states of matter Word Searches

Prestressed Word Search 2023-02-20

24 Items: load bearingroom under roofrounded stairs edgelevel part of buildingfor circulation purposeuse to protect ourselves.material for dividing roomconnect between wall and doorplanted into the wall from the jambthe highest floor, usually expensivethe overhead inside lining of a roomtype of concrete, use in hall/auditorium...

March 2024 Ambassador Word Search 2024-03-11

20 Items: Basic unit of digital informationProgramming instructions for softwarePattern recognition through algorithmsAdvanced neural network-based learningProcess of acquiring knowledge or skillsExtraction of insights from large datasetsA specific job or assignment to be completedField involving automated machines and systems...

United States History Chapter 2 2013-10-03

36 Items: ofandrulefreecostruralurbansuburbbranchbranchbranchchecksmarketprofitsupplydemandcultureeconomyfactorsservicerepublicjudicialbalancesmajorityindustryimmigratedemocracyexecutivetrade-offpatriotismpopulationgovernmentproductionlegislativeconstitutionmanufacturing

Unit 10 "The United States" 2021-04-08

23 Items: taptipbaldcoinsizesurejazzeagleexistsquatnationtheorymiddaytrainerthousandengineernicknamemusicianmidnightimportantworldwideskyscraperinvitation

Southeast Region States and Capitals 2022-12-14

24 Items: RockRougealabamafloridageorgiaatlantajacksonraleigharkansaskentuckyCarolinaCarolinacolumbiavirginiarichmondVirginiafrankfortlouisianatennesseenashvillemontgomerycharlestontallahasseemississippi

STREETS N AVENUES N STATES 2023-02-10

27 Items: westavoniowauniontexasmainenevadakansasalaskalincolnfloridageorgianewyorkmontanawyomingindianaeastmainvirginiaoklahomadelawarestratfordlouisianacaliforniaconnecticutmississippipennsylvaniasouthcarolina

Cities in the United States 2024-05-22

120 Items: renowacoomahamiamitulsatampaboisefargodallasaustindenverelpasobostontusconfresnoauroranewarktoledomobilejolietnormantopekaalbanynewyorkchicagohoustonphoenixsanjoseseattledetroitmemphisatlantaraleighwichitaorlandolincolnstlouismadisonbuffalolubbockspokanejacksonlansingbouldersandiegocolumbuslasvegasportlandhonolulurichmondrockfordsyracusecolumbia...

APRIL COVERAGE REVIEW 2024-04-10

34 Items: SIUDOLagentcrocschangeLETTERdutiesREPORTpolicyrentalPHOTOSSEARCHOF SALEcontactOF LOSSPAYMENTinsuredCARRIEROUT UPDwitnessclaimantcoveragemetadatacollisionliabilityINCEPTIONOF RIGHTSSPECIFICSdealershipdeductibleproceduresinvestigateoverlappingcomprehensive

Monopoly 2023-05-18

42 Items: gotaxredjailrentgamebankpinkhotelhousemoneytradeboardgreenbrownstatesbalticbankeryelloworangepacificventnorindianavermontpropertymortgagebankruptatlanticillinoiskentuckyvirginiaorientaldarkblueboardwalkparkplacerailroadstennesseelightbluewaterworksconnecticutpennsylvaniamediterranean

The Graveyard Book - Chapter 5 2023-04-26

20 Items: Side by side and facing the same way.Pertaining to or consisting of flowers.A twisted mass of something; to become twisted together.Simultaneously; at the same time; in harmonious agreement.A shrill, wailing sound, especially associated with bagpipes.Firm, dry, and brittle; or fresh and sharp in taste or manner....

Musical Genres 2024-03-11

15 Items: suiiimade for moviesA sub-genre of piepopular music of MexicoPopular music of Jamaicapopular music of Argentinahad its "boom" in the 1940'senjoyed in theatres and hallscommonly uses electronic drumsguitars and drums and keyboardscategory of musical compositionmusic that is popular in Colombiamusic made with digital instruments...

