states of matter Word Searches

History - Chapter 3: The Fertile Crescent 2016-07-11

37 Items: dikesSumerAkkadTorahMosesSinaiDavidJudahstylusTigrisSargonExodusCanaanIsraelPersianBabylonJudaismcontactHebrewsAbrahamGoliathSolomonHittitescovenantpromisedzigguratscuneiformHammurabiEuphratesAssyriansJerusalemMesopotamiacity-statesPhoeniciansPhilistinesCommandmentsFertileCrescent

4th of July 2024-07-04

40 Items: bbqredflagribsbluejulystarspartywhiteparadefamilyhotdogstatesholidaylibertyamericafreedomfreedomstripespicnicscarnivalamericanapplepiesparklerpopsicleicecreampatrioticcherrypiehamburgersparklingpresidentsbakedbeanswatermeloncelebrationcelebrationgrilledcornpotatosaladpeachcobbleramericanflagindependenceday

June 5-11 2023-05-13

24 Items: joylifeloveseeknisanfriendwisdomloyaltyhonestyjehovahprosperinherittogetherhezekiahpassoverhumilityholinessmarriagegatheringjerusalemof jehovahmotivationneutralityof Unleavened Bread

Units 44 and 45 Part 2 2024-01-18

62 Items: votedpublicnationalby votingto be sent(color) silver(color) copper(neuter) the wood(neuter) the metal(feminine) the voteof or made of glassof or made of plastic(feminine) the revolutionwooden, of or made of wood(feminine) the (law) treatyof or made of stone or rock(neuter) the (rock) diamond(masculine) the (male) slaveof or made of metal, metallic...

Unit 5: Spelling Lesson 1 2023-01-12

25 Items: composed of onefoolish or sillyan eating establishmentcomposed of more than onea shortened form of a wordslanted cursive or type characterscomprising everything; comprehensiveconsisting of diverse things or membershappening as a minor result or by chancethat which had being before something elseuninfluenced by emotion; based on the factual...

Shelach 2024-06-22

18 Items: “Send”Shalom“Fallen ones”Ammiel’s father.“The Ninth of Av”a cluster of grapes“In the Wilderness”Where Moses sent the scouts.The Master’s “Sent Out” onesThe city Moses bequeathed to CalebHoshea son of Nun was from this tribeSon of Hori, from the tribe of Simeon.He sends out spies in the Haftarah Shelach.Caleb, son of Jephunneh was from this tribe....

Challenger - Comet Vocabulary ALL - Word Search 2023-05-16

30 Items: The compactness of an object.To move in a circle or orbit around.The seven colors that make up white light.The title of elected US government officials.A group of stars that form a picture or a shape.The action of rotating around an axis or center.A comet that orbits the Sun in less than 200 years....

Vocabulary year 7 2015-09-17

41 Items: fallChinaKoreathanksmemberMexicoBrazilschoolfathermothersistersummerautumnCanadaUnitedStatespartnerAmericastudentteacherbrothercollegecountrywelcomeeveningmorningaverageActuallyspeakingexcitingvacationstudentsgreetingtomorrowclassmatelisteningcafeteriachemistryafternoonuniversityconversation

Alexandria Ocasio-Cortez 2023-10-01

27 Items: YorkTermRicanbronxStateslatinainternelectedKennedySandersoctobersenatorDistrictDirectorcongresscampaignCampaignamericaneconomicsRelationsCommunityUniversityadvocatingalexandriapoliticiansocasio-cortezrepresentative

Class 4 Science Exam 2023-06-12

35 Items: gasheavylightsolidwaterlightsounddecaywasteopaquematterliquidplasmalivingsafetymethodmeltingheatingcoolingmixturesolublescienceclassifyfreezingsolutiondissolvedecomposefiltrationtransparenttranslucentdecantationsedimentationbiodegradablemicroorganismcharacteristic

United States Part 1 Levering 2022-08-27

25 Items: iowaohiomainetexashawaiioregonalabamaarizonafloridavermontillinoiskentuckymissourinebraskaminnesotanewmexicowisconsincaliforniawashingtonconnecticutrhodeislandsouthdakotanewhampshiremassachusettsnorthcarolina

