states of matter Word Searches

CVA Review Game 2024-01-05

16 Items: Pertaining to the heartAnything that makes a substance unusable for its intended purpose.Section Delivery of fetus by incision through the abdominal wall and uterine wall.Pertaining to the cranium or the head end of the body, or anterior end of the body.A light proof housing for X-ray film, containing front and back intensifying screens....

Breed Word Search 2024-01-05

16 Items: Pertaining to the heartAnything that makes a substance unusable for its intended purpose.Section Delivery of fetus by incision through the abdominal wall and uterine wall.Pertaining to the cranium or the head end of the body, or anterior end of the body.A light proof housing for X-ray film, containing front and back intensifying screens....

Waves 2016-03-21

33 Items: heatechoatomswavessoundgasesenergyenergyabsorbmattersolidsnucleusreflectliquidstransmitmoleculesfrequencywaterwavelightwaveswavelengthsoundwavesvibrationslightenergysolarenergysoundenergyseismicwavevisiblelightinfraredlightstateofmatterenergytransfernuclearreactionultravioletlightelectromagneticspectrum

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Room 217 is The Best 2022-08-29

28 Items: samavaremyliamandyjackmateohazeljacobcarsonannikaoliviadominozephyrsawyeradriancedricpolinacharlierussellamolikacarolineannamikabrooklyncharlotteThe name of our schoolThe name of your teacherThe name of Principal Malone's pug

Past Participles 2023-11-15

8 Items: The PP of goThe PP of eatThe PP of takeThe PP of giveThe PP of haveThe PP of speakThe PP of drinkThe PP of write

Year 9 English 2024-07-05

35 Items: The ____ Plot 1605______ kills Duncan'half-formed ______''Be the ____ under't'Tennyson was Poet _______Genre of Macbeth: ________'I carving out me _______'Who kills Macbeth? ___________A commanding verb is an ______Poem by Carole Rumes 'The ____'Post __________ Stress Disorder'Straight I unloosed her ______'Playwright of 'Macbeth': _________...

Quest 2 2022-10-15

12 Items: The Ancient of Knowledge.Home to the Vermilion elves.A young keeper, blind at birth.Known as the "Jewel of the South."The main antagonist of the Warminster Series.The animal species the Faircloth family breeds.Incanus Dru'Waith is a ____ elf and an assassin.Erud's magical tome is called The Tome of ________....

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

Salon Skin Care 2023-07-10

20 Items: Foul-smelling perspirationCapable of destroying fungiA large blister containing clear, watery fluidThe study of muscles - their structure, function and diseasesAny material that allows or supports the flow of electric currentSmall, red elevated protrusion of the skin, usually containing no pus...

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Toes and Foot Word Search 2024-07-16

20 Items: For an AP foot, the central ray is angled ___ ___ degrees.What part of the 5th metatarsal is on profile on an oblique foot?When positioning for lateral toes the 1st-3rd toes require ___ ____.When positioning for lateral toes the 4th-5th toes require ___ ____.For all positions of the toes how much of the metatarsals in required?...

Reconstruction 2024-02-20

8 Items: Lincoln's successorThis is what happened to Lincolnperiod of reunifying the country between 1865-1877The amendment the ended slavery except as penalty for a crime.The 15th Amendment protected the right to this regardless of race.prohibited Black people from owning property, firearms, occupying certain places, and testifying in court...

Matter and Energy in Ecosystems 2024-05-30

18 Items: fatinputenergyoutputstarchsystemglucoseproductglycogenmoleculeproducerreactantecosystemorganismsdecomposermitochondrionphotosynthesisenergystoragemolecule

Chapter 3: How Living Things Interact (Part II) 2014-11-21

32 Items: oldpreynichelevelmattergrowthmimicrymineralorganicpigmentpioneerspeciesprimaryrecycletrophicwarningmoleculeomnivorepredatorconsumerproducertertiarypredationscavengersecondarypopulationsuccessioncolorationnourishmentreproductionmicroorganismphotosynthesis

