states of matter Word Searches

Work and Energy 2024-05-30

18 Items: Unit for workunit for energyEnergy that is storedThe ability to do workEnergy that's in motionenergy related to heightenergy of electric chargesenergy stored in chemical bondsenergy from electromagnetic wavesgravitational energy increases with:energy from the vibration of objectsenergy of moving particles in an object...

Passing Word Search 2024-02-07

15 Items: 2nd hit3rd hitturn clockwisereceive the ballstart of the gamejudge of the gameyou need this toocenter of attentionkeep the ball goinga really good serveyou need them to winwhere you are on the courtsuper long, a lot of gamesdefense & offense positionsmatching with your teammates

How Well Do You Know Your Model A #4 2023-12-29

20 Items: modern voltagelifts the valvesprovides inertiaoriginal voltage____ draft carburatermodern battery chargeroriginal battery chargerlegal ownership documentvehicle with body removedtype of suspension springsreduces engine exhaust noisevehicle construction starting pointseals the junction between two surfacesconverts linear motion to rotational motion...

important people in early colonies 2023-01-30

14 Items: married pocahontasminister at Plymouthsecond governor of Plymouthfirst governor of Jamestownfirst child born in New Worldplanned first settlement of Georgiasaid, "you don't work you don't eat"a missionary from The Great Awakeninghired to protect Pilgrims at Plymouthfirst black woman to have book published...

Weather and Climate 2023-05-12

15 Items: Warm water currentchange in moister contentmeasures the air pressuremeasures the speed of windwarm air that rises rapidlyusually brings precipitationmeasures the direction of blowing windthe weight of air pushing down on earthmeasures the amount of heat in the atmospherewhen the boundary between two air masses stalls...

Respiratory System 2022-09-12

28 Items: chestblood clotsuffocatingtaking in of airnormal breathingvocal apparatus of larynxanother name for windpipeinflammation of the lungsinflammation of the larynxair or gas in chest cavityplastic surgery on the nosemembrane surrounding each lungtemporary absence of breathinganother name for auditory tubelabored or difficulty breathing...

Paris Word Search 2023-08-30

30 Items: Capital of CubaCapital of JapanBollywood's homeCapital of ChinaKnown for bankingThe Colosseum cityThe city of canalsCapital of ThailandHome to the PyramidsHome to Disney WorldA vibrant city-stateKnown for the KremlinFamous for its castleFamous for its sunsetsCapital of South KoreaHome to Table MountainFamous for its carnival...

CNA Review 2023-08-31

30 Items: to widenfaintingto urinateChest painheart muscledeath of tissuelow blood sugarhappens suddenlycapable of walkinga patient advocatethe act of vomitingdifficulty swallowingcentral nervous systemthe absence of breathingproduced by the pancreasperipheral nervous systemtemperature taken at the earsystolic bp greater then 130...

Transverse Word Search 2022-11-28

10 Items: lowest point of wavehighest point on wavearea of maximum displacementswhat frequency is measured in2nd area of maximum displacementdistance of one complete wave cyclemeasurement of maximum displacementnumber of waves or vibrations produced per secondwave witch moves the medium perpendicular wave motion...

Virtual Museum Fieldtrip 2023-05-05

10 Items: Kahnitalyl'asiefrancekimbellMatisseestoniaof Apolloof Lazarusdi Buoninsegna

Weather and Climate 2023-05-12

15 Items: Warm water currentchange in moister contentmeasures the air pressuremeasures the speed of windwarm air that rises rapidlyusually brings precipitationmeasures the direction of blowing windthe weight of air pushing down on earthmeasures the amount of heat in the atmospherewhen the boundary between two air masses stalls...

Weather and Climate 2023-05-12

15 Items: Warm water currentchange in moister contentmeasures the air pressuremeasures the speed of windwarm air that rises rapidlyusually brings precipitationmeasures the direction of blowing windthe weight of air pushing down on earthmeasures the amount of heat in the atmospherewhen the boundary between two air masses stalls...

