states of matter Word Searches

The Greek Pantheon 2026-04-18

19 Items: God of warGod of deathGod of the forgeKing of the GodsGoddess of springGoddess of discordGoddess of victoryGoddess of the huntGoddess of marriageGoddess of the harvestGod of the sea and horsesGoddess of love and beautyGod of poetry and prophecyGod of wine and indulgenceGod of wealth and the deadGod of thieves and travelers...

Topic 9 Chemical Reactions Vocabulary 2024-10-23

15 Items: a chain of molecules made up of repeating unitsa substance that enters into a chemical reaction (change)matter cannot be created or destroyed in an isolated systema substance formed as a result of a chemical reaction (change)basic particle of matter; the smallest particle of an element that...

Suspensions Word Search 2025-03-26

35 Items: ion with (-) chargealso known as basesgas with pungent ordereasily absorbs moisturesubatomic with (+) chargecontraction of surface agentsion with (+) electrical chargeparticles with negative chargemixture of 2 or more substancessimplest form of chemical matterrapid oxidation of heat and lightsubatomic particles with no charge...

25 Favorite Saints 2025-09-25

25 Items: JeromeLiguoriAmbroseAquinasof Paduaof Sienade Salesof Avilaof Avilathe GreatAugustinethe Greatof BingenAthanasiusof SevilleChrysostomBellarmineof LisieuxBonaventureof Poitiersof Clairvauxof Nazianzusof the Crossthe Venerableof Alexandria

U6 Homeostasis 1 Wordsearch 2022-11-15

21 Items: increase the speed of enzymesmolecule that an enzyme acts uponable to dissolve in other substancesThe energy needed to start a reactionsmaller pieces of something larger, that make it upa state of balance of the internal conditions of an organismenzymes are specific to the molecules in which they work upon...

The Rise of Sumerian City-States 2025-10-20

16 Items: siltRiverRiverSumerleveehillsplainsproblemfarmerssolutiongeographyMountainsfoothillsirrigationcity-stateMesopotamia

science 2015-11-17

9 Items: gasflowsolidliquidforcesstatesboilingstrengthparticles

China Word Search 2025-12-11

9 Items: zhouchinastatesperioddynastyeasternwesterncapitalagriculture

What is matter 2025-11-20

16 Items: gasmasswarmcoolsolidstatewatermatterenergyweightvolumefreezedensityheaviermaterialwatervapor

PUZZLE 4 2025-07-18

15 Items: IndiaChinaJapanItalyEgyptStatesBrazilCanadaRussiaFranceAfricaMexicoGermanyKingdomAustralia

Chapter 2: Properties of Matter 2025-09-10

10 Items: gasmasssinksolidfloatliquidmattertemperaturephysical-statephysical-properties

What Matter Is Made Of? 2024-11-18

10 Items: neutral subatomic particle found in the nucleusan abbreviation used to represent an element’s namedense center of the atom that has a net positive chargethe sum of the number of protons and neutrons in an atomshells around the nucleus in which electrons can be foundpositively charged subatomic particle found in the nucleus...

Place in space 2026-08-17

19 Items: The centre of a black holeThe outermost part of a galaxyType of galaxy; squashed circleThe closest galaxy to the milky wayA gaseous or rocky satellite of a starType of galaxy - looks like snail shellThe point of no return for a black holeThe galaxy that contains the solar systemA natural satellite that orbits a planet....

Wavelength Word Search 2026-03-12

11 Items: Reflectionhighest point of a wavea wave of light you can seeThe height of a wave or depththe number of repetitive motionsWhat is the lowest part of a wave?a wave where matter moves back and fortha wave where the matters moves up and downthe bending or changing direction of a waveWhat do you call colours or frequency of visible light?...