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Review 2023-11-14

32 Items: gassolidgroupanionmetalmatterliquidplasmaperiodcationelementneutrondensitycompoundelectronnonmetalnoblegasmoleculesionicbondmetalloidhomogenousmassnumberdepositionsublimationheterogenousatomicnumbervaporizationcondensationcovalentbondphysicalchangeschemicalchangesvalenceelectron

How Well Do You Know Your Model A #5 2023-12-30

20 Items: Charging gaugeA theft deterrent.Leaf spring hanger.______________ bowlA grouping of wires.A vintage brand of tire.pulls air thru the radiator.Center of the wheel assembly.Controls carb and distributorDraws additional gas to start.Original color of radiator hoses.A common brand of updraft carburetor.Wire junction box on top of generator....

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

CCES Wisers Extended: Word Search 2023-02-22

15 Items: ilayaparademinifairfielddemoboardgamesartcontestthewitnesssportsgamesName of your schooltheme for this yeargroup _____ of Todaygroup ____ of Tomorrowgroup _____ of Yesterdaybeing celebrated right nowWhat you call the students who goes to your school

History & Wildlife Conservation 2024-01-17

27 Items: value to earn moneyfirst national parkfather of soil conservationpublished a book about birdssystem of safe wildlife areaspart of USDA to manage forestsvalue to enjoy wildlife's beautyfather of the conservation movementpopulation is close to becoming extinctthe use of natural resources for profitpopulation is close to being endangered...

Natural Resources 2024-03-10

25 Items: resources that occur naturallymixture of gases surrounding earth3 types of inexhaustible resourcesremains of decomposed plants & animals3 types of renewable natural resourcesnatural resources used to provide energycycle where water is continuously renewednatural inorganic substances on or in earth2 types of of nonrenewable natural resources...

Science Word Search 2023-05-25

25 Items: The ability to dissolveThe harmful rays that come from the sunAn animal that hunts and eats other animalsA scale that shows the acidity of substancesThe SI base unit of thermodynamic temperatureThe type of cloud that tells you a storm is comingWhen different species work together, BOTH benefitThe layer of the atmosphere where weather occurs in...

All things quality 2022-12-13

18 Items: a name of a QC xxxquality is a "xxxxx" not an actpeople representative for qualityquality can improve this "12 letters"a brand of chocolates "quality xxxxxx"one of Bede's values (POD - 6 letters)best place to work (company name "xxxx")a brand / manufacturer of quality cars (Swedish)quality can improve this with customers / clients...

Unit IV Review: Abs-sci-ment 2024-05-17

22 Items: ______ the Terrible_______ WollstonecraftThe Index of _____________The belief that one should doubt everythingEmpress of Russia known for her Enlightened ideasThe spread and mixing of various cultures and ideasThe idea that the sun is at the center of the solar systemA child who ascends to the throne following a parent's death...

Variation 2023-05-18

20 Items: A random change in DNAThe variable you changeThe variable you measureThe organelle that contains DNAThe variables you keep the sameA different form of the same geneThe technique used to photograph DNAA result that does not fit the patternCharacteristics we get when we are bornThe change in species over millions of years...

Aiden 7th grade 2024-05-16

15 Items: the driest of all the biomesthe biological variation that occurs within speciesa ridge of rock in the sea formed by the growth and deposit of coral.the variety of different habitats, communities and ecological processesthe variety of life in the world or in a particular habitat or ecosystem....

Gabby's Wave Word Search 2022-11-28

10 Items: - The lowest part of a wave- Area of maximum displacment- The highest part of the wave- Area of maximum displacement- Measurement of maximum displacement- distance of one complete wave cycle- Moves parallel to the wave of motion- Waves or vibrations produced per second- Moves perpendicular to the wave of motion...

Word search - States 2023-07-11

10 Items: utahohioidahomainetexasoregonarizonafloridamontanacolorado

Unit 3: Electrons in Atoms 2023-09-26

20 Items: 3.00 x 10^8 m/sHeight of a waveparticles of lightthe arrangement of electrons in an atomElectrons on the outermost energy level of an atomthe clockwise or counterclockwise motion of an electronthe possible energies that electrons in an atom can havenumber of complete wavelengths that pass a point in a given time...