Science 2024-05-16

15 Items: A big place full of wildlifeThey're in our galaxy far awayThe beginning of the water cycleThey come in all shapes and sizesThere are layers inside the earthFilled with living life everywhereThey're very dangerous to us humansBig chunks of ice that float aroundIt was on our planet a long time agoA super natural hazard that's dangerous...

Stairs Word Search 2024-01-23

10 Items: the stepsto come acrossa flow of cool airany kinds of cropsa not finished workto examine somethinga series of somethingthe past tense of throwlooks at something for a long timea printed form used as a way of paying

Space Stuff 2023-01-03

43 Items: The red planetThe first dog in spaceThe north's stars true nameThe color of a sunset on MarsThe brightest star in the skyThe galaxy of our solar systemA belt between Jupiter and MarsThe color of Venus' sulfur cloudsThe planet called the Water PlanetThe most common gas in the universeAn object that orbits another object...

pythagorean theorem 2022-11-20

15 Items: one of its sidesa number that is the square of an integera two-dimensional surface formed by two number lines.the shape or the figure that has three (even higher) dimensionsa number that cannot be expressed as a fraction for any integersthe factor that we multiply by itself three times to get that number....

english lesson 2023-03-28

10 Items: Kinds of Narrative Textstructure of descriptive textgeneral structure of recount textLanguage Features of Recount Textgeneral structure of narrative textLanguage Features of Descriptive Texttext that describes a particular object in detailrecount text whose contents tell historical eventstext which retells events or experiences in the past...

Global Extra Credit 2023-05-02

13 Items: 2nd country3rd countryStopping the spread of CommunismThis plan gave massive aid ($) to rebuild EuropeCommunism spread to these THREE countries in AsiaThe U.S.S.R. kept missiles here, 90 miles off the coast of FloridaChurchill said a ___ was descended upon Europe separating the East from the West...

Boca Grande Historical Society - Word Search 2022 2022-07-15

25 Items: A platted communityA Former island schoolExclusive winter resortShellfish for consumptionA Gasparilla Island countyTreasure of Charlotte HarborNo longer on Gasparilla IslandName for wealthy winter residentsBody of water renowned for Tarpon fishingRailroad built community at North end of islandCompany built storage facility for incoming oil...

Vocabulary 2023-02-02

12 Items: A green vegetable.It makes food sweet.You use them to see.It is a type of meat.A long and yellow fruit.People can hear with them.The opposite of beautiful.A type of food which is white.You need it when you make mistakes.A type of food that is made with milk.A person who has got lots of friends is......

Test crossword 2024-03-20

28 Items: Best manMaid of HonorGroom’s siblingFirst movie dateGroom’s professionGroom’s alma materMother of the groomMother of the brideCouple’s dog’s nameMonth they first metMonth groom proposedColor of groom’s eyesHoneymoon destinationBride’s birthday monthGroom’s birthday monthCouple’s favorite storeCouple favorite TV showCouple’s weekend hotspot...

CKM JROTC abbreviations & Knowledge 2023-04-25

17 Items: Temporary DutyAir Force BaseAs soon as PossibleRank with 5 Stripes0-3 in the Air ForceC in phonetic AlphabetW in Phonetic alphabetZ in phonetic alphabetNon Commissioned Officer"_____Arms" #5 in 30 step_______ Science InstructorPresident of The United StatesAbbreviation for Master SergeantJunior ____ officer training Corps...

BJ 2024-04-11

20 Items: A lover of books.Calm and peaceful.Calm and unemotional.Walking in one's sleep.Done without preparation.A playful or fanciful mood.Keeping watch with alertness.Lasting for a very short time.A sentimental longing for the past.Impossible to understand or interpret.(Of a person) determined and persistent.Happening by chance in a beneficial way....