Metric Measurements 2022-08-17

19 Items: masskilodecadecihectoUnitscentimillilengthconversiondisplacementgraduatedcylinderthe unit of volumethe unit of distancethe unit of weight/massis smaller than centimetersis the amount of space an object takes upare one thousand times larger than a gramis the unit in between a kilometer and a decameter

Country 2023-04-29

10 Items: ItzaMahalpetraPicchuof Gizacolosseumof Libertystonehengethe RedeemerWall of China

Self Care (Black Wellness Matter) 2023-10-26

16 Items: smilereadingfishingwalkingdancingshoppingcraftingbreathinggardeningbubblebathexercisingmeditatingaffirmationtakevitaminsordertakeouthealthyeating

Baluster Word Search 2023-02-24

25 Items: a fence or barrier made of rails.a short pillar or column on stairsthe lower square slab at the base of a column.a horizontal beam connecting two rafters in a roofa window that projects vertically from a sloping roof.move from a lower position to a higher one, come or go up.a side post or surface of a doorway, window, or fireplace....

Canadian History 2023-11-06

40 Items: furrulecabotharshpeltsbattledefeatempirehockeyquebecsprucestatesunitedbritishcoastalcontrolsailingvictoryvikingsweaponscoloniesdiscoverfortresslacrossemedicinemontrealreligionsoldiersthirteenestablishexplorerseuropeansloyalistssnowshoesindigenousprotectionresponsiblesettlementsindependencerepresentatives

Drama Word Search 2023-10-19

12 Items: a play written or adapted for television.a list of all the characters in the play.the perspective from which a story is toldFeeling or atmosphere that a writer creates for the readera dramatic work intended for performance by actors on a stagedescriptions of setting, characters, or actions (usually in italics)....

Plate Tectonics: 4.01-4.02 Vocabulary 2022-11-18

12 Items: CAPABLE OF BEING MOLDEDCAPABLE OF BEING MOLDEDTHE OUTERMOST LAYER OF EARTHTHE UPPER PART OF EARTH'S MANTLEUPPER MANTLE JUST BELOW LITHOSPHERESOLID IRON AND NICKEL LAYER OF EARTHTYPE OF CRUST THAT IS DENSE AND THINLIQUID IRON AND NICKEL LAYER OF EARTHTYPE OF CRUST THAT IS THICK AND LIGHTPART OF EARTH BENEATH THE CRUST MADE UP OF ROCK...

Space Exploration 2013-06-17

34 Items: SunMarsUnitMainVenusEarthPlutoWhiteSaturnUranusDwarfsmatterGalaxyCometsmeteorequinoxMercuryJupiterNeptuneNebulaeMassiveSolsticeellipsesSequenceLightyearProtostarSupernovaMeteoritegeocentricMeteoroidsSupergiantsheliocentricAstronomicalInterstellar

Random Thoughts 2015-01-28

39 Items: cardogyouredhugsnowfallrainsaltBestyoloThatintodataHippohellonightlighttodaygamesafterwomenthinkbrightjacketfriendwantedstatesrandompopcorntappingtomorrowsandwichSaturdayspellingtogetherthoughtsdifferenthappening

Meiosis 2024-05-31

17 Items: period between two periods of mitosishaving chromosomes in homologous pairsa period in the life of the cell when it is conducting cell divisiona condition in which non-sister chromatids of homologous chromosomes exchange geneshaving a single, complete set of chromosomes, or one half of each pair of homologous chromosomes...

Admin key term word search chapter 1 2022-12-14

21 Items: cmarmarmaaamamshposhaabheshipaacaahepresumeclia'88registrationaccreditationcertificationcross-trainingstandard-of-carepatient-navigatorscope-of-practicecontinuing-educationlicensed-practitionerprofessional-development

South East States 2023-05-25

10 Items: floridageorgiaalabamaarkansaskentuckylouisianatennesseenorthdakotasouthdakotamississippi

Foundation Word Search 2022-09-16

25 Items: the lower edges of a roofto support the roof ceilingThe inclined member of staircombination of tread and riserto give support to the handrailthe bottom horizontal member of athe inclined rail over the stringextend from the caves to the ridgecovers the top face of the buildingone that allows fresh air and lightthe surface laid on the plinth level...

Parts of a Song 2024-02-16

16 Items: the speed of the music; BPMthe "first paragraph" of a songthe musical structure of a songform that is verse, chorus, versethe words in the song; expresses emotionthe sense ("feel") of an insistent rhythmform that is verse, chorus, verse, bridgemost 3-pointers made in one NBA game (14)strong, regular, repeated pattern of beats...