Epidemiology Topic 3 2023-01-28

12 Items: S____ maps show locations of individual cases.Descriptive epidemiology enables development of testable h__________.Cross-sectional allows measure of the p________ of something(e.g. a disease).Descriptive epidemiology provides information useful for a_________ of resources....

Sound Word Search 2022-12-13

11 Items: moving back and forththe absence of matterthe way a wave travelshow high or low a sound iswhat sound waves travel throughwave the type of wave a sound isalso known as longitudinal wavesthe ability for something to do workwhen air particles are furthest apartwhen air particles are close togethervibrations create this so you can hear it

PSG Scoring and Event Quiz 1 2024-04-23

22 Items: teeth grindingirregular heartbeat>90% drop in airflowrapid cycling P waves>10 mmHg increase in PaCO2heart rate >90 BPM during sleep>3 second pause(6+ years of age)<40 BPM during sleep (6+ years of age)30 sec for staging, 120 sec for scoringSleep ____ distribution of sleep stages_____ rhythms the body's natural clocks...

Slappy Word Search 2024-07-22

20 Items: NightZombiesBeware!of a Dummyof the Jack!in DreamlandFriend SlappyBlood Is Backand the Beastwith the StarsBirthday to YouGhost of Slappyof the SquawkerAlive! It's Alive!from Shudder Mansionof the Invisible BoyAm Slappy's Evil TwinDo Not Feed the WeirdoDummy Meets the Mummy!Call Me the Night Howler!

Kaylee Word Search 2022-10-05

29 Items: MANmosslovenavyROOMCLAYmarchblushkayleehunterturkeyfamilyweddinghuntingcupcakesOF HONORSECURITYsaturdayburgundyhoneymoontennesseeflowergirlDIXIE FARMSOF THE BRIDEOF THE BRIDEOF THE GROOMOF THE GROOMWAY FOR MOSSLAUREN PHOTOGRAPHY

Mitosis 2023-02-21

17 Items: The life of a cell.Two Identical Cells.The last phase of mitosis.The second stage of meiosisThe first stage in cell division.An organism of one or more cells.The process by which a cell divides.Division of the cytoplasm of a cell.To repeat or copy (something) exactly.The process in reproduction and growth cells....

The Nervous System :) 2024-02-21

15 Items: - the largest lobe of the brain- the sensory switchboard of the brain- part of the brain that controls breathing- part of the brain that coordinates movement- part of the brain in charge of memory and hearing- a disorder of the brain characterized by repeated seizures- part of the body that receives and sends sensory information...

SIX THE MUSICAL 2023-03-15

17 Items: sixWAYPARRDOWNbradWIVESBOLEYNposadaSEYMOUROF STONEcatherineOF CLEVESkatherineOF HOLBEINLOSE UR HEADYOUR WANNA DODON'T NEED YOUR LOVE

Astronomy  2016-10-21

32 Items: biglawholebangdarkstarblackwhitedwarfgalaxynebulamatterplanetgravityinertiaquasarshubblesuniverserotationapparentabsolutelightyearprotostarastronomysupernovageocentricrevolutionbrightnessbrightnessheliocentricconstellationplanetesimals

Purcom Set 1 word puzzle 2022-12-15

25 Items: Full command in 2 languages.The most famous dead language."What are they talking about?"Sender gives a message to whom?Hearing things through language.Order is issued through language.The Latin word for "communication""meaning are in people, not words"Obstructs exchange of communication.Responses to the messages of the sender....

U6 Vocab 2023-11-09

36 Items: A seasonal wind.the coldest climateThe climate of a small area3rd layer of the atmosphereWinds that blow from west to eastThe lowest layer of Earth's atmosphereA thin layer of gases surrounding Earthwhen a cold front overtakes a warm frontThe outermost layer of Earth's atmosphere.A person who studies the different climates....