Rwandan Genocide of 1994 [Checkers] 2024-04-25

45 Items: Related to agricultureGuidance or guardianshipPeople engaged in farmingUnauthorized armed forcesArmed resistance or revoltUp to this point or until nowMajority ethnic group in RwandaTemporary or provisional periodTo instigate or stir up troubleAn extremely wicked or cruel actExemption from punishment or lossRestoration of friendly relations...

Numbers 2024-03-13

15 Items: What is eleven in binary?The percentage meaning halfWhen did Margaret Thatcher die?What is one less than one hundred?When did the Battle of Hastings end?How many hexadecimal colours are there?What is ten to the power of 4 plus one?Which year was the start of the Third Millennium?In Geometry Dash, how many main levels are there?...

WWII Leaders and Ideologies 2023-12-13

12 Items: founded on the principle of elected officials representing a group of peoplea form of government in which the monarch has absolute power among his or her peoplean authoritarian and nationalistic right-wing system of government and social organization...

Quizsearch! 2023-10-24

15 Items: What is a doe?The capital of England?What colour are smurfs?The capital of Scotland?What type of fish is Nemo?What do caterpillars turn into?How many legs does a spider have?Where is the Great Pyramid of GizaWhat is Harry Potter's owl called?The name of the fairy in Peter Pan?The ocean off the Californian coast?The current premier league champions?...

Ramayana Ch. 1-3 2024-02-13

10 Items: Kaikeyi's sonKing of KosalaKaushalya's sonDasaratha's GuruCapital of KosalaShatrughna's motherOne of Sumitra's sonsYaksha cursed by Agastya MuniMaricha and Subahu were henchmen of?Powerful sage who sought Rama's help

Unit 8 2024-04-25

9 Items: Reprocessing of waste into new, useful productsFlow of all wastes produced by the average persontype of waste with mostly household and commercialtype of waste with mostly chemical and constructiontype of waste with manure, crop residue, dead livestocktype of waste with tailings, overburden, broken equipment...

Body as Evidence 2023-11-28

11 Items: Feeding on dead fleshDepositing, or laying, of eggsThe scientific study of insectsA transformation or dramatic changeTemperature of the environment or airThe scientific study of how living things are classifiedPost-mortem cooling of the body to the surrounding temperatureSmall, often microscopic animals, especially those that live in the soil...

Personal Financial Planning 2023-10-17

23 Items: The assets a person ownsPerson who depends on another personLong-term insurance with a savings elementShort-term insurance with no savings elementPayments made by a corporation to its stockholdersThe increase in the value or usefulness of an assetThe decrease in the value of usefulness of an asset...

Words related to Culture 2024-05-02

20 Items: The study of past events (7).A group of people living in the same area (9).Written works, such as novels, poems, and plays (9).A celebration or event, sometimes involving music (8).Moving the body rhythmically in a pattern of steps (5).An artwork created by applying colour to a surface (8).The sense of self and belonging to a particular group (8)....

BTGHS Section 2: CH 4-7 Vocab 2024-04-30

15 Items: covered in tarloyal, reliableabout to happenextremely unpleasantrepetition and routinefemale spirit who criesunpleasantly cold or wetpale orange tropical fruitlose or lack vitality, weakof a distant foreign countryspun thread used for knittingleave, unable to move through lack of winddistance of a place north or south of equator...

PID 2023-01-31

47 Items: shayjulylifetaxespresscolonyvotingspeechstatesnationunitedanarchylibertycabinetfederalarticlesjudicialdictatormonarchycolumbuspropertyfranklinsenatorscitizensreligionassemblybeararmspetitionamendmentexecutivesovereignjeffersonwashingtontabularasademoncracyrevolutionkinggeorgedeclarationlegislativeindependencebillofrightsconstitutionstateofnature...