Countries 2025-07-01

15 Items: ChinaIndiaJapanItalySpainStatesCanadaMexicoBrazilFranceRussiaAfricaGermanyEnglandAustralia

Argentina Word Search 2026-09-15

15 Items: EgyptIndiaJapanKenyaSpainBrazilCanadaFranceMexicoStatesGermanyZealandNigeriaArgentinaAustralia

Federal Word Search 2026-04-20

9 Items: StatesPowersFederalFreedomCongressAmendmentsGovernmentConstitutionAntifederalists

us states 2025-02-01

12 Items: YorkOhioTexasNevadaFloridaGeorgiaArizonaIllinoisMichiganCaliforniaWashingtonPennsylvania

ESS 2024-03-27

10 Items: julynationunitedstatesfreedomlibertyamericapatrioticcelebrationindependence

EMANCIPATION PROCLAMATION 2024-12-29

10 Items: UNIONCIVILSTATESFREEDOMLINCOLNSLAVERYABRAHAMPRESIDENTPROCLAMATIONEMANCIPATION

fathersday 2025-03-26

10 Items: mealwomanearlyfatherstatesfathersholidayofficialcountriesappreciation

Spelling 2026-02-02

10 Items: yearstraysfoxesfliesstatesinchescitiesponieslunchescherries

The Central Bank In The Founding Era of The United States 2026-01-01

10 Items: BURRDUELIDEASSTATESCOUNTRYHAMILTONAUTHORITYCOMPETINGJEFFERSONFEDERALIST

California day 22nd February 2026-04-06

10 Items: WestCostBeachPartyGurlsStatesCelebrityExpensiveCaliforniaUnitedStates

North America 2026-02-10

12 Items: ArticMexicoCanadaStatesPacificDesertsBeachesAtlanticPrairiesMountainsDiversityTerritories

Geography - Chapter 6: A Profile of the United States 2015-12-18

22 Items: freeareacitytownfarmgrosscanalcitiesUnitedStatesnationproductvillagenationalrailroadhierarchyenterprisehinterlandsettlementmetropolismetropolitantelecommunication

July 2019-06-25

22 Items: redflagbluebandstarswhiteunitedstatessummeranthemparadesamericafreedompicnicsstripeslibertyhotdogsenglandfireworksbarbaequehamburgersindependance

Time to Fly! 2021-08-25

22 Items: fallwindraincoldsouthTexastreeswinterCanadaUnitedStatesMexicoorangenectarMonarchmigrateFloridahatchesmilkweedCaliforniabutterfliescaterpillar

Prohibition 2026-02-24

22 Items: ActUSALawSellMakeCrimePoliceUnitedStatesFamilyAlcoholPovertyIllegalProhibitVolsteadViolenceProblemsEnforcedAmericanstransportProhibitionManufacture

BORDERS 2026-06-05

22 Items: icelandwallbordermarginunitedstatespolicenativestatusracismcountrynaturalcustomscentersboundaryculturalmovementdetentionartificialimmigrationdeportation

Adams Word Search 2026-06-19

22 Items: JULYADAMSFOURTHNATIONPARADERIGHTSSTATESUNITEDAMERICAFREEDOMHOTDOGSLIBERTYBARBECUECOLONIESCONGRESSEQUALITYTHIRTEENFIREWORKSJEFFERSONREVOLUTIONDECLARATIONINDEPENDENCE

Light Waves - Amplify 2025-12-15

18 Items: to take into give offto pass througha range of wavelengthsan object that emits lightthe maximum height of a waveto bounce off without absorbinghow often or fast something happensto form a mental picture of somethingthe ability to make things move or changeanything that has mass and takes up spacea type of invisible light that is beyond violet...

COUNTRIES 2025-06-23

15 Items: ITALYCHINAJAPANSPAINRUSSIABRAZILFRANCEGREECEMEXICOENGLANDPORTUGALCOLOMBIAARGENTINAUNITED STATESUNITED KINGDOM

6TH LESSON 10 2024-01-24

19 Items: uglyclockworldtowersundialPAST TENSE OF DOPAST TENSE OF GOPAST TENSE OF BUYPAST TENSE OF EATPAST TENSE OF MAKEPAST TENSE OF DRAWPAST TENSE OF COPYPAST TENSE OF STOPPAST TENSE OF BUILDPAST TENSE OF WRITEPAST TENSE OF CATCHPAST TENSE OF DRINKPAST TENSE OF THINKPAST TENSE OF INVENT

2024 Fall Semester Final 2024-12-18

15 Items: Your teachera logical appealAn ethical appealAn emotional appealThe tallest mountainThe main idea of a textThe subject of this classWhat you are taking right nowThe largest animal to ever liveConvincing someone you are rightComparing two things using like or asthe name of someone in the 10th gradeRepetition of beginning consonant sounds...