Chinese Rulers, Dynasties, and Philosophers 2023-09-28

18 Items: The Shortest DynastyThe Last Dynasty of ChinaThe Last Emperor of ChinaThe First Emperor of ChinaThe First Dynasty in ChinaThe Longest Lasting DynastyThe Philosopher who Wrote The AnalectsBorn as a Peasant, but Became an EmperorA Philosopher Who Wrote "The Art of War"The Emperor Who Started the First DynastyThe Dynasty that was Founded in 202 B.C.E....

Science definitions 2023-05-15

16 Items: measures air pressurechanges moisture contentweight of air pushing down on eartha tropical storm with winds exceeding 119 km/hrmeasures the amount of precipitation that has fallena front where cold air mass replaces a warm air massoccurs when a cold air mass takes over a warm air massfront that stays in one place for a long period of time...

Science definitions 2023-05-15

16 Items: measures air pressurechanges moisture contentweight of air pushing down on eartha tropical storm with winds exceeding 119 km/hrmeasures the amount of precipitation that has fallena front where cold air mass replaces a warm air massoccurs when a cold air mass takes over a warm air massfront that stays in one place for a long period of time...

Sensory Organs & PNS 2022-10-03

31 Items: ear waxsense of smellnearsightednessear inflammationinability to hearnoise in the earseyelid inflammationanother word for styhardening of the earpertaining to hearingcapable of being heardanother word for cryingsmall dark circle in eyeabnormal pressure in eyemucous membrane of eyelidsurgical repair of ptosisanother word for lazy eye...

Countries 2022-10-04

17 Items: 🏔🇵🇱🇦🇺🇫🇷🇳🇬🇮🇳🇮🇹🇩🇪🇭🇳🇧🇷🇵🇹🇨🇳🇪🇸🇯🇵🇮🇪🇨🇦States 🇺🇸

Step Word Search 2023-02-24

23 Items: view of buildinglead on window frame structure.combination between rise and tread.created where two roof slopes meet.length of projection beyond the forward perpendicular.is the fitting together of pieces to give a structure support and shape.a cluster of buildings in an enclosure, having a shared or associated purpose....

Global II Review 2024-06-03

24 Items: "Gold, God, and Glory"Louis XIV's fancy house.Seafaring Scandinavian warriorsThe capital of the Byzantine Empire,The head of the Roman Catholic Church.Famous Empress of the Byzantine Empire.Probably the most famous German monk ever.The 1054 split within the Christian Church.A major Mesoamerican capital built on Lake Texcoco....

4.7 Spelling Words : We, the people of the United States 2014-02-25

20 Items: inchespaddedblamedurgingcousinsscoringindexesderivedclippingninetiesflurriestrophiesstrikingsecuringpermittednighttimescarecrowpresidingskyscraperastonishes

Stock Market Terms 2022-11-29

31 Items: profit of a companypayment for the use of moneythe money earned by a companythe current price of stocks or bondsthe current price of a stock or bonda company owned by two or more peopleA period of generally rising stock pricesA period of generally falling stock pricesmoney a corporation pays to its stockholders...

Stock Market Terms 2022-11-29

31 Items: profit of a companypayment for the use of moneythe money earned by a companythe current price of stocks or bondsthe current price of a stock or bonda company owned by two or more peopleA period of generally rising stock pricesA period of generally falling stock pricesmoney a corporation pays to its stockholders...

Spelling/Vocabulary word search puzzle 2022-11-10

15 Items: not alivebring to lifestrong disliking.a small, yellow birdrelating to metaphysics.an animal that feeds on flesh.the form and size of a persons bodythe rebirth of a soul in a new body.a traveling amusement show or circus.a person qualified to practice medicine.relating to the body as opposed to the mind....

Door Word Search 2022-09-15

28 Items: A rounded roofA person who designs buildingsHorizontal member of step (stair)Vertical member of a step (stair)A structure that has a roof and wallsA design plan or other technical drawingwood that is prepared for use in buildingA fence or balustrade made of rails and postsThe lower surface of a room that people walk on...

