receive benefits or funds.The determination of the exact coverage to which the insured is entitled....

Pichwai Word Search 2023-05-12

20 Items: The old name of Nathdwara was ___.Deccani or Golconda style of Pichwais originated in _____.A day at Shreenathji ki Haveli is divided into ____ darshans.He was an ardent devotee of Shrinathji and a devotional philosopher.Every Pichwai painting relates to a specific celebration of a ______....

Biodiversity Vocab 2023-05-16

19 Items: Environment lacking oxygenVariety and variability of lifeSpecies dwindling toward extinctionAmount of organic mass in an ecosystemOrganisms' natural home or environmentSpecies with no living members remainingSpecies indigenous to the given ecosystemLarge, regional habitat of flora and faunaFormation of new species due to env. change...

Animals, Colors, Jobs 2023-03-08

20 Items: Animal that barksthe color of dirtThe color of grassThe color of a roseThe color of the skyanimal that slithersThe color of a grapeThe color of the sunThe color of a whiteboardA animal that you can rideA person that likes to singTakes care of people(female)animal that likes to hop(female)A professional at acting(female)...

How Well Do You Know Your Model A #5 2023-12-30

20 Items: Charging gaugeA theft deterrent.Leaf spring hanger.______________ bowlA grouping of wires.A vintage brand of tire.pulls air thru the radiator.Center of the wheel assembly.Controls carb and distributorDraws additional gas to start.Original color of radiator hoses.A common brand of updraft carburetor.Wire junction box on top of generator....

Vocabulary Vines Word Search 63-66 2024-09-20

12 Items: of a shiplike a startoward a shipthe wrong namethe act of namingwritten with lighta particle of lightsailor of the starsnaming of the starssailor of the universeput together with lightdistribution in the environment

Chapter 3: How Living Things Interact (Part II) 2014-11-21

32 Items: oldpreynichelevelmattergrowthmimicrymineralorganicpigmentpioneerspeciesprimaryrecycletrophicwarningmoleculeomnivorepredatorconsumerproducertertiarypredationscavengersecondarypopulationsuccessioncolorationnourishmentreproductionmicroorganismphotosynthesis

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Review 2023-11-14

32 Items: gassolidgroupanionmetalmatterliquidplasmaperiodcationelementneutrondensitycompoundelectronnonmetalnoblegasmoleculesionicbondmetalloidhomogenousmassnumberdepositionsublimationheterogenousatomicnumbervaporizationcondensationcovalentbondphysicalchangeschemicalchangesvalenceelectron

Adam and Eve 2022-07-18

15 Items: evegodmanadamgoodevillovefruitangelwomandeathserpentof Lifeof Edenfreewill

Study Guide Crossword 2024-04-17

31 Items: viewed from all sidessoft or workable materialclay is fired once in kilnclay is NOT fired in kiln yetrepetition of one or more elementhigh water content, most workablea single material an artist may useliquid material is poured into moldhard less water, but still workablecompletely air dried & very brittlea difference in the use of two elements...

Taxonomy Word Search 2024-01-22

24 Items: organisms.relationships.characteristics.characteristics.The study of the form and structure of organisms.The study of evolutionary relationships among organisms.Structures in different species that share a common ancestry.The science of classification, organizing and naming living organisms....

Early Industrialization 2023-12-01

24 Items: the "working class"money used to investbusiness organizationinventor of Cotton Ginthe new "middle class"perfected the steam enginemovement of people to citiesprocess of combining farmlandterm meaning country/ farmlandsecond country to industrializemade up most of new middle classprocess of removing iron from its ore...

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

Unit IV Review: Abs-sci-ment 2024-05-17

22 Items: ______ the Terrible_______ WollstonecraftThe Index of _____________The belief that one should doubt everythingEmpress of Russia known for her Enlightened ideasThe spread and mixing of various cultures and ideasThe idea that the sun is at the center of the solar systemA child who ascends to the throne following a parent's death...

Toes and Foot Word Search 2024-07-16

20 Items: For an AP foot, the central ray is angled ___ ___ degrees.What part of the 5th metatarsal is on profile on an oblique foot?When positioning for lateral toes the 1st-3rd toes require ___ ____.When positioning for lateral toes the 4th-5th toes require ___ ____.For all positions of the toes how much of the metatarsals in required?...