ENVIROMENTAL 2023-03-15

20 Items: Worldwideits powerIts all around usIts pure not manmadeDefective or not in useThe industry of buildingRenewable or non renewableThe reusing of old materialsa threat from global warmingIs harmful to the environmentThe release of greenhouse gasesA Hydrocarbon found in the groundThe conversion of sunlight into energy...

Science Is Coooooooooool <->: 2015-05-20

36 Items: gasLabSunmasswindsolidSpaceEarthFloodClaimProveenergymatterliquidPotionPlanetweatherSCIENCEHabitatVolcanopressureMr.VulloBillGatesScientistInventionTelescopeLandslideEnviromentEarthquaketemperatureMs.PhillipsSolarSystemObservationThomasEdisonLouisPasteurBillNyetheScienceGuy

CH3 - Rocks and Minerals 2022-12-18

16 Items: The layer of rock that forms Earth's outer surface.________________________Process in which sediment is laid down in new locations.________________________A dense sphere of solid iron and nickel at the center of Earth.________________________The layer of hot, solid material between Earth's crust and core.________________________...

US History Unit 7 terms 2023-02-28

11 Items: Who won the 1912 presidential election?Where was the canal built in 1904 located?The panic caused by the fear of communism's spreadpowers Which alliance was the Ottoman Empire a part of during WWI?Which act was passed in order to strengthen the Sherman Anti-Trust Act?The mass migration of African Americans away from the Southern United States...

Musical Genres 2024-03-11

17 Items: suiiimusic popularmade for moviesA sub-genre of pieclub and party musicpopular music of MexicoPopular music of Jamaicapopular music of Argentinahad its "boom" in the 1940'senjoyed in theatres and hallscommonly uses electronic drumsguitars and drums and keyboardscategory of musical compositionmusic that is popular in Colombia...

Reformation 2024-04-18

17 Items: Kings or queens.Church officials.Local church community.Official letter from the Pope.Church tax equal to 10% of income.Church court that punishes heresy.Period of art and learning revival.Major religious change and movement.Group of people gathered for worship.Formal statements of religious belief.Biased information to influence opinion....

The Shaws 2024-06-27

20 Items: The brides nameThe grooms nameThe month of ProposelThe couples dogs nameThe grooms ProfessionThe brides birth monthThe grooms middle nameThe grooms sisters nameThe brides favorite foodThe grooms favorite drinkthe couples favorite storeThe state of the engagementThe color of the couples eyesType of vehicle the couple drives...

Week 18 Thursday 2024-02-04

25 Items: SpyingYoungera choicehelp or supportFor a short timePermitted by lawAt the present timeMoney for investmentMasses of bread or meatthe act of being presentA way of acting or behavingSomeone who repairs machinesA deep, gaping hole; a gorgeTo have said yes to somethingThe reason why something happensA relative who lived in the past...

Plate Tectonics Wordsearch 2023-02-15

14 Items: The outer layer of the EarthWhen one plate slips below anotherThis continents are in constant ___When this rises and cools, it creates new crustWhen plates push up, it creates this kind of landformType of heat transfer that causes tectonic plates to moveLast name of the scientist who proposed continental drift...

Dove Holiday Word Search 2023-12-04

10 Items: Jewish New YearHindu festival of lightsHindu festival of colorsCelebrating the birth of Jesus ChristA day honoring Buddha's enlightenmentMexican holiday reuniting the living deadA holy, month-long observance for MuslimsCelebrating the resurrection of Jesus ChristCelebration of African-American culture held in December...

Word Search - Elijah Smith 2023-09-13

31 Items: Moving airair that surrounds Earthtoo much water in one placeThe distance above sea levelHow hot or cold something isthe current outdoor conditionswater found in lakes and glaciersbuilding up of something overtimeInformation that has been collectedThe amount of water vapor in the airthe continuous flow of water on earth...

vocabulary 2023-10-05

27 Items: an ancestorlead by, guided(of a place) without inhabitantsan airplane with one set of wingscontaining or using only one colornext to or adjoining something elselikely to be the case or to happen.relating to or resulting from motionoperated by or equipped with machinesliving the life of a nomad; wanderingmeter used to determine the altitude attained...