Child Welfare Information Gateway 2024-03-19

45 Items: kindatachattoolsyouthcourtsequitystatestraumatribeslibraryneglectparentswebsiteadoptionoutreachresearchbelongingdiversityinclusionknowledgewellbeingworkforcecaregiversengagementevaluationfostercarepermanencypreventiontechnologycommunitiespartnershipchildwelfaremaltreatmentpublicationscollaborationgrandfamiliesmodernizationreunificationsubscriptions...

ADHD Review 2023-11-03

20 Items: ADHD is _________.Executive _________.Common result of ones ADHD.What does H stand for in ADHDMore common in girls with ADHD._____ is one common symptom of ADHD.Side effect of some ADHD medications.ADHD is not caused by _____ parenting.Some parents feel ______ by their child.Type of symptom that gets kids overlooked...

Emma Lantz 6th Grade 2024-05-16

15 Items: The hottest planet in spaceNo longer considered a planetClouds that are low in the skyClouds that are high in the skyClouds that are light and fluffyWhen a liquid turns into a solidA tidal wave that can flood a cityA natural disaster that spits out lavaWhen lava hits water it melts instantlyThe measure of reflectivity of a surface...

Vocab Word Search 2023-01-24

19 Items: scorecomplementedtaking care ofbringing forthhide somethingfading quicklypleasant feelingpart of the wholesudden revelationnot taking too muchhostile or unwelcomingshedding leaves anuallyavoid doing or go aroundhave legalized by a notarynot made through natural meansvoicing your opinion for changeshy due to lack of self-confidence...

Ethan's word search: Tuesday Term 3 Week 2 2023 2023-07-25

20 Items: achieving or having achieved success.essential, indispensable, or requisite:in accordance with fact or truth; truthfully:to keep apart or divide, as by an intervening barrier or space:by chance or mistake; in a way that is not planned or intended:(in the ancient Roman army) the commander of a century...

SIX THE MUSICAL 2023-03-15

17 Items: sixWAYPARRDOWNbradWIVESposadaOF STONEcatherinekatherineanneboleynOF HOLBEINjaneseymourannaofclevesLOSE UR HEADYOUR WANNA DODON'T NEED YOUR LOVE

Factors that Affect Motion 2024-05-13

15 Items: A p__________ is a place or location.A force that opposes motion is f_________.The force generated by a push is the t_______.An e_______ is what happens because of a cause.An object is in m________ when its position changes.The r____ of a particle is the speed of its movement.A point of view is also called a frame of r____________....

A- Word Search 2023-01-25

26 Items: Kinetic Engineer: A kinetic engineer is an engineer that emphasizes on heat and mass transfer and deals with the process of design.Utility Engineer: A utility engineer is a civil engineer who works for a utility company, such as a water, gas, or electric company....

The Final Tracklist 2024-07-12

16 Items: Harm506-aloneof meaddict!eclipsewith LaufeyOf The PartyComing Back!It Just Be Us?twothousandnineKids Are Not Finea Memory with AVONTHE CREDITS with Phoebe Bridgesor Die with davd and beabadoobeeHunter & The Ghosts of Murdered Snakes

What is a mineral? 2024-04-28

9 Items: A paste-like material made from minerals, used for coating walls and ceilings.makeup: The specific combination of elements and compounds that constitute a mineral.A powdery substance made from minerals, used in construction to bind materials together.A mineral used in ceramics, known for its distinct chemical composition and crystal structure....

Lily's Word Search 2022-11-28

10 Items: lowest part of a transverse wavehighest part of a transverse wavethe frequency is measured in thisthe measurement of maximum displacementthe distance from of one complete wave cyclemoves the medium parallel to the wave motionis the maximum displacement in a longitudinal wavearea of maximum displacement in a longitudinal wave...

Units 1.4 - 1.6 Knowledge Check 2023-12-27

12 Items: One learning style is ________________One learning style is ________________One learning style is ________________One type of visual arts is s___________One habit of mind is Thinking F________,One habit of mind is Finding H____________One visual arts strategy is no j___________One habit of mind is Striving for A_________...