Biology Word Search - Kiki 9b 2024-06-11

15 Items: the coloring in a leafa reagent that tests a leaf for starchA part of a plant that attracts pollinatorsA part of a cell that supports and protectsA part of the vascular bundle that carries waterAn organ that is responsible for transport in plantsthe product of using iodine on a leaf after photosynthesis...

paiges wordsearch 2023-12-18

19 Items: a soundour galaxywhat we live onwere we live inthe study of the universeknown as the little dipperthe belief on constellationsare stars of youre birth monthcontellation of the northern skywere a planet goes around the suna rock that falls from earth to spacelumps of rock or iron that orbits the suna big constellation that looks like a spoon...

M3 Parts of a Flower 2023-09-04

14 Items: the male gamete of a flower.Tough outer coat of the seed.Sweet, sugary fluid found in flowers.Part of the flower that stores pollen.Type of organ flowers are to the plant.Colorful part to attract insects and birds.Part of the flower that holds up the anther.The place where the male and female games fuse....

Overcharge Word Search 2024-03-07

12 Items: down + to pullhappy + state oftoo much + to usefluffy + state ofunder + relating to watercreate + causing or makingdirect + causing or makingtoo much + to give power totoo much + ride + past tenserespect + full of + state ofunder + write + act of/state ofdown + write + causing or making

Science definitions 2023-05-15

16 Items: measures air pressurechanges moisture contentweight of air pushing down on eartha tropical storm with winds exceeding 119 km/hrmeasures the amount of precipitation that has fallena front where cold air mass replaces a warm air massoccurs when a cold air mass takes over a warm air massfront that stays in one place for a long period of time...

Science definitions 2023-05-15

16 Items: measures air pressurechanges moisture contentweight of air pushing down on eartha tropical storm with winds exceeding 119 km/hrmeasures the amount of precipitation that has fallena front where cold air mass replaces a warm air massoccurs when a cold air mass takes over a warm air massfront that stays in one place for a long period of time...

Clay's Vocab 2023-09-26

23 Items: made a choiceto show clearlycontaining nothingyoung cows or bullsa quantity of somethingto form a mental pictureto total numbers togetherreflection of sound wavesa way to get into somethinga value that does not changea breaking of a law or promisedownward measurement from a surfacea sweet, brown food that is made from cocoa...

Law 2024-01-19

20 Items: physicalpersonCreator of the "eye for eye" theoryThe name of the Codex for Civil lawSince we are born we have certain ...Basic unit of a legal system is a .....Meaning of the sword Lady justice holdsCopyright lasts for ... years after deathOnly one legal system in place is called...the state of being legally and officially true...

unit 9 2024-05-01

20 Items: another name for petroleuminclude coal, oil, natural gasmost common form of hydro powergas cleanest burning fossil fuelsmall bubbles of NG trapped in iceany organic materials, including wastessomething that doesn't occur continuouslyusing a fuel for both electricity and heatareas with consistent wind with many turbines...

Word Search 2024-04-05

34 Items: corefogscrusthazesveilspallsmistscavummuruscaudamantlematterflumencirrusshadowsshroudsmantlesvolutusvolutusfluctusculumusstratusbiospheregeosphereatmosphereconvectionhydrospherelithospheresilvagenituscumulonimbusasthenosphereflammagenitusphotosynthesiscataractagenitus

jacob 7th grade 2024-05-16

15 Items: a group of living organismsthe variety of life on Earthis defined as the number of different species.a large naturally occurring community of floraa large open area of country covered with grassa state of balance between continuing processes.is a hot, moist biome where it rains all year longabandon in a way considered disloyal or treacherous....

Yoto Carnegie 2023 Word Search 2023-05-03

9 Items: The number of shadowers in TeamBerkoThe surname of the author of 'When Shadows Fall'TeamBerko (The name of our school shadowing group)The title of the shortlisted book by Jessie BurtonThe title of the shortlisted book by Patrice LawrenceThe surname of the author of 'The Light in Everything'The month of the year in the title of the 2022 medal winner...

Coronation word search 2023-04-30

13 Items: The dog of royaltyThe King's first nameOne of the King's sonsThe name of the King's mumThe month of the coronationThe age of King Charles IIIThe name of the King's wifeThe city that the king lives inWhat the king wears on his headThe event that happens to crown the kingOne of the colours on the Union Jack flag...