Flowers Word Search 2024-05-13

23 Items: MANdancakekissvowsloveYORKringsdresskirrenflowersbramblesiewertforeverceremonyOF HONORpetersoncoloradogroomsmenbridesmaidsOF THE GODSphotographerHICKORY HILL

Age of Revolutions word search 2023-10-12

10 Items: fearestateestateestategeneralof terrorof rightsguillotineof bastilleconstitution

cxcb 2023-12-26

8 Items: Mangandhiof Fireamadeusplatoonof AfricaLast Emperorof Endearment

math wordsearch 2022-11-30

31 Items: oddeveneventmarkupinverseoutcomedivisionmarkdownsubtractadditionfractionsinferenceprincipalpopulationproportioncross-sectioninterest-ratepercent-erroradjacent-anglescomplex-fractioncomposite-figurepercent-equationinvalid-inferencepercent-of-changeindependent-eventsisolate-a-variablecomparative-inferenceexperimental-probability...

Constitution 2023-09-19

20 Items: vetoratifyReviewPowersPowersPapersProcessCollegepreambledelegaterepublicamendmentbicameralof Powersof RightsfederalismConventionSovereigntyconstitutionand Balances

The Nutcracker Ballet 2023-10-11

20 Items: taleclaraPrinceCoffeemagicalde deuxof SnowelegancegracefuldazzlingballeticSoldierswhimsicalof SweetsgrandiosedreamlikeenchantingPlum Fairytchaikovskyof the Flowers

Global I Review 2024-01-09

30 Items: Be goodBe chillBe good or elsePlebeians and...The first civilizationThe Islamic code of conductChristianity, Judaism, IslamThe Greek word for city-stateThe dynasty started by Liu BangA city-state that rivaled AthensAncient Mesoamerican civilizationCapital of the Eastern Roman EmpireHinduism, ancient Egypt, Rome, Greece...

APHUG Unit 5 test review 2024-01-31

21 Items: farmingUses many inputsHaving enough to sellCanada and the Western USthe minimum amount to sustain lifeplantation farming found in this type of climatediseases like malaria and small pox traveled from ____ to _____water contamination and depletion is a _ of the Green Revolutionuse of little labor and capital to increase agricultural productivity...

God's Names - By: Dillon Postma 2024-04-10

18 Items: sonwordabbajesusbiblerabbisaviorof Godof GodfathermessiahteacherMessiahof JesusDelivererDelivererChosen OneRelated to Man

CNA Lesson 17 Review 2023-01-22

15 Items: walkingturning upwardturning a jointturning downwardbending backwardbending a body part or jointstraightening of a body part or jointmovement of a limb toward the midline of the bodymovement of a limb away from the midline of the bodydevice used to maintain a body part in a fixed positionpermanent stiffening of a joint or muscle caused by atrophy...

Instacart's Puzzle 2022-10-12

9 Items: Logo of instacartInstacart Connect Retailer, uses barcodeWhat do we do for orders that the items out of stock"I understand your frustration, I would be upset too."What do we do to an order when a family emergency comes upSuggesting a friend to join instacart and getting paid for it.Color of the pop up showing batching paused on shopper's profile....

HYPER AND HYPO ! 2023-10-08

15 Items: LONGSIGHTEDNESSEXTREME WEAKNESSSHORTSIGHTEDNESSEXCESSIVE VOMITINGTHICKENING OF BONEDEFICIENT MUSCLE TONEEXCESSIVE PERSPIRATIONEXCESSIVE TALKATIVENESSEXCESSIVE SECRETION OF MILKDECREASES BLOOD SUGAR LEVELLOW POTASSIUM LEVEL IN BLOODDEFICIENCY OF SODIUM IN THE BLOODDECREASED AMOUNT OF OXYGEN IN THE TISSUE...