AP United States History: Unit 5 2013-05-22

31 Items: GasAAACCCKKKNRANaziBombFDICJapanHitlerRussiaFrancoFacismGermanyNormandyNagasakiJingoismSinclairCommunismHiroshimaHolocaustRooseveltLusitaniaMussoliniDepressionFitzgeraldMuckrakersAppeasementProhibitionFundamentalismIrreconcilables

Chemistry 2023-12-09

42 Items: szaatomrayscchscloudanionbreakmarlasantadaltonmattertheoryprotontrendsradiuslaptopenergycationdisneythomsonneutronnucleusorbitalnuclearkohlwesnegativepositiveelectronflanaganaristotlechemistryparticlesplanetarymaterialsrutherforddemocritusshrodingervolleyballexperimentindivisibleplumpuddingindestructible

Safety and Sanitation 2023-01-23

22 Items: Maximum safe level in foodSpoilage due to breakdown of fats.Monoxide- Odorless highly poisonous gas.Prevention of illness through cleanliness.Immediate removal of a product from store shelves.Plug- Plug that has one blade wider than the otherBurn- Moisture loss caused by improper chilling out packaging...

Unit 4: Spelling Quiz 2 2022-12-01

30 Items: skillfulentirelysacred; set aparta book of synonymsboundless; limitlessone who writes psalmsa slothful, idle personto tear down or demolishlazy; indolent; sluggisha shortened form of a wordprotection and preservationmisrepresentation; falsenesslacking moisture; parched by heatan island; especially a small onehaving subtly penetrated or spread...

Wonders of the World 2023-04-20

27 Items: Famous tilted structure in Pisa, ItalyWorld-class art museum in Florence, ItalyStunning white marble mausoleum in Agra, IndiaRose-hued city carved into the cliffs of JordanMysterious stone statues found on Easter IslandGift from France standing tall in New York HarborAustralian landmark with distinctive sail-like design...

Mental Health Crossword 2024-02-21

15 Items: A cause of stress.Causes extreme mood swings.The act of harming ones self.Way to take a break from feelings.The act of causing ones own death.A feeling of fear, uneasiness, or dread.Expression or release of strong emotions.The reactions on what to do when stressed.Emotional, physiological, and social well-being....

Early Autumn Word Search 2023-01-19

20 Items: Mel's WifeFrightenedA detectiveAn investigatorPatty's HusbandOpposite of strongPatty is Mel's ___ready to give helpSpensers GirlfriendMel is Paul's fatherHaving no one presentSpensers favorite drinkA stupid foolish personThe son of Patty and Melnot having made a decision.raise one's shoulders slightlybeing certain of your abilities...

Drew Test 2023-06-20

50 Items: Deep sadness or griefReluctant or unwillingFeeling fear or scared.Not recognized or valuedState of calmness or peaceExtremely angry or enraged.Fortunate or having good luckExpressing curiosity or doubtEasily changeable or unstableFeeling of unity or closenessNot satisfied or accomplishedFeeling of alleviation or easeNervous, confused, or agitated....

geometry dash main levels 2024-04-07

22 Items: dashxstepjumpercyclesdry-outclubsteppolargeistdeadlockedfingerdashcant-let-goclutterfunktime-machineback-on-trackhexagon-forcestereo-madnesselectrodynamixbase-after-baseblast-processingtheory-of-everythingelectroman-adventuresgeometrical-dominatortheory-of-everything-2

Beneficial Genetic Mutations 2023-03-29

16 Items: Some frogs have developed ___ feet as a mutation for better swimmingA resistance to this type of disease by the sickle cell anemia mutationA resistance to this type of medicine helps bacteria survive and reproduceAn ability to find prey that evolved in bats because of a genetic mutation...