U.S states 2026-08-14

12 Items: IdahoAlaskaHawaiiAlabamaArizonaFloridaGeorgiaArkansasColoradoDelawareCaliforniaConnecticut

Famous Singers 2026-07-03

19 Items: Singer of ExpressoSinger of Ocean EyesSinger of DandelionsSinger of Blank SpaceSinger of Shape of YouSinger of Wild FlowersSingers of Viva La VidaSinger of City of AngelsSinger of That's So TrueSinger of People You KnowSingers of Counting StarsSinger of Born In the USASingers of Hey Soul SisterSinger of Last Friday NightSinger of Devil In Disguise...

Unit 3 PS The Structure of Matter 2025-08-08

17 Items: GasAtomSolidModelLiquidPlasmaProtonElementNeutronNucleusMoleculeCompoundElectronMassNumberAtomicNumberStateOfMatterNaturalElement

Unit 1 What is your favoriate video game? 2024-01-11

16 Items: booksongbandteamalbumrugbychinajapansportstennisbrazilcanadacricketcountriesice-skatingunited-states

North/Central/South American Countries 2025-11-21

16 Items: PeruRicaCubaChileHaitiCanadaStatesMexicoBrazilPanamaGuyanaBoliviaColumbiaGreenlandArgentinaVenezuela

Greek Generations 2025-11-21

42 Items: God of war.God of wine.God of light.God of the SunGod of the sea.The god of sleep.Goddess of the MoonThe goddess of night.Goddess of the hearthMessenger of the gods.The goddess of the day.Goddess of the harvest.Goddess of fresh water.King of the gods and sky.God of fire and the forge.Goddess of love and beauty.The personification of death...

Lesson 14: The Constitution Vocabulary Words 2024-02-21

11 Items: The branch that makes laws.The branch that carries out, or executes, lawsThe document that describes how the U.S. government works.An agreement in which each side gives up some of what it wants.The branch that interprets laws and settles disagreements about them....

Matter Word Search 2025-10-23

15 Items: GasSolidStateMatterLiquidMeltingBoilingScienceFreezingExperimentHypothesisEvaporationTemperatureCondensationObservations

Healthy Muscles Matter 2026-01-21

15 Items: pumpresttalkliftdietbloodmusclethroatsoccerbreatheskeletalmovementlawnmowervoluntaryexercising

Matter Word Search 2026-06-11

15 Items: VAPORMATTERENERGYCHANGEDENSITYTHERMALKINETICMELTINGBOILINGCOOLINGHEATINGPROPERTYFREEZINGSUBSTANCECONDENSED

football 2024-12-04

10 Items: gamessportsStatespopularstudentswatchingdangerousorganizeddisciplinecommercials

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substanceenergy in the form of heatenergy associated with motionable to dissolve other substances.the basic unit of a chemical element.the degree of compactness of a substancethe speed of something in a given direction.the rate of change of velocity per unit of time.the ability to be dissolved, especially in water....

Fall Break! 2018-09-21

23 Items: poolfallreadcampxboxsoilbeachbooksgamescouchfamilyStatestravelflyingAtlantaplayingPokemonswimmingstaycationDisneyWorldHarryPotterMeteorcraterobstaclecourse

Election Day! 2024-11-05

23 Items: joevicetrumpswingpollsearlymediadonaldkamalaharrisunitedstatesvotingwinnertuesdayrunningmichiganelectoralpresidentgovernmentwhitehousecaliforniapennsylvania

BILL OF RIGHTS 2024-11-21

22 Items: BILLCOURTRIGHTSSTATESTINKERAMERICAHISTORYJUDICIALMRJORDANPOLITICSAMENDMENTEXECUTIVEKUHLMEIERALEXANDERGOVERNMENTFREESPEECHLEGISLATIVEDECLARATIONSUPREMECOURTINDEPENDENCEREVOLUTIONARYCONSTITUTIONAL

great lakes 2026-04-28

23 Items: ErielineHuronGreatLakesfreshwatershoreUnitedStatesborderCanadaTrontonatureSuperioMiciganOntarioeconomyChicagoDetroitMilwaukeeCleverlandrecreation

Civics 2026-04-30

55 Items: Makes lawsEnforces lawsInterprets lawsUpper house of CongressLower house of CongressPresident rejects a lawAdvisors to the presidentHighest court in the U.S.First U.S. government planLawmaking body of the U.S.Change to the ConstitutionPowers given to the statesAgreement between countriesEveryone must follow the lawFair treatment under the law...