TpT Email 2022-07-30

13 Items: judaismbradburystarwarsRelating to the Middle Ages.The "end times" in Norse mythology.The primary religion of people from India.The last of the Ptolemaic leaders in Egypt.Short story from the perspective of Lady Capulet.His assassination sparked the beginning of The Great War.Approximately one-third of the SAT and ACT are based on this....

Scrum Glossary 2023-07-21

34 Items: 10, See "Product Backlog __________"5-4, A self-managing team consisting of one Scrum Master, one Product Owner, and Developers.8, The selection of items from the Product Backlog Developers deems feasible for implementation in a Sprint....

Econ concepts 2023-07-16

16 Items: iloveeconomicsmyfavoriteclassbestteacherevergreatlifelessonsThe study of the economic behavior of individuals and firms.A situation in which extra units of something produce successively smaller benefits.A school of economic thought advocating government spending to pull economies out of recession....

Lesson 4: Father of Many Nations 2024-04-05

14 Items: heirisaacshieldrewardnationnationsbehavioralmightyoffspringtestamentof promisedemonstrateof the earthrighteousness

May words 2022-06-06

33 Items: Of or pertaining to a year.The using up of a resource.Stick fast to a surface or substance.In spite of the fact that; even though.Craving or consuming large quantities of food.Rigorously binding or exacting; strict; severe:A union or association formed for mutual benefit.A group or system of interconnected people or things....

annie's word search 2024-05-16

15 Items: atomic mass unithigh temperature gasprotons and neutronsprotons and electronspostively charged atomsneutrally charged atomsnegativelty charged atomsa table of chemical elementsa mass of atom of a moleculeessential to living organismscharging a object without touching ita way of representing atoms or molecules...

Marketing - Branding Test - Use vocabulary words to complete word search. 2024-03-05

20 Items: States the quality of the product.The brand name, trademark,or logo.Products that do not carry a company name.the physical container or wrapping for a product.Using their packages to promote social and political causes.incorporates a unique symbol, coloring, lettering, or design element....

States 2024-03-22

4 Items: JuneauPhoenixMontgomeryLittle Rock

LS - Mod 1 - Matter and Energy in Ecosystems 2022-10-05

38 Items: co2h20snowalgaewaterdecaycyclesleetvaporspongyoxygencarbonmatterexhalematterenergyglucosetrophicrecyclestomataprocessbacterianitrogenomnivorecarnivoreherbivorefossilizeecosystemdecomposerdetritivorechloroplastchlorophyllevaporationrespirationcondensationprecipitationphotosynthesischemosynthesis

7th Grade Review 2024-05-07

20 Items: FCCLA's official flowerWhat the F in FCCLA stands for.The acronym for the 4 areas of child development.A kitchen tool used to flip pancakes or turn hamburgers.A kitchen tool used to beat eggs and add air to mixtures.The type of stitch we used for our final sewing projects.The type of project we did where you chose what you would cook....

Environmental Events and their Implications to Human Lives 2023-03-11

15 Items: The extent of being liable.It is a potential source of harm.A real threat to general welfare.It is commonly known as biohazards.It is also known as social hazards.It is commonly known as tidal waves.The gradual caving in or sinking of an area.The sudden and violent shaking of the ground.These are hazardous substances that can cause harm....

Environmental Events and their Implications to Human Lives 2023-04-01

15 Items: The extent of being liable.It is a potential source of harm.A real threat to general welfare.It is commonly known as biohazards.It is also known as social hazards.It is commonly known as tidal waves.The gradual caving in or sinking of an area.The sudden and violent shaking of the ground.These are hazardous substances that can cause harm....