Summer of the Mariposas 2023-03-16

17 Items: Spanish for mermaidNarrator of the storySpanish for butterflyDelia and Velia are _____Youngest of the Garza sistersColor of the dead man's houseUS state where the Garzas live"Too much cream spoils the ____"Model of Papa's car the girls tookLast name of the author of the bookEnchanting hostess who served treatsLa Llarona's role in the Hero's Journey...

Winika's Challenging Word Search 2022-08-09

20 Items: not responsibleIt is like a canoea very small objectTo turn into a liquidstyle of the middle agesa naive act or statementfreedom from work or dutylong duration of own lifeyou can also control thiscomplicated plan or actionglowing impression of lightsomething that isn't necessarysomething enforced by the courtinclined to dispute an argument...

Word Search 2023-03-06

20 Items: Not a dogNot a catcolor of rosesspanish teacherColor and fruitWhere birds livecolor of patrickThe color of grassThe color of the sunWhere kids go to learnWhat you cut paper withAnimal born with a shellDevice we all use everydayBig cat king of the jungleAnother girl color not pinkdevice given to us by schoolBird with long legs that is pink...

Lord of the Flies 2023-09-27

20 Items: Wild, uncontrolled.Large sea snail shell.Older boys on the island.Boys tasked with hunting.Someone who saves others.Younger boys on the island.Person rejected by society.Place of shelter or safety.Brutal, uncivilized behavior.Group gathering for a purpose.The pig's head; symbol of evil.Dance Ritual dance by the boys.Advanced state of human society....

countries 2024-07-19

10 Items: The authority of a state to govern itself.The art and practice of conducting negotiations between nations.The official residence or offices of an ambassador in a foreign country.The status of belonging to a particular nation by origin, birth, or naturalization.The official line separating two countries, administrative divisions, or other areas....

Smell Word Search 2024-06-08

40 Items: spyfanwildlifthairsofasmellstinkslinkwringteachneedymushysteelfrogsbleedprintsmilefalseflingwritebecomesteadyremovechoosematterprettyhaircutqualifyimperilpuzzledtenuoussplendidspitefulintroducebefittinginsuranceadjustmentsuperficialadventurous

Libby & Nate 2024-07-25

30 Items: Grooms alma materCouples dog’s nameBride’s middle nameGroom's middle nameCouples favorite barMonth groom proposedHoneymoon destinationBride’s favorite foodBride’s favorite wineBride’s favorite hobbyBride's birthday monthDating app they met onGroom’s favorite hobbyBride's college mascotGroom’s favorite dessertGroom’s favorite bourbon...

4.5 Electricity and Magnetism 2023-08-25

12 Items: push awaypull towardends of the magnetan unbroken path for electronsany object that is able to attract ironmaterial that allows electricity to flow through ittype of electricity with continuous flow of electronsproduces electricity by using a coil of wire and a magnetmaterial that does not allow electricity to flow through it...

Cardiovascular Word Search 2024-07-09

10 Items: Blue skinenlarged heartFast heart rateBottom of the heartHigh blood pressureInflammation of the veinNarrowing of the arteriesMuscular tissue of the heartIncludes heart, blood vessels, and bloodProfessional that specializes in the heart

Republic Word Search 2023-02-28

17 Items: kingnoblespeasantsa popular votethe right to voteto the law or to rulesa political compromisea sudden overthrow of the governmentto formally give up control of a country or stateto incorporate into an existing political unit, such as a city or countryhe middle class, including merchants, industrialists, and professional people...

Waves Unit Vocabulary (RIS) 2024-03-14

22 Items: lowest part of a wavehighest part of a wavehow compressed or rarefiedrapid back and forth motionfrom one compression to the nextwave traveling parallel to the forcedisturbance causing medium to vibratewhat a mechanical wave travels throughfrom crest to crest or trough to troughthe distant parts of a longitudinal wave...

ww5 u10 2024-06-10

24 Items: to freea particular timeto set up or beginto be or act againstexcellent of its kinda very large number; manyto forbid by law or orderhappening once in a whilethe act of following aftera longing or strong desirethe state of being enslavedthe act or condition of being againsteasy to get; present and ready for usenot wanting to do something; unwilling...