Biology Chapter 11 Vocabulary Word Search 2024-03-19

25 Items: formation of a new speciesthe variety of alleles in a populationthe changes in a population's genetic structurethe effect of chance on a population's gene poola speciation that occurs via a geographic separationa speciation that occurs in the same geographic spacean evolution that results in similar forms on different species...

71.Alaska and Hawaii became the 49th and 50th states of the United States in 1959. 2023-03-07

30 Items: unionhistorycultureeconomytourismislandscongresspoliticswildlifenationalstatehoodadmissiondemocracygeographyresourcesdiversitymountainsannexationgovernmentpopulationtraditionsterritorieslegislationsovereigntycitizenshipdevelopmentconstitutionindependencenaturalbeautyrepresentation

NervousPathology-Pugh 2022-08-15

15 Items: parkinsons is onebundles of neuronspathway to the CNSpathway from the CNSan involuntary responsefound at nerve synapsessomething affected by ADHDan actual use of medical detoxF of stroke symptom screening FASTA of stroke symptom screening FASTS of stroke symptom screening FASTT of stroke symptom screening FAST...

Wordsearch 2023-03-29

15 Items: The age of LeBron.The shop LeBron owns.The height of LeBron.The daughter of LeBron.The net worth of LeBronThe first son of LeBron.The second son of LeBron.The name of LeBron's wife.The school owned by LeBron.The city LeBron was born in.The month LeBron was born in.The high school LeBron went to.The American state LeBron was born in....

Ian and Liz OO 2024-05-28

29 Items: Groom's sisterMonth Ian proposedBride's professionGroom's professionHen party locationWhere Ian proposedBride's middle nameGroom's middle nameMonth they first metBride's brother's nameGroom's favourite hobbyThe couple's dog's nameCouple's favourite monthThe club they are part ofMother of the groom's nameMother of the bride's name...

ES 2.1 Gravity and the Universe 2022-10-10

15 Items: our galaxytype of meteoritegroups of galaxiesone of 3 types of known galaxiesone of 3 types of known galaxiesone of 3 types of known galaxiesa rotating cloud of gas, ice and dustapproximate shape of ALL known galaxiespiece of a meteoroid that lands on Earthatoms move more quickly when they are __________...

U.S.A states 2022-02-12

7 Items: NewYorkHawaiiAlaskaMarylandOklahomaColorado

Chemistry, Physics, and Energy 2023-05-14

20 Items: measured in Newtonsmeasured in mL or cm^3they make up the periodic tablemetals are good examples of thesethe first step in the water cyclethe formula for it is mass/volumeplastics are good examples of thesethe formula for it is distance/timea phase change, the opposite of depositionthere are two types of it-positive and negative...

ELA Word Search 2024-01-08

26 Items: Time orderExtreme exaggerationThe problem of a storyPerson telling the storyGood guy or hero of a storyOpposition's claim/argumentTo restate in your own wordsSequence of events in a storyBad guy or villain of a storyA word with a similar meaningThe time and place of a storyConversation between charactersMain idea of a text (two words)...

ellies wordsearch 2023-12-18

16 Items: to create lighta pattern of starsthe study of planetshas the north star in itfor light to bounse of itthe study of constellationsa rock that falls from spacea person that travels in spacea spoon made of made of 7 starslight in the sky from a meteoroidapath in space around a planet/starwhen night and day are the same length...