States of Consciousness and Dreams Word Search 2021-01-21

23 Items: WishamoCFreudLucidLatentDreamsDreamsContentContentManifestDaydreamHypnosisSynthesisProcessingNightmaresActivationMeditationFulfillmentInformationDissociationSubconsciousPreconsciousConsciousness

America 2022-04-25

9 Items: redbluestarsstatesamericajoebidenwashingtondcmissouririvermountmckinlay

Independece Day Puzzle 1 2024-03-27

9 Items: nationunitedstatesfreedomlibertyamericapatrioticcelebrationindependence

Vote Word Search 2025-06-24

9 Items: PIEVOTEOATHPROUDBRAVEUNITEDSTATESWAFFLEHISTORY

BILL OF RIGHTS 2024-11-21

22 Items: BILLCOURTRIGHTSSTATESTINKERAMERICAHISTORYJUDICIALMRJORDANPOLITICSAMENDMENTEXECUTIVEKUHLMEIERALEXANDERGOVERNMENTFREESPEECHLEGISLATIVEDECLARATIONSUPREMECOURTINDEPENDENCEREVOLUTIONARYCONSTITUTIONAL

Classifying Matter 2021-08-29

10 Items: massmattervolumedensitythermalrelativeconductorinsulatormagnetismsolubility

Matter Vocabulary 2024-01-25

10 Items: gassolidliquidmeltingevaporationcondensationpuresubstancesolidificationhomogenousmixtureheterogenousmixture

5.1-5.3 CR 2025-09-23

12 Items: word choiceWriting stylelook over workput stress on subject matterWhat should there be no mistakes of?Type of figurative language, no like or aswords that carry strong or emotional weightType of figurative language, uses like or asKnowledge that has been selected to be presentedType of language writers should use to convey ideas...

Chemistry Word Search Extra Credit 2025-10-28

20 Items: Smallest unit of matterGroup of covalently bonded atomsForces between different moleculesOuter electrons involved in bondingSharing of electrons between nonmetals“Sea of electrons” shared among metalsTwo or more elements chemically bondedPositive ion; atom that loses electronsNegative ion; atom that gains electrons...

Plantation Word Search 2023-09-26

21 Items: -petite gulf cotton seedtype of evil for slaverylarge agricultural estateMS outlawed all blacks from ittype of slave who worked indoorsto act against inhumane treatmentMS institution established in 1844type of slave who labored outdoorstwo causes were slavery and tariffswithdraw to protect MS's state's rightsMS prohibited free black people from it...

Government/Politics Word Search 2025-09-23

20 Items: LawsDutyObeyTaxesRightsCanadaStatesVotingFreedomRepublicGovernorJudicialCitizensPresidentExecutiveParliamentAmendmentsLegislativeConstitutionPrimeMinister

Civics and Citizenship 2025-10-14

22 Items: PERTHCOLONYSYDNEYSTATESEMPIREBRITAINJUBILEEVICTORIATASMANIACANBERRAADELAIDECONVICTSSETTLERSMONARCHYDEMOCRACYAUSTRALIAFEDERATIONQUEENSLANDINDIGENOUSIMMIGRANTSPARLIAMENTCONSTITUTION

Meriwether Lewis 2026-04-14

21 Items: armybearlandlawsLewischiefClarkpolicestatesHuntingAmericaGovernordiscoverMissouriexploredsiblingsSacagaweaLouisianaMeriwetherExpeditionadventurer

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substanceenergy in the form of heatenergy associated with motionable to dissolve other substances.the basic unit of a chemical element.the degree of compactness of a substancethe speed of something in a given direction.the rate of change of velocity per unit of time.the ability to be dissolved, especially in water....