Atmosphere to clouds 2024-01-30

16 Items: The movement of airThe type of cloud that rainsThe weather conditions right nowThe wind that is here in IndianaThe type of cloud that is ice crystalThe atmospheric layer where meteors burn upThe gas that makes up 78% of the atmosphereThe gas that makes up 21% of the atmosphereThe wind blowing east to west near the equator...

Wedding Word Search 2024-04-18

10 Items: Symbols of never ending lovePerson of the Bride's bridal partyThe annual celebration of marriagePerson of the Groom's wedding partyFlowers arranged for the Bride to holdPromises made between the Bride and GroomTraditional dessert of wedding receptionsVacation the married couple take post weddingThe celebration of love between the Bride and Groom...

Viking Word Search 2022-07-26

10 Items: The wielder of the magic sword Tyrfing was _____.Olga of Kiev is better known as St. Olga of _____ ______.Skadi is the daughter of the giant Thjazi who was killed by the god ____ of Asgard.Norse literature and _________, however, depicts a number of legendary women who do precisely that....

kennadees word search 2022-11-28

11 Items: motionmoves parallelnumber of wavesmax displacementsmax displacementslocations of max displacementlocations of max displacementwavelength measured in metersmeasurement of max displacementsdistance of one complete wave cyclemoves the perpendicular to the wave

BrazilShit 2023-12-21

12 Items: Name of CurrencyRanking in economyName of Largest Rainforestname of the country we're inLocation you're at right nowContinent of country we're inCapital of the country we're inThe Country's National LanguageLocation you were previously athow many timezones the country hasBrazil's Most famous soccer player...

Culture Word Search 2024-05-02

20 Items: The study of past events (7).A group of people living in the same area (9).Written works, such as novels, poems, and plays (9).A celebration or event, sometimes involving music (8).Moving the body rhythmically in a pattern of steps (5).An artwork created by applying colour to a surface (8).The sense of self and belonging to a particular group (8)....

Section 3 Unit 15 (46) Word Search 2 2024-02-16

30 Items: (η) the physics(η) the science(το) the cause, reasonto discover, uncover, invent(η) the chemistry (fig or lit)(η) the (genre) science fiction(η) the method, system, fashion(το) the sample, specimen, tokento research, investigate, search(η) the energy, action, potential(ο) the (male) astronaut, cosmonautanalog, proportional, proportionate...

Recovery 2022-10-15

12 Items: non-use of any addictive psychoactive substance.A dysfunctional state resulting from the use of psychoactive substances.A state in which an increased dosage of a psychoactive substance is needed to produce a desired effect.A process of withdrawing a person from a specific psychoactive substance in a safe and effective manner....

APES Unit 11 2024-04-30

12 Items: Bottom of the ocean97% of water is ________Factor in water availabilityUnevenly distributed human needCover 71% of the Earths surfaceNot enough light for photosynthesisTransport water over long distancesamount of water used for all purposes per personOpen water, contains phytoplankton to photosynthesize....

M3 Unit 1-3 vocabulary 2023-09-01

11 Items: the ovule becomes this partmany food chains linked togetherthe ovary of a flower becomes thismethod of identifying an unknown organismtype of process where humans control traitspollen moving from the anther to the stigmathe passing of features from parents to offspringtype of process where the environment controls traits...