UAE 2021-10-20

37 Items: OilYasAbuDatePalmGulfBurjArabArabTreesHajarDubaiDhabiCamelAjmanStatesIslandSpicesHummusIslandDesertUnitedTrucialPersianTourismFalafelBeachesKhalifaSharjahSaadiyatEmiratesFujairahMountainsArchitectureUmmal-QuwainModernizationRasal-Khaimah

Unit 1 Vocab 2022-09-16

33 Items: lawfactatomcellaniontheorymattercationsolutesolventmonomerpolymerisotopescompoundmoleculesolutionprincipleconstantstechnologyqualitativeengineeringhydrophilichydrophobicquantitativecontrolgroupsurfacetensionmacromoleculesmonosaccharidepolysaccharidevalenceelectronsdependentvariableexperimentalgroupindependentvariable

World Landmarks 2023-02-10

20 Items: BenTowerMahaluluruFallsSophiaMosqueMosqueMosqueAlHaramKhalifaAnNabawicolosseumof Libertyof CordobaOpera HouseGate BridgeBlue MosqueLane MosqueWall of China

Cells Word Search 2024-05-21

15 Items: the smallest unit that can live on its own.provide support and movement to the soft tissues.a type of fibrous connective tissue that links your muscles and bonesA type of blood cell that is made in the bone marrow and found in the blood.a type of eukaryotic cell that lacks a cell wall and has a membrane-bound nucleus...

We're looking for YOU! 2023-09-13

30 Items: alliesconvoyserbiabalkansbelgiumgermanyprussiarivalryslavicsmonarchysarajevobismarcktrenchesbulgariaferdinandzeppelinslusitaniahomefrontultimatummilitarismpropagandanationalismblank-chequedual-alliancelondon-treatyunited-statesbosnian-crisiscentral-powersschifflen-planfranco-russian-alliance

Baluster Word Search 2023-02-24

25 Items: a fence or barrier made of rails.a short pillar or column on stairsthe lower square slab at the base of a column.a horizontal beam connecting two rafters in a roofa window that projects vertically from a sloping roof.move from a lower position to a higher one, come or go up.a side post or surface of a doorway, window, or fireplace....

Baluster Word Search 2023-02-24

25 Items: a fence or barrier made of rails.a short pillar or column on stairsthe lower square slab at the base of a column.a horizontal beam connecting two rafters in a roofa window that projects vertically from a sloping roof.move from a lower position to a higher one, come or go up.a side post or surface of a doorway, window, or fireplace....

Hammurabi Word Search 2023-09-01

20 Items: an ancient manuscript text in book form.In Hindu belief, a person's religious and moral dutiesan official order or proclamation issued by a person in authoritythe belief that people were bad by nature and needed to be controlleda king of ancient Egypt, considered a god as well as a political leader...

Ancient Egypt Terms 2022-08-09

20 Items: The capital city of the Old Kingdom of Egypt.A large stone box that held a mummy's coffin.A queen of Egypt who was famous for her beauty.The season of the year when the Nile river flooded.A charm worn that the Ancient Egyptians thought had magical powers.A powerful queen who became one of Egypt's most successful pharaohs....

Term 4 Review 2022-10-05

13 Items: a text typeHuman _____an IB attributeanother text typean English B themeanother IB attributeanother English B themepart of the core of the DPthe number of IB attributesthe number of English B themesanother part of the core of the DPa strategy for reading comprehensionanother strategy for reading comprehension

Word Search 2024-04-05

34 Items: corefogscrusthazesveilspallsmistscavummuruscaudamantlematterflumencirrusshadowsshroudsmantlesvolutusvolutusfluctusculumusstratusbiospheregeosphereatmosphereconvectionhydrospherelithospheresilvagenituscumulonimbusasthenosphereflammagenitusphotosynthesiscataractagenitus

ww4 u8 2024-04-29

15 Items: a roomto finda way invery valuableto go or come downhaving lots of roomthe outside layer, the topvery old; of a long time agothe inside part of somethinga part or share of the wholea period of one hundred yearsa part of a written work or piece of musicto come or go in without permission or welcomea deep pit where stone is cut out of the ground...