CCES Wisers Extended: Word Search 2023-02-22

15 Items: ilayaparademinifairfielddemoboardgamesartcontestthewitnesssportsgamesName of your schooltheme for this yeargroup _____ of Todaygroup ____ of Tomorrowgroup _____ of Yesterdaybeing celebrated right nowWhat you call the students who goes to your school

American Alligator 2024-10-21

39 Items: LakeJawsSkinApexFishTeethSnoutScalyBirdsSmallGatorHolesUnitedStatesSwampsRiversMatingSeasonReptileMarshesArmoredPredatoTurtlesMammalsCarrionStealthAmericanPowerfulAlligatorBellowingFreshwaterEcosystemsCarnivoresEndangeredCamouflageEctothermicSoutheasternConservationMississippiensis

​🇨​​🇦​​🇷​​🇸​​🇴​​🇳​ ​🇼​​🇴​​🇷​​🇩​ ​🇸​​🇪​​🇦​​🇷​​🇨​​🇭​ 2024-05-16

15 Items: What humans BreatheThe end of A long boneAre ocean currents related to windHow Carbon moves out of the atmosphereThe process were liquid turns into gasZone of the ocean that has a lot of sunlightA flexible material found on the ends of bonesThe less muscular of the two types of blood vesselsThe more muscular of the two types of blood vessels...

4.7 Spelling Words : We, the people of the United States 2014-02-25

20 Items: inchespaddedblamedurgingcousinsscoringindexesderivedclippingninetiesflurriestrophiesstrikingsecuringpermittednighttimescarecrowpresidingskyscraperastonishes

Quest 2 2022-10-15

12 Items: The Ancient of Knowledge.Home to the Vermilion elves.A young keeper, blind at birth.Known as the "Jewel of the South."The main antagonist of the Warminster Series.The animal species the Faircloth family breeds.Incanus Dru'Waith is a ____ elf and an assassin.Erud's magical tome is called The Tome of ________....

8th Grade Forces and Energy Chapter 4 Hints 2024-01-04

13 Items: scientific ruleenergy of electric chargesability to do work or cause changeenergy of stretched or compressed objectsenergy that an object has due to its motionpotential energy stored in the nucleus of an atompotential energy that depends on the height of an objectform of potential energy that is stored in chemical bonds between atoms...

Unit 13 Vocabulary Word Search 2023-03-29

20 Items: To charmDull, boringGive care forTo set on fireNoisy confusionExtremely funnyLarge and heavyWell thought ofTo humble oneselfWork done by handOf or like a motherTo lose interest inTo change continuallyTo make or become smallerTo love and respect dearlyA narrative of heroic exploitsTo say suddenly or without thinking...

Gabby's Wave Word Search 2022-11-28

10 Items: - The lowest part of a wave- Area of maximum displacment- The highest part of the wave- Area of maximum displacement- Measurement of maximum displacement- distance of one complete wave cycle- Moves parallel to the wave of motion- Waves or vibrations produced per second- Moves perpendicular to the wave of motion...

Documents & Correspondence - Glossary and more 2024-12-18

31 Items: Consecutive hoursConsectutive daysReceiver of the cargoStowage plan for containersAlternative term for insurerSynonym for Bare Boat CharterDuplicate of a bill of ladingType of grain; Barley and oatsArchaic term for charter partyVessel sailing along a fixed routeAdditional sum of money to be paidType of grain; wheat, rye and corn...

CVA Review Game 2024-01-05

16 Items: Pertaining to the heartAnything that makes a substance unusable for its intended purpose.Section Delivery of fetus by incision through the abdominal wall and uterine wall.Pertaining to the cranium or the head end of the body, or anterior end of the body.A light proof housing for X-ray film, containing front and back intensifying screens....

Breed Word Search 2024-01-05

16 Items: Pertaining to the heartAnything that makes a substance unusable for its intended purpose.Section Delivery of fetus by incision through the abdominal wall and uterine wall.Pertaining to the cranium or the head end of the body, or anterior end of the body.A light proof housing for X-ray film, containing front and back intensifying screens....

Health Sciences Word Search 2024-09-11

20 Items: Means "red"Means "self"Means "vein"Means "slow""Anti" means:"Intra" means:Means "around"Between statesMeans "between"Means "lung(s)""Erythrocyte" means:"Intravenous" means:"Pulmonology" is the:Around a certain areaSomeone who draws bloodsomeone's "Tachy" means:Someone who studies lungsThe process of drawing blood...

Slappy Word Search 2024-07-22

20 Items: NightZombiesBeware!of a Dummyof the Jack!in DreamlandFriend SlappyBlood Is Backand the Beastwith the StarsBirthday to YouGhost of Slappyof the SquawkerAlive! It's Alive!from Shudder Mansionof the Invisible BoyAm Slappy's Evil TwinDo Not Feed the WeirdoDummy Meets the Mummy!Call Me the Night Howler!