Cognitive Word Search 2019-10-16

35 Items: axonlobegreypinkbrainfoldsshortsmelltastetouchmattermemoryvisionthoughtemotionfrontalbarrierhearingtemporallongtermdopamineamygdalabreathingdendritesoccipitalbrainstempituitaryserotoninprocessingCerebellumneurologistelectricityhemispheresneuroscienceneurotrasmitters

Word Search 1 2024-01-16

35 Items: billfelttestmoonmindloverainbluewishreadydancecellspaintcausetrainmattersquarecenterenergyregionreturnpickedsimplefarmersdividedgeneralsubjectbelievememberssuddenlyanythingexercisesyllablesdirectiondeveloped

States 2024-03-22

4 Items: JuneauPhoenixMontgomeryLittle Rock

States 2024-03-22

4 Items: JuneauPhoenixMontgomeryLittle Rock

THE BLOOD 2024-04-04

24 Items: ELSEloveWINEjesusBLOODWHOLEsavedcrossgloryLIVEStruthenoughchristOF GODCHAINSfreedomvictoryhealingsurrendercrucifiedhallelujahforgivenessresurrectionOF SUFFERING

Animal 2023-10-24

20 Items: The fastest land animal.The world's largest land animal.Bat The world's smallest mammal.Shark The largest species of shark.Penguin The largest species of penguin.An animal that sleeps upside down in caves.A snake known for its hood and deadly bite.An animal often called "man's best friend."Eagle The national bird of the United States....

Atom - nuclear 2023-10-17

20 Items: protons + neutronssaid electrons travelled in orbitals.radiation with high penetrating powersubatomic particle with neutral chargeparticle that is basically an electronsubatomic particle with positive chargesubatomic particle with negative chargeidentity of element. Number of protons.discovered electrons. Cookie dough model...

Spring into Security 2024 Word Search 2024-02-14

20 Items: Basic unit of digital information.Programming instructions for software.Pattern recognition through algorithms.Advanced neural network-based learning.Process of acquiring knowledge or skills.Extraction of insights from large datasets.A specific job or assignment to be completed.Field involving automated machines and systems....

united states wars 2013-02-17

9 Items: revcoldwarholcaustcivilwaramericanolustionworldwar2worldwar1vientiamwar

Pure Substances and Mixtures 2018-02-21

37 Items: gasalloyfluidsolidsolutetheorymatterdiluteliquidsiftingsortingsolventelementmixturemeltingboilingsolutionparticlecompoundchemicaldissolvefreezingmagnetismsubstancefiltrationsolubilitymechanicalsaturationevaporationhomogeneoussublimationtemperaturedistillationcondensationheterogeneousconcentrationchromatography

Spelling 6 2024-03-27

10 Items: opposite of shortthe opposite of pushanother word for nicethe solid form of waterthe eighth month of the yearused to make windows and cupspart of an animals foot, especially catsa mineral used in jewelry, like a diamonda small round piece of metal used for moneyparts of the body muscles connect to (plural)

Discern Word Search 2023-12-20

10 Items: parishbishopdiscernmandateof Faithcelibacyseminarydalmaticof bishopsinfallibility

Bady 2016-10-25

3 Items: FarahUnitedStates

science 2023-01-04

37 Items: labsmassvialsatomsflaskstheorymatterweightatomicsciencebiologyecologygeologyphysicsanatomylabcoatbeakersfindingschemistsevidenceresearchelementsvelocitychemistryvariablesscientistphysicistgeologistphysiologyexperimenthypothesiskinesiologydevelopmentbunsenburnersafetygogglesperiodictablemicrobiologist

MNP Word Search 2023-05-30

20 Items: She offers protection from rabies.These are usually found flanking the goddess.This deity is placed on the top arch of the Mata’s temple.The Chitara family come from the _____ taluka of Ahmedabad.This is the symbol of the sun which controls day and night.She is symbolized only by a fly whisk made of peacock feathers....

St. Brendan the Navigator Word Search 2023-11-16

12 Items: fenitmonkstraleeirelandfinnianscotlandmonasteryannaghdowncolumcilleof Irelandthe Navigatorof the Blessed

CHAPTER 14 2023-04-21

16 Items: eraeonfossilepochsperiodshalf-lifekt-boundrypaleontologistplatetectonicsrelative-datingradiometricdatingcambrian-explosionlaw-of-superpostiongeologic-time-scaleendosymboint-theorytheory-of-biogenesis

Vocab Word Search 2022-09-08

20 Items: to ask a questionthe act of hunting for factsthe size or amount of somethingto work effectively with othersmodel a constructed model of somethingmodel a picture that represents somethinga guess or hypothesis based on observationsa factor in an experiment that affects the outcometools and supplies needed to conduct an experiment...