Astronomy Word Search 2023-12-18

21 Items: emitorbitmilkymeteorplanetgalaxyequinoxreflectsolsticemeteoriteursamajorursaminormeteoroidsa constellationa constellationthe research of the skya group of stars in the skythe start of summer or winterthe research of bodies in the skyfrozen leftovers in the solar systema person that flies into space to do research in space

Classic Horror Movies 2022-10-20

15 Items: ManManblobkongmummyof waxpeopledraculanosferatufrankensteinof the operadangerous gameon haunted hillof Frankenstein"from the Black Lagoon

Mexico's Culture 2024-05-09

12 Items: an example of Mexican artofficial name of our countryan example of a Mexican sportofficial language of our countryscientists who study human cultureculture can change when the ___________ changesan example of a thing/element that makes up a cultureanother example of a thing/element that makes up a culture...

By-Election Losers since 2019 2023-10-31

19 Items: with envyKleptomaniacson of Patrickadept at making barrelsTiger in the Jungle Book1996 Formula One Championthe groover from vancouverVs Lion and nearly a Turkeya typical teenager's bedroomdamaged the governor's districtput undergarment in the rubbishtaking the courage out of the camelshortest reigning Monarch of England...

GIFTS OF THE HOLY SPIRIT 2023-06-23

9 Items: faithhealingmiraclesprophecyof wisdomof spiritsof tonguesof knowledgekinds of tongues

Macroeconomics Wordsearch 2024-04-24

14 Items: total amount gainedassets of a businessCreator of Capitalismthe amount of a productthe makers of a productthe buyers of a productwant of a certain productfounder of a new businessa greater demand than supplyamount gained after all expensesthe current price a product is sold atwhen a business fights another for customers...

chapter 2 - tools of environmental science 2023-09-06

17 Items: factor of interestchance that something will happen.representations of objects or systems.the probability of an unwanted outcome.associations between two or more events.a procedure designed to test a hypothesisgroup that receives the experimental treatmenta piece of information we gather using our senses...

Unit 8 APES review 2024-04-30

20 Items: Where over 50% of MSW ends upA common exposure route through the airA common exposure route through the skinA common exposure route through food/ waterIncrease in death rate occurs over a large areaType of waste that is mostly chemical and constructionType of disease not caused by pathogens and can be genetic...

FTFC Word Search 2024-02-08

20 Items: The __________ is responsible to approve the BSN FTFC Policy.BSN Treat Customer Fairly Charter (TCF) can be found in the Bank's __________.The Bank must handle financial consumer complaints __________, fairly and effectively.The Bank must ensure that financial consumers are provided with fair terms in ___________ with the financial consumers....

LGAW Crossword 2024-02-28

18 Items: The Tla'amin Nation NewsletterElected Executive Head of the Tla'amin Nation.How staff present information to elected officialsElected Executive Head of the City of Powell River.The name of elected officials for the Tla'amin NationCampsite and Park managed by the City of Powell River.Elected Executive head of the qathet Regional District....

English Law Word Search 2023-09-13

25 Items: Dealt with major civil casesWrote the first Law Code of EnglandA systematic collection of statutes.A written law passed by a legislative bodyA difficult or painful experience, a trialA court of equity, as distinguished from a common-law court.A legal document giving certain rights to a person or company...

Conduction Word Search 2024-05-16

15 Items: Ice melting in your handwhat is the charge of Cswhat is the charge of Srwhat is the charge of Sewhat is the symbol for Goldwhat is the symbol for radiumwhat is the combination of H+Ohow many electrons are in Goldwhat is the symbol for Hydrogenwhat is the combination of AI+Pwhat is the combination of Ca+Owhat is the melting point of iron...

Agency Administration 2021-04-22

19 Items: BeatZoneSectorBriberyPerjuryPrecinctMoochingShoppingChiselingShakedownExtortionCorruptionMeat-EaterFavoritismGrass-EaterRank-StructureCode-of-EthicsUnity-of-CommandOperational-Strategies

CH6 - Human Impact 2022-12-20

16 Items: Pollutants that are released into the air.________________________Contamination of Earth's land, water, or air.________________________A specific source of pollution that can be identified.________________________The removal of forests to use the land for other reasons.________________________...

Nindita, Maisya & Shofia Riddle 2023-02-23

25 Items: : separating the room: another name for loft: vertical height in stairs: the bottom part of the door: a very common type flooring: different levels of building: the bottom part of the window: highest level in the apartment: the lowest load-bearing part of building: the top element that covering the building...