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substance.SOLUTEthe basic unit of a chemical element.ATOMenergy in the form of heat.THERMAL ENERGYable to dissolve other substances.SOLVENTenergy associated with motion.KINETIC ENERGYthe degree of compactness of a substance.DENSITYthe speed of something in a given direction.VELOCITY...

chapter 13.3 2025-05-05

10 Items: an animal of a breed of cattle with long horns.city that serves as the county seat for Albany County, Wyoming, in the United Statesdrive, activity of cowboys herding sizable groups of cattle from the vast pastures of the WestTrail, a trail used in the post-Civil War era to drive cattle overland from ranches in southern Texas,...

Mind Over Matter 2025-04-10

15 Items: FocusBeliefClarityMindsetSelfloveGratitudeConfidenceResilienceCommitmentDisciplineConsistencyEmpowermentIntentionalBreakthroughDetermination

Matter and Materials 2025-07-01

15 Items: GasIronWoodClaySolidWaterGlassPaperStoneMetalLiquidPlasmaOxygenCottonPlastic

Midwestern States 2026-04-08

12 Items: OhioIowaKansasIndianaMichiganIllinoisMissouriNebraskaWisconsinMinnesotaNorthDakotaSouthDakota

Dillon Singleton Ch.16 Vocab 2025-04-16

14 Items: Horizontal row in the periodic table.Vertical column in the periodic table.Number of protons in an atom's nucleus.Particle in the nucleus with an electric charge of 1+.Particle of matter that makes up protons and neutrons.Atom of an element that has specific number of neutrons.Electrically neutral particle inside the nucleus of an atom....

history 2026-03-06

11 Items: the 10 out of 12 amendments that were ratifiedan alliance or Union that unites to achieve common goalsA bill that passed to establish a plan for surveying the landofficial approval requires the approval of at least nine statesopposed the Constitution and having a strong central government...

Chapter 11 Twist on Vocabulary 2023-04-21

38 Items: windelevation above sea levelwater in the form of a gashow hot or cold something isthe lower part of the thermospherethe outer layer of the thermospherewinds that blow over short distancesreflection of light in all directionsthe lowest layer of earth's atmospherean instrument used to measure wind speedan instrument used to measure temperature...

GREEK generations 2025-11-21

41 Items: God of war.God of wine.God of light.God of the SunGod of the sea.The god of sleep.Goddess of the MoonThe goddess of night.Goddess of the hearthMessenger of the gods.The goddess of the day.Goddess of the harvest.Goddess of fresh water.God of fire and the forge.Goddess of love and beauty.The personification of deathThe primordial god of the sea....

The Louisiana Purchase 2026-02-05

11 Items: BurrPikeLewisClarkFranceStatesNapoleonHamiltonLouisianaJeffersonSacagawea

The European Renaissance 2026-08-16

11 Items: Medicisourcehistorywealthyevidencemonarchycity-statesindependentsinglerulercentralizedgovernmentRepresentativegovernment

Science End Of Year Choice Board 2026-05-07

11 Items: The smallest units of matter that make up everything.Molten (liquid) rock found beneath the Earth's surface.A pure substance made of only one specific type of atom.Rock formed from the cooling and hardening of magma or lava.Rock changed from its original form by extreme heat and pressure....

Dark Matter 2023-12-05

10 Items: darkwidestarsmatterenergygalaxymassiveuniversevelocityinvisible

United Word Search 2026-03-03

20 Items: ChinaIndiaJapanKoreaItalySpainStatesRussiaFranceBrazilCanadaArabiaTurkeyMexicoAfricaKingdomGermanyAustraliaIndonesiaArab Emirates

Local Government 2025-02-11

19 Items: rulemayortownsstatescitiescourtsjudgesbranchleaderbranchmemberscounciljusticemeetingsgovernordecisionslawmakerscommunitygoverment

War of time 2026-01-27

20 Items: warwarcodescivilunionhousesolderstatesbosquemexicostatehoodamericansassimilateassimilatereservationterritoriesreservationconfederatesectionalismslaveholding

Chapter 11 Twist on Vocabulary 2023-04-21

38 Items: windelevation above sea levelwater in the form of a gashow hot or cold something isthe lower part of the thermospherethe outer layer of the thermospherewinds that blow over short distancesreflection of light in all directionsthe lowest layer of earth's atmospherean instrument used to measure wind speedan instrument used to measure temperature...