Geography Terms 2022-11-16

28 Items: A small streamWet spongy groundNatural elevationA small wooded hollowNarrow gorge with streamrounded hill or mountainA high steep face of rockA ring shaped coral islandA waterway dug across landA slowly moving mass of iceA steep rugged rock or cliffsmall low lying coral islandA small sheltered bay or inletA ridge of sand created by wind...

Chemical Processes BONUS Word Search 2023-12-05

37 Items: lawflowheatatombondenergymatterokeefethermalformulanaturalpolymermonomerdensityproductschemicalequationmoleculeresourcecatalystpropertyreactantssubscriptsyntheticrenewablecorrosiveflammableconductorinsulatorexothermiccoefficientprecipitateendothermictemperaturenonrenewableconservationconcentration

40 literary terms,elements,& devices 2022-10-07

40 Items: meaningA words literal definitionSomeone who is the voice of the poem.the time and place in which a story is toldA person who tells a story in a film or literatureA figure of speech that is an exaggeration for emphasisAn obstacle that characters have to overcome in a storyThe main message that is being conveyed throughout a story...

Vocabulary Lesson 6 2022-10-22

10 Items: To conquerHarsh; severeNatural talentAdded/non-essential partAuthoritative command/orderTo give forms of verbs in a fixed orderWithout skill/inappropriate/out-of-placeSevere/constricted/tight or pertaining to scarcity of moneyA serious state of affairs/the condition or point of being joined...

Occupational Therapy Care vocabulary 2023-03-10

23 Items: adulteatinghealthdevicereportbathingof lifeleisureculturegroomingmobilitydressingtoiletingpediatricassessmentadaptationenvironmentproductivitydevelopmentalaccommodationof daily livingcare activitiesrecommendations

Ides Word Search 2024-03-04

12 Items: luckbeefwindygreenspringrainbowof goldcabbageof MarchshamrockleprechaunPatrick’s Day

Building Components 2023-02-20

25 Items: a lowest part of basea top that covering of a buildingto guide water flow from the roofa protection from the rays of the sunthe bottom horizontal member of a walla very tall building with many storiesthe part of a wheel or tire that makes contacta triangular portion of a wall between the edgesprovide the structure's stability from the ground...

God's Names - By: Dillon Postma 2024-04-10

18 Items: sonwordabbajesusbiblerabbisaviorof Godof GodfathermessiahteacherMessiahof JesusDelivererDelivererChosen OneRelated to Man

Gods Names - Eli Postma 2024-04-10

18 Items: sonwordabbajesusbiblerabbisaviorof Godof GodfathermessiahteacherMessiahof JesusDelivererDelivererChosen OneRelated to Man

Improperfraction Word Search 2023-01-12

12 Items: part of wholetop of fractionbottom of fractionnumerator is larger thanfractions that are equalthe product of two factorsnumber whole number with fractionnumerator is smaller than denominatorfraction using lowest number possiblea number multiplied with another numberknown size or amount that helps understand the difference...

Women of UPS (March, 2023) 2023-02-24

13 Items: EVP & Chief Corporate Affairs and Sustainability OfficerFirst woman package car driver, beginning in 1943, Los AngelesBoard of Director - President and CEO of Lumen Technologies, Inc.UPS’s first woman pilot, joining the newly founded airline in 1988Board of Director - Group President, Pfizer Biopharmaceuticals Group...

g4.4.Matter in Ecosystems 2023-02-22

10 Items: decaylitterhazardcompostnutrientpollutantscavengerdecomposerecotourismbiodegradable

Chapter 15 Vocab Word Search 2024-03-21

11 Items: A solution of known concentrationA compound whose color is sensitive to pH.The point at which an indicator changes color.The pH range over which an indicator changes color.The negative of the common logarithm of the hydronium ion concentration.The negative of the common logarithm of the hydroxide ion concentration....