ATOMS  2020-09-24

35 Items: BOHRWAVEATOMSCLOUDGASESMODELREPELENERGYMATTERPROTONQUARKSATTRACTCOMBINEELEMENTISOTOPELIQUIDSMOSELEYNEUTRALNEUTRONNUCLEUSADHESIONELECTRONMOLECULENEGATIVEPOSITIVEFLAMETESTSUBATOMICATOMICMASSDEMOCRITUSJOHNDALTONRUTHERFORDATOMICNUMBERATOMICWEIGHTSCHROEDINGERQUANTUMTHEORY

Random Thoughts 2015-01-28

39 Items: cardogyouredhugsnowfallrainsaltBestyoloThatintodataHippohellonightlighttodaygamesafterwomenthinkbrightjacketfriendwantedstatesrandompopcorntappingtomorrowsandwichSaturdayspellingtogetherthoughtsdifferenthappening

The Reign of Fulk 2023-04-19

12 Items: Captured from Fulk by ShamsSite of covent built by MelisendeCoastal town controlled by Hugh IIRecipients of the castle of BethgibelinMarried Pons’ son, Raymond II of TripoliNew governor of Damascus eager to work with FulkForced to stay in Latakia after being ousted from AntiochConstable of Jerusalem chosen by Melisende after Fulk’s death...

WH40K 2024-06-04

100 Items: - The Chaos God of war, blood, and skulls.- The Chaos God of change, fate, and sorcery.- The Chaos God of excess, pleasure, and pain.- The Chaos God of decay, disease, and despair.- The heavily armored suits worn by Space Marines.- The immortal ruler and psychic beacon of humanity.- A versatile combat exoskeleton used by T'au warriors....

Endocrine System Word Search 2023-04-07

20 Items: promotes constructive metabolisma hormone produced in the pancreasa body system that produces hormonesthe human bodies main source of energyan excess of glucose in the bloodstreamdeficiency of glucose in the bloodstreama medication that treats type 2 diabetesa hormone produced by the pituitary gland...

Respiratory System Word Search 2023-12-20

17 Items: Pleura that lines the thoracic cavityEarly pulmonary tuberculosis is usuallypleura that adheres directly to the lung tissueCystic fibrosis is classified as a(n) __ diseaseFormation of a cavity within the lungs as a result of TBPleural effusion is considered a(n) __ pathologic conditionThe gas exchange between the lungs and the circulatory system...

kassidys word search 2023-12-18

18 Items: big bareSmall bareshoting starare universespace reserchersgive off or glowa sistem of starscontalashon beliefwe are on ---- earthIcy body that releases gasespeace of rock still in spacesomeone that "lives" in spacelight bounceing off something12 hours of day 12 hours of nightthe moon is stuk in the earths ...longest or shortest day of the year...

Madhubani Wordseach 2023-07-19

18 Items: Madhubani painting were made duringWhich Madhubani motif symbolises fertility?Which flower is used to create the orange colorMithila Museum is located in this part of JapanHow many styles of Madhubani paintings are thereMadhubani was originally painted on which surface?In Madhubani paintings, Lotus is a symbol of which gender...

Grade 8: PHYSICAL SCIENCE 2014-10-19

36 Items: gasmassatompuretablesolidmattervolumeenergyprotonchangechangeliquidsolutedilutenucleusneutronelementmixturecolloidsolventelectroncompoundmoleculeperiodicphysicalchemicalsolutionparticledissolvesubstancepropertiessuspensionhomogeneousconcentrateheterogeneous

States 2024-03-22

4 Items: JuneauPhoenixMontgomeryLittle Rock

Week 8 Thursday 2023-10-06

25 Items: course of studyTo buy somethingMario's occupationWorthy of attentionwritten communicationto support with evidenceHappens at the same frequencyBelonging to a particular personFirst in the order of importancea math sentence with an equal signA number that is not a whole numbersharing an edge or boundary; touchingConvert waste into a reusable material...

Mont: Y9 Area Conversion/Area of 2D shapes 2023-09-08

17 Items: A three-sided polygon.A rectangle with all sides of equal length.Units of measurement based on the metric system.Shapes that have two dimensions - length and width.A mathematical relationship or rule expressed in symbols.A part of a circle enclosed between two radii and an arc.A four-sided figure with opposite sides equal and parallel....

yay 2023-03-20

26 Items: a piece of hardwarea voltile memory storagethe brains of the computerwhat the computer puts outthe little square on photossomething that is programmedinside the CPU to process datathe same as solid state storageused in the resolution of photosa way of storing quick use memoryhow to give power to the computersomething made using computer logic...