Ethnic studies 2024-06-04

9 Items: warunitedstatesisraelfinanceweaponsprotestgenocidepalestine

Chapter 11 Twist on Vocabulary 2023-04-21

38 Items: windelevation above sea levelwater in the form of a gashow hot or cold something isthe lower part of the thermospherethe outer layer of the thermospherewinds that blow over short distancesreflection of light in all directionsthe lowest layer of earth's atmospherean instrument used to measure wind speedan instrument used to measure temperature...

cOUNTRY 2025-08-16

10 Items: JapanChinaKoreaIndiaCanadaBrazilStatesThailandAustraliaPhilippines

Risorgimento Word Search 2023-03-01

11 Items: crimeamazziniliberalgiuseppemoderatepiedmontgaribaldiyoung-italynationalismunificationpapal-states

United Word Search 2024-09-09

12 Items: ChinaIndiaEgyptJapanStatesCanadaBrazilFranceMexicoAfricaKingdomAustralia

Living Systems Investigation 1 & 2 2025-04-21

24 Items: All of the water on Earth.Anything that takes up spaceA collection of interacting parts.To use again or continue a process.The rock and mineral part of Earth.A mixture of decayed organic matter.An organism that makes its own food.The layer of gases surrounding Earth.A reddish-brown worm found in decaying material....

Lesson D Reading Word Search 2023-11-15

16 Items: the action or practice of meditating.the accomplishment of an aim or purpose.a feeling of worry, nervousness, or unease.the state of being free from injury or illness.the state of being comfortable, healthy, or happy.focus a persons attention on a particular activity.to have optimistic, affirmative, and good feelings....

Export Control 2025-09-25

7 Items: Tool used to screen end use (r)Consequences of Export Offense is ___________.Goal of Export Control. Fight against __________Types of goods are _________ and Immaterial goods.Goal of Export Control. Be cautious of __________itemsThe EC Key Considerations are WHO,WHERE,WHAT & ________....

Spanish Speaking Countries and Their Capitals 2026-04-16

21 Items: The capital of Cuba is …The capital of Peru is …The capital of Chile is …The capital of Spain is …The capital of Mexico is …The capital of Panama is …The capital of Bolivia is …The capital of Ecuador is …The capital of Uruguay is …The capital of Colombia is …The capital of Honduras is …The capital of Paraguay is …The capital of Argentina is …...

Travel 2024-12-25

13 Items: landJapanKenyaChinaItalyEgyptLondonBrazilStatesFranceDenmarkIrelandPortugal

Bill of Rights 2023-09-26

23 Items: fairjuryarmsbilltrialmediafirsttenthpresscivilgatherfourthstatesspeechrightswarranttortureprivacysearchedassemblereligionamendmentdoublejeopardy

US History Essentials U85-L2 Civil War 2025-03-06

23 Items: unionstatesrightscollegegeneraltacticsstrategyblockadeantietamtotalwarElectoralsecessioninauguralrebellionartilleryfortsumterMasonDixonGettysburgAppomattoxconfederacyemancipationproclamationbattleofbullrun

Swim 2025-09-23

21 Items: SwimTeamCheerMeetsRelayHeatsSpiltFamilyStartsSprintsWarmUpsTurtlesFrogKickMermaidsFlipTurnOpenturnFreestyleButterflyBackStrokeStreamlineBreaststroke

Current Events 2026-03-02

23 Items: WarNotJetIranMoreWillEastTrumpWarnsChaosUnitedStatesIsraelDeathsTroopsMiddleKuwaitFighterCrashesAttackedEscalatesNegotiateHezbollah

Unit 9 Definitions 2025-12-08

17 Items: A collection of objectsFundamental ___ PrincipleElements in both sets A and BThe set of all possible outcomesA useful way of visualizing setsElements that are in either A or BA possible result from an experimentAn action or trial with varying resultsA way to describe a set with no elementsThe product of all natural numbers from n to 1...

Parade Word Search 2026-07-01

9 Items: CivicLegalRulesTownsVotersPoliceLawyerCitiesStates

States and Capitals (Midwest Region) 2025-03-05

24 Items: The capital of Ohio is __________.The capital of Kansas is __________.Topeka is the capital of __________.The capital of Indiana is __________.Lansing is the capital of __________.Madison is the capital of __________.Lincoln is the capital of __________.The capital of Michigan is __________.The capital of Illinois is __________....