Mitosis 2023-02-21

17 Items: The life of a cell.Two Identical Cells.The last phase of mitosis.The second stage of meiosisThe first stage in cell division.An organism of one or more cells.The process by which a cell divides.Division of the cytoplasm of a cell.To repeat or copy (something) exactly.The process in reproduction and growth cells....

Sound Word Search 2022-12-13

11 Items: moving back and forththe absence of matterthe way a wave travelshow high or low a sound iswhat sound waves travel throughwave the type of wave a sound isalso known as longitudinal wavesthe ability for something to do workwhen air particles are furthest apartwhen air particles are close togethervibrations create this so you can hear it

United States Part 1 Levering 2022-08-27

25 Items: iowaohiomainetexashawaiioregonalabamaarizonafloridavermontillinoiskentuckymissourinebraskaminnesotanewmexicowisconsincaliforniawashingtonconnecticutrhodeislandsouthdakotanewhampshiremassachusettsnorthcarolina

Science Word Search 2023-05-25

25 Items: The ability to dissolveThe harmful rays that come from the sunAn animal that hunts and eats other animalsA scale that shows the acidity of substancesThe SI base unit of thermodynamic temperatureThe type of cloud that tells you a storm is comingWhen different species work together, BOTH benefitThe layer of the atmosphere where weather occurs in...

Aiden 7th grade 2024-05-16

15 Items: the driest of all the biomesthe biological variation that occurs within speciesa ridge of rock in the sea formed by the growth and deposit of coral.the variety of different habitats, communities and ecological processesthe variety of life in the world or in a particular habitat or ecosystem....

Room 217 is The Best 2022-08-29

28 Items: samavaremyliamandyjackmateohazeljacobcarsonannikaoliviadominozephyrsawyeradriancedricpolinacharlierussellamolikacarolineannamikabrooklyncharlotteThe name of our schoolThe name of your teacherThe name of Principal Malone's pug

Year 9 English 2024-07-05

35 Items: The ____ Plot 1605______ kills Duncan'half-formed ______''Be the ____ under't'Tennyson was Poet _______Genre of Macbeth: ________'I carving out me _______'Who kills Macbeth? ___________A commanding verb is an ______Poem by Carole Rumes 'The ____'Post __________ Stress Disorder'Straight I unloosed her ______'Playwright of 'Macbeth': _________...

U6 Vocab 2023-11-09

36 Items: A seasonal wind.the coldest climateThe climate of a small area3rd layer of the atmosphereWinds that blow from west to eastThe lowest layer of Earth's atmosphereA thin layer of gases surrounding Earthwhen a cold front overtakes a warm frontThe outermost layer of Earth's atmosphere.A person who studies the different climates....

Biology Chapter 11 Vocabulary Word Search 2024-03-19

25 Items: formation of a new speciesthe variety of alleles in a populationthe changes in a population's genetic structurethe effect of chance on a population's gene poola speciation that occurs via a geographic separationa speciation that occurs in the same geographic spacean evolution that results in similar forms on different species...

Word Search 2024-04-05

34 Items: corefogscrusthazesveilspallsmistscavummuruscaudamantlematterflumencirrusshadowsshroudsmantlesvolutusvolutusfluctusculumusstratusbiospheregeosphereatmosphereconvectionhydrospherelithospheresilvagenituscumulonimbusasthenosphereflammagenitusphotosynthesiscataractagenitus

Self Care (Black Wellness Matter) 2024-11-23

16 Items: smilereadingfishingwalkingdancingshoppingcraftingbreathinggardeningbubblebathexercisingmeditatingaffirmationtakevitaminsordertakeouthealthyeating

Unit 3: Electrons in Atoms 2023-09-26

20 Items: 3.00 x 10^8 m/sHeight of a waveparticles of lightthe arrangement of electrons in an atomElectrons on the outermost energy level of an atomthe clockwise or counterclockwise motion of an electronthe possible energies that electrons in an atom can havenumber of complete wavelengths that pass a point in a given time...

Space Exploration 2013-06-17

34 Items: SunMarsUnitMainVenusEarthPlutoWhiteSaturnUranusDwarfsmatterGalaxyCometsmeteorequinoxMercuryJupiterNeptuneNebulaeMassiveSolsticeellipsesSequenceLightyearProtostarSupernovaMeteoritegeocentricMeteoroidsSupergiantsheliocentricAstronomicalInterstellar

Epidemiology Topic 3 2023-01-28

12 Items: S____ maps show locations of individual cases.Descriptive epidemiology enables development of testable h__________.Cross-sectional allows measure of the p________ of something(e.g. a disease).Descriptive epidemiology provides information useful for a_________ of resources....