Chemistry Midterm Exam Wordsearch 2014-01-21

35 Items: IonGasAtomBetaMassJouleGroupMetalAlphaGammaEnergymatterPhotonFamilyAlkaliRadiusProtonLiquidQuantumHalogenValenceNeutronNucleusIsotopechemicalSpectrumPeriodicAlkalineNonmetalElectronRadiationIonizationTemperatureconfigurationElectronegativity

Science Vocabulary 2015-08-23

35 Items: ionatombasecellgenemetalorganvirusarterydeserthybridkidneymatterprotontissuetundrabladdercontrolelementerosionhabitatmixturenucleusvaccinewetlandantibodypathogensolutiondigestionecosystemrecyclingsubstancechromosomefloodplaingrasslands

Jackys cool word search 2022-11-28

10 Items: moves parrelnumber of wavesmeserued in meterslocation of maximunmaximum displacementmeasure of displacementhighest point on the wavethe distance of wave cycleereas of maximum displacementwaves move the medium perpendicular

Corsica Word Search 2023-11-24

18 Items: 1821: Died on May 5th on _____.1809: Defeated _____ at the Battle of Wagram.1804: Crowned himself _____ of the French.1769: Born on August 15th in _____, France.1785: Graduated from _____ academy in Paris.1793: Distinguished himself at the Siege of _____.1799: Led a _____ and became First Consul of France....

STARR Vocab Word Search 2023-01-24

37 Items: without awarenessa hostile challengea state of adversitystrengthen and supporta feeling of extreme joya feeling of evil to cometurn aside; turn away froma feeling of intense angerdepriving one of self-esteema longing for something pastextreme distress of body or mindmarked by deliberate deceptivenesscause someone to believe an untruth...

Redox Vocabulary (paired with Holt PDF Textbook) 2023-05-01

15 Items: site of reductionsite of oxidationelectric potentialThe gain of electronsThe disintegration of metalsone half of the overall redox reactionaccept electrons easily and are reducedtwo electrodes separated by an electrolyteThe loss, wholly or in part, of one or more electronscause reduction to happen and are themselves oxidized...

Medical Term Ch 2 2024-01-17

16 Items: Out ofWithinControlThe study ofA specialistGrowth or formationThe study of diseaseCondition produced by diseaseCommonly known as belly button or navelA disease producing microorganism such as a virusProvides protective padding, insulation, and supportThe basic structural and functional units of the body...

Science definitions 2023-05-15

16 Items: measures air pressurechanges moisture contentweight of air pushing down on eartha tropical storm with winds exceeding 119 km/hrmeasures the amount of precipitation that has fallena front where cold air mass replaces a warm air massoccurs when a cold air mass takes over a warm air massfront that stays in one place for a long period of time...

Science definitions 2023-05-15

16 Items: measures air pressurechanges moisture contentweight of air pushing down on eartha tropical storm with winds exceeding 119 km/hrmeasures the amount of precipitation that has fallena front where cold air mass replaces a warm air massoccurs when a cold air mass takes over a warm air massfront that stays in one place for a long period of time...

Science definitions 2023-05-15

16 Items: measures air pressurechanges moisture contentweight of air pushing down on eartha tropical storm with winds exceeding 119 km/hrmeasures the amount of precipitation that has fallena front where cold air mass replaces a warm air massoccurs when a cold air mass takes over a warm air massfront that stays in one place for a long period of time...

Property & Commercial Insurance Terms 2022-07-06

20 Items: rateperilbaileehazardpremiumrobberyindemnifyvandalismThe chance of lossThe date on which a policy endsLegally binding contract of insuranceA request by an insured for insuranceA person entrusting goods to another.Risks, perils or properties defined in the policy as not covered...

SkinPathology-Pugh 2022-08-15

22 Items: the creation of vitamin dcells that produce pigmentrespond to noxious stimulianother way to say hypodermisdetect changes in temperatureglands that secrete via ductsstratum made of layers of dead cellsstratum found in the palms and solesdetect pressure vibration and stretchthe most superficial layer of the skinspecialized cells that produce keratin...