Compact Word Search 2023-10-06

11 Items: a compact's usual shapea synonym of compactingwhat a compact can carryan antonym of compactingtype of makeup that boldens lipstype of makeup that tans your facetype of makeup that boldens eyelashestype of makeup that colors your eyelidssomething to apply powder onto your facetype of makeup that makes your cheeks rosey...

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Atoms Word Search Puzzle 2017-11-22

33 Items: ionatomrepelorbitbondsnucleifusionmatterquarksattractnucleusfissionprotonsnucleuschemicalneutronsparticleisotopeselementsnucleonsmoleculesradiationelectronspropertiesstableatomsatomicenergyatomicweightatomicnumberperiodictableunstableatomspositivechargenegativechargeatomicstructure

Universe Word Search 2023-11-27

26 Items: wayvoidtimecometyearsaliendwarfastralsystemapollocosmicmattershuttleuniversegalacticgalaxiesredshiftcentauricentauriandromedasatellitessupergiantouterspaceinterstellarconstellationextraterrestrial

Chapter 4 Word Search 2023-11-16

34 Items: Organelle of protein synthesis.Viscous fluid enclosed by the nuclear envelope.Small circle of DNA in some bacteria and archaea.Long, slender cellular structure used for motility.Barrel-shaped organelle from which microtubules grow.This eukaryotic organelle specializes in producing ATP.Semifluid substance enclosed by a cell's plasma membrane....

Math 6 Vocabulary 2023-04-18

15 Items: Part of a wholePer one hundredA comparison of two ratiosA comparison of two quantitiesThe measurement of the space aPositive or Negative Whole NumberA statement of an order relationshipA math statement that shows equalityThe measure around the outside of a circleThe measurement of the outside of a polygonMath phrase with numbers and operation sign...

VOCAB 2023-05-15

11 Items: the moisture in the air.a weather instrument that measures air pressure.the weight of the molecules in a large mass of air.forms when colder air mass moves a warmer air mass.rapitly,whriling,funnel shaped could that reaches down from storm.steady winds that flow from west to east between latitudes 30N and 60N...

Ham Radio 2024-07-12

20 Items: High power operation, typically more than 100 watts.A device used to transmit and receive radio signals.Extremely low power operation, typically less than 1 watt.A contact or conversation between two amateur radio operators.A combined transmitter and receiver unit used for two-way communication....

Electricty Wordfind 2017-08-26

35 Items: AmpOhmVoltFuseWattWireCellAtomsDiodePowerMatterEnergyCurrentNeutralProtonsNucleusCircuitCurrentAmmeterBatteryNeutronsTerminalResistorRheostatElectronsVoltmeterPowerPackConductorsInsulatorsComponentsResistanceSeriesCircuitCircuitDiagramPotentialEnergyParallelCircuit

A Tale of Two Cities 2024-05-10

26 Items: trotspilllumberrelishburiedinformshatterimaginedeliverentertainconstituteThe Shoemakerthe Golden Threadverbs found in ATOTCOwner of the wine shopthe mysterious messengerBanker from Tellson's BankTom's guard on the mail coachRecalled to this______________London and Paris are 2 of thesethe destination of the mail coach...

Carbondioxide Word Search 2024-05-16

15 Items: Produces Atphas a formula of C6H12O6The site of Photosynthesissingle member of a speciesHas a chemical formula of CO2when a liquid turns into a gaswhen a gas turns into a liquidwhen water is released from the cloudsliquid that fills up the inside of a cellConverts light energy into chemical energyall the living and non living things in an area...

Greta's Planet Wordsearch! 2023-12-18

20 Items: our galaxygives off lightwhen light bounces offsomething orbiting the sunMajor Latin name for big bearChris Hadfeild is one of theseA big ball of ice gas and rocka piece of rock still in spaceminor latin name for little beara group of stars making a picturea constellation making a big beara constellation making a little bear...