Spelling Test 3 2022-09-23

28 Items: against slaveryhostile; unkindunfit to be eatenthe act of going awayto repeat or say againone who is not a memberbefore recorded historythat which is not nuclearoccurring twice in a yearto stop or prevent an actionapart from one's choice or willto go do, come down, fall, or sinkof the highest degree or importanceextending across the Atlantic Ocean...

A Monster Calls: Vocab #1 2023-12-04

30 Items: a small sofarefuse to stoplean but strongin an unclear waynecessary for lifeconfused; perplexedto disturb or irritatevery scary or frighteningrise and move, as in wavesa look of anger or dislikea tall tower in a buildinga close friend or associateexpress pleasure with wordsa feeling of a lot of angerexert much effort or energy...

Conner Prairie: Interactive History Park 2014-05-09

43 Items: bedpanbiteweramsowwarpoketickyokefoalboarparkcivilcabinunionciphertrunlehearthspiderdaycappotterheifervoyagelenapebridgeunitedstatesmorganscholartoeheadconnnerprairieballoonindianscoveredraidershistorydelawarehomesteadapprenticeblacksmithprairietown

BBVB Independence Day 2024 #248 2024-05-31

42 Items: flagadamsbraveeagleproudbostoncolonyheroesnationparaderightsstatesunitedcountrycouragefreedomhancocklibertyrespectamericancitizenscongressequalityfranklinrepublicveteransbetsyrossdemocracyfireworksjeffersonpatrioticsacrificeallegiancerevolutionwashingtoncelebrationdeclarationconstitutionindependencephiladelphiaredwhiteandbluestarsandstripes

PhT 100 Word Search 1 (Spring 2024) 2024-05-09

17 Items: To grind to a smooth substance with moisture.The basic unit of weight in the apothecary system.The dating of any medication that has a short shelf life.The liquid in which another substance is being dissolved.The determination of the covererage an insured is entitled.Complete destruction of organisms after they leave the body....

Saved by the Lab 2023 QuidelOrtho 2023-03-09

20 Items: Na,K,Cl,CO2BUN,CREAT,GFR testingIAT, IS, or EXM are optionsQuidelOrtho Chemistry PlatformWinner of the 2015 Edison AwardWaterless chemistry methodologyWhen will the test be resulted?Brought PCR testing to many labsbody system that regulates hormonesDeveloped in the 80's by Dr LaPierreLessens incubation time in AHG testing...

Stage 20 Culture Review 2023-05-11

23 Items: nikenikenikepseudo-sciencefather of medicinecenter of learninggreat griffin golfergreat griffin runnermade first water-clockAlexandrian astronomermade first steam turbinewrote a geometry textbookmeasured the circumferencefamous 20th century doctorfamous 20th century authorRoman contribution to healthtitle of first geometry textbook...

Chapter 3 : The Constitution Vocabulary 2024-01-31

16 Items: vetorepealcabinetgridlockGovernmentSovereigntyrule-of-lawsupermajorityjudicial-reviewpolitical-partyunconstitutionalsupremacy-clauseelectoral-collegechecks-and-balancesseparation-of-powersexecutive-agreements

Les quantités - au marché 2024-06-20

15 Items: merci: t_a_ksde rien:it's n_th_ngs'il vous plaît: p_e_sedouze oeufs: t_el_e e_gsde la salade: so_e s_ladcinq citrons: fi_e l_m_nsje voudrais: I wo_l_ li_evingt oignons: t_enty o_io_sdix chou-fleurs: t_n ca_l_flo_ersun kilo de poisson: a ki_o of fi_hune tranche de jambon: a sl_c_ of _amune bouteille d'eau: a bo_t_e of w_ter...

Advance Functions 2024-07-22

13 Items: To change the base, we used the:Statements that compare two expressionThe smallest repeating unit of the functionWhich is attached to the highest degree of “x”line that a curve approaches, as it heads toward infinityA set or group of functions that share common characteristicsA relation in which each x-value in the domain has a unique y-value...