Week 16 Thursday 2024-02-04

25 Items: To includeIn place ofFemale childHarm or damageTo give adviceReal or genuineA recommendationNot able to be seenTo go back and forthKindly or charitableTo ask for informationto think about carefullyThe result of a subtractionGiving assistance or supportOne of the materials in a mixtureHaving to do with the sky or heavens...

S 2024-04-09

19 Items: (mystery)(peculiar)(watchful)(captivating)(proper manners)(group of stars)(sad and pensive)(theatrical dance)(science of sound)(calm and peaceful)(related to horses)(related to cooking)(sentimental longing)(art of good cooking)(lively and energetic)(complex musical piece)(ability to bounce back)(study of celestial bodies)...

Bamidbar 2024-06-01

14 Items: “Kohen”Firstborn of Leah“In the wilderness”“the one who counts”Dan and Naphtali were sons of _______.This functioned as a portable Mt. SinaiA priest must be descended from ______.They died for offering unauthorized fire before HaShemThe Torah calls the armies of Israel “_____”. Numbers 1:3These were set apart to protect and maintain the Sanctuary....

Week 17 Thursday 2024-02-04

25 Items: PersonTo excludeA group of alliesIn a joyous mannnerAn arm, leg or wingCareful or cautiousOpposite of backwardTo show or point outSharp-edged utensilsThe right to use powerAble to do many things wellWanting what someone else hasCompeting for a better positionThe first person to create somethingTo rub fat on a surface while cooking...

Riser Word Search 2023-02-23

25 Items: The outer wall of the triangular roofVertical height for each step in the ladderThe tip of the step that sticks out like a noseThe top floor of a building directly under the roofA great way to cover and protect your home from the sunThe lowest part and is in direct contact with the groundA staircase constructed between two floors in a building...

SOL 7: Word Search 2023-12-04

11 Items: Our state's highest courtThe highest court in our nation (the U.S)This is the name of the state's legislative branchThe leader's position of the state's execute branchThe second in command of the federal executive branchThe second in command of the state's executive branchThis is the state's version of the House of Representatives...

Foundation Word Search 2022-09-16

25 Items: the lower edges of a roofto support the roof ceilingThe inclined member of staircombination of tread and riserto give support to the handrailthe bottom horizontal member of athe inclined rail over the stringextend from the caves to the ridgecovers the top face of the buildingone that allows fresh air and lightthe surface laid on the plinth level...

Public Speaking Basics 2023-10-26

16 Items: stand alone topicsWhat is this unit aboutthe closing of the speechthe major part of the speecha “sneak peek” at the speechrecap all of the informationtheft of intellectual propertythe overall goal of the speechenhance the main points of the speechto share information with the audienceallows speaker to identify with audience...

Science definitions 2023-05-15

16 Items: measures air pressurechanges moisture contentweight of air pushing down on eartha tropical storm with winds exceeding 119 km/hrmeasures the amount of precipitation that has fallena front where cold air mass replaces a warm air massoccurs when a cold air mass takes over a warm air massfront that stays in one place for a long period of time...

Typhus Word Search 2022-11-16

34 Items: three dotsPost-war illnesspunctuation markSite of personalitySprouting seedlingssubtitle (one word)modern narrative stylemovie title (one word)Site of the Stone Dancetrigger of flight for coverSite of the nuclear accidentDirect opposite of somethingprotein one fears to consumeexperience of Charlotte Wolfdead fish that move when cut...

Filix School of Education (Grade-IV) Science 2024-05-03

18 Items: The centre of the tooth.Disease caused by virusesthey makes our teeth strongA thin sticky layer of germsDisease caused due to protozoaIt is caused due to tooth decay.The four front teeth in each jaw.They are also called tearing teeth.Helps to make soft cakes and bread.We must visit him/her twice a year.They are also called grinding teeth....

Anatomy & Physiology-Muscles (Milady Esthetics) 2024-06-04

37 Items: middle part of a musclemuscle associated with smiling2-part muscle that covers the nosetemporal muscle; involved in chewinglarge, triangular muscle covering shoulderring muscle of eye socket; closes the eyelidwhen muscles turn inward; ie palm faces downwarddraws corners of mouth out and back when grinning...