Unit 1 Test Review 2023-10-24

21 Items: one way we use our foodused to handle hot potsphysiological influence examplethe body's main source of energythis is used to reach high placestype of shoes worn in the kitchenthis provides our body with energyshould be disposed of with a broomcarries nutrients throughout the bodythis is an example of a media influence...

Heather's Mortgage Word Search 2022-10-27

20 Items: Fannie MaeFreddie MacWhat is a 1003To buy real propertyThe number of days the lock is effectiveproperty secured to the repayment of the loanThe numeric value issued by the credit bureauFee paid to an appraiser for preparing an reportThe annual cost or fee associated with a serviceThe first individual listed on a loan application...

Clinicaldepression Word Search 2022-10-21

15 Items: UnhappyPsychoanalystA mental disorderRelated to emotionsA form of treatmentA bad way of thinkingAuthor of Harry PotterIn need of sleep and restFreud's theory on depressionA medicinal form of treatmentThe inability to relax or sleepA person who prescribes medicationAnother word for Clinical DepressionActor who's open about his depression...

Unit 6 Vocab 2023-02-08

22 Items: a natural discharge of groundwaterwells that are drilled down to reach aquifers(width x depth x velocity) of water in a streama curve in a stream channel made by moving waterformations of calcium carbonate on floor of a caveformations of calcium carbonate on a caves ceilingpermeable underground layer where groundwater flows...

Inkspiration 2022-06-23

25 Items: catdogSIGNbookgamedreamhobbymottomoviecareercoupleANIMALfriendcopycathometowninterestmarriagememoriesmilitaryrelativechildhoodsuccessesOF A CHILDmilestonesOF A LOVED ONE

Module1: Introduction to pathology/Skeletal system 2023-12-20

18 Items: The primary site of ossificationThe most common form of arthritisA generalized decrease in cell sizeA generalized increase in cell sizeHaving more than one illness at the same timeAn abnormal change occurring in mature cells.The forward slippage of one vertebra on anotherA specific cancellous bone located in the skull...

Annuities 2023-07-19

29 Items: the property of a deceased individualbe "appointed" to sell a specific company's productsA legal binding agreement between two or more partiesThe basic amount of investment, exclusive of earningsRefers to the monthly anniversary of the "day" of issue for a Policythe person whose age is used to determine the amount of annuity income...

World Religions Word Search 2023-02-06

15 Items: God in IslamA Jewish FaithJewish LanguageJewish Holy BookA God or GoddessMuslim Holy BookMuslim set of rulesThe Worlds Oldest ReligionFounder of the Jewish FaithA leader of the Jewish faithA religion with only ONE GodA religion with multiple GodsA religion followed by MuslimsFounder of the Christian FaithThe set of rules for Christians

Reception 2023-10-22

23 Items: First dateAustin's jobKaitlyn's jobWho is older?years togetherour cat's nameTown of first homeAustin's first namecouple's dog's nameAustin's birth monthname of the best manKaitlyn's middle nameKaitlyn's birth monthKaitlyn's maiden namewhere did he propose?Austin's favorite sportour nontraditional petsnumber of months engagednumber of total siblings...

Unit 10 2024-05-14

15 Items: The smallest unit of lifeSomething that has never been aliveVariations that help a species surviveSomething that is alive or used to be aliveWhen two organisms both need the same resourceAll populations of different species in an areaPhysical differences between members of a speciesMosquitos and humans have this kind of relationship...

Semester Exam 2018-12-17

38 Items: airlifeacidbasemasseartheightmodelsmetalsmattertheoryenzymeproblemproductprotonssciencedensityprecisenucleusphysicalreactantvariableneutronschemicalmoleculeeighteenpoliticscatalystaccurateviscositynonmetalssubstancesaturatedelectronsinhibitortechnologyconductorsdotdiagrams

Science 2023-03-02

39 Items: dnaatomgenecellacidsolarspacee=mc²platetheoryneuronfossilmatterenergygenomegravityecologyclimateelementquantumecologykineticclimatechemicalbacteriageneticsfrictionevolutionecosystemexperimenthypothesismicroscopeartificialendangeredmeteorologybiodiversityradioactivityphotosynthesiselectromagnetism