Orlando 2024-05-13

22 Items: EyeBayCoveEolaepcotCenterCenterof ArtOrlandoSpringsStudiosStadiumKingdomExhibitionof AdventureSpot AmericaOrlando ResortAnimal KingdomTyphoon LagoonRip Ride RockitDisney World ResortWizarding World of Harry Potter

spelling words 2016-01-14

41 Items: 1.2.3.4.5.6.7.8.9.10.11.12.13.14.15.16.17.18.19.20.areastaredairylargeforcesquaredaringbewarebeforeUnitedStatesJanuarypartnerarticleargumentguardingordinaryAmericanorchestraimportantdictionary

WH Mod, Unit 16 Vocabulary 2023-02-02

25 Items: German submarinefinal set of demandslarge gas-filled balloonglorification of the militaryone who favors extreme changesprepare military forces for waragreement to end fighting in a warpolicy of supporting neither side in a wargroup of merchant ships protected by warshipsnonbinding agreement to follow common policies...

Week 15 Thursday 2024-02-04

25 Items: out loudWent upwardin the distanceselected for a joba period of 100 yearsmake resistant to fireto pay no attention tothe state of being happyhead of a group of soldiersbringing or worthy of honorthe head of a state governmentshut in on all sides; surroundA brief or an unexpected meetingthe outside or surface of something...

Cristmas Revision 2022-11-28

15 Items: Buying and selling of church positionsSupporter of reform in the Catholic churchEnglish or Scottish soldiers who had fought for the crownPeople who were planted in foreign territory by the crown.The appointing of relatives to Church jobs regardless of meritLaws, Laws that suppressed the status of Catholics in Ireland....

Islam Timeline 2023-07-26

15 Items: 570: _____ is born in the city of Mecca.1187: _____ retakes the city of Jerusalem.1526: The _____ Empire is established in India.630: Muhammad returns to _____ and gains control of the city.1099: Christian armies recapture _____ during the First Crusade.632: The dispute over who would lead Islam begins between these two groups....

Islam Timeline 2023-07-26

15 Items: 570: _____ is born in the city of Mecca.1187: _____ retakes the city of Jerusalem.1526: The _____ Empire is established in India.630: Muhammad returns to _____ and gains control of the city.1099: Christian armies recapture _____ during the First Crusade.632: The dispute over who would lead Islam begins between these two groups....

Insurance and Mail facilities 2023-09-03

10 Items: Direct advertisingRemittance of moneyA range of delightful cardsSafeguard against rising medical costProvide measure of financial support to farmersEffective vehicle for indian corporate to advertise brandReliable delivery ensuring your packages reach destination quicklySum of money is secured to the assured in even of death of bulls cows...

Conifer Vocab II -- Forestry 2024-06-03

25 Items: The slender, pointed leaf of a coniferous tree.Small pores on plant surfaces, regulating gas exchange.The green pigment in plants responsible for photosynthesis.The inner, older wood of a tree, providing structural support.Trees that shed their leaves annually, in contrast to conifers.The protective outer covering of a tree, composed of dead cells....

Plankton vocab 2024-01-22

22 Items: respirationother organismsLargersized plankton visible under a microscopeSmall crustaceans that are a common type of zooplanktonExtremely smallsized plankton smaller than microplanktonSmall animals that feed on phytoplankton or other zooplanktonOrganisms that obtain their energy by consuming other organisms...

social studies vocabulary 2022-06-14

14 Items: jurycivilgroupenlistof lawappealvaluesdonatedemandsupplyinquiryof rightsconventionpoint cabinet

NORTHEAST REGION STATES AND CAPITALS 2016-11-21

22 Items: mainedoveralbanybostonnewyorkvermontaugustatrentonconcordmarylanddelawarehartfordnewjerseyannapolisharrisburgprovidencemontpelierrhodeislandconnecticutpennsylvanianewhampshiremassachusetts

United States and it's allies 2023-05-17

51 Items: italyspainegyptjapanqatarcanadafrancegreecenorwaypolandturkeybrazilisraeljordankuwaitalbaniabelgiumcroatiaczechiadenmarkestoniafinlandgermanyhungaryicelandlativiaromaniabahrainmoroccotunisiaukrainebulgariaportugalslovakiasloveniacolumbiapakistanthailandlithuaniaargentinaaustraliagreenlandluxembourgmontenegronewzealandsouthkoreanetherlands...