Ultimate Minecraft Word Search 2024-05-10

14 Items: The One-Shot KingThe Blaze OverlordThe Fourth DimensionThe Face Of MinecraftThe Myth Of MinecraftThe Beast With No Eyes"We Need To Go Deeper"The Magic Of Minecraft"Ice Bucket Challenge"24 More Diamonds To Go"With Our Powers Combined"The Most POPULAR Java ServerThe Creator Of PossibilitiesAwkward Potion + Blaze Powder

Adjectives 2022-11-08

15 Items: happy and cheerful.evil or morally wrong.(of a person) feeling cold.unable to understand; perplexed.in a vulnerable position or situation.(of an object) easily broken or damaged.lasting or existing forever; without end.capable of or tending towards murder; murderous.(of a person) unfriendly and unwelcoming towards people....

U.S. History Word Search 2024-04-25

15 Items: December 7th 1941Your 2nd Amendment RightFirst African American PresidentMusic genre made during the 1920's1st Medal of Honor winner during WWIKilled in Dallas on November, 22nd 1963Creator of The Smartphone and founder of AppleProgram made under FDR during the Great DepressionCivil Rights group that will use force if necessary...

AP Seminar Vocab 2022-09-03

58 Items: choicesevidencereferencebe examinedendeavor/work— A condition or exceptionand/or explain relationshipsA possible future effect or resultInvolving two or more areas of knowledge— The act of solving a problem or disputeImportant problem for debate or discussionA belief regarded as true and often unstated— A point of view conveyed through an argument...

Independent Living Vocabulary 2024-01-26

15 Items: The longest side of a triangle.The amount of a home that an owner actually owns.The vertical distance between two points on a graph.The horizontal distance between two points on a graph.In a proportion, a/b=c/d , the terms b and c are the meansIn a proportion, a/b=c/d , the terms a and d are the extremes....

Eliyanahs Word search 2024-05-15

15 Items: makes atpMakes lipids and detoxifiesSecond leave of organizationHighest level of organizationLowest leavel of organizationThird leavel of organizationfourth leavel of organizationholds and protects the cells DNAMake proteins using instructions written on RNATransports substances to where they need to go in the cell...

Look Ben, I made a wordsearch 2023-11-25

12 Items: my fluffy miraclefavourite positionsong with the wrong tonea favourite drink of oursother word for fine Chinasomething that you can't doclosest thing I have to a kinkone of your many personalitiesthe type of influence you bringthe 4 legged beast at Petersfieldur favourite character in lord of the rings...

Vocabulary - Chapter 7 2023-03-13

21 Items: revokeTo make known.The act of choosing; choice.Formal evidence of ownership.The right of ownership to goods.A guarantee of quality imposed by law.Exercising the most influence or control.The responsibility for loss or damage to goods.Conforming to one principle, standard, or rule; consistent....

The Tabernacle 2024-01-19

8 Items: The manna was put in itIt is the colour of royaltyThis colour reminds us of heavenThe altar of burnt offerings is a symbol of thisThe altar of burnt offerings was overlaid with itWashing in it is a symbol of baptism and repentanceThere was only one just like how Jesus is the only wayThey are on top of the ark of the covenant (have wings)

Bay Model 2024-07-06

11 Items: A problem solverThe creation of new ideasA mixture of salt and fresh waterThe proper use of natures resourcesThe protection of nature from damageThe system of rivers, lakes, and baysThe ocean that the SF bay drains intoThe body of water where rivers meet the seaThe wetlands where rivers flow into the bayAnimals or plants that came from another area...

US States and Capitals V 2019-04-06

15 Items: OhioSalemAlbanyOregonSantaFeNewYorkRaleighBismarckColombusNewMexicoOaklahomaNorthDakotaPennsylvaniaNorthCarolinaOaklahomaCity

Provider Referral Word Search 2024-03-28

30 Items: 2. __________3. ______________4. ____________ of times referred.2. Language other than ___________California state animal is a ______.2. (orthodontist, endodontist, etc.)3. ______________ for a given provider3. Unusual or exceptional ____________.The member is referred to this team for ________.These needs include things such as: 1._____________...

US States and Capitals I 2019-04-06

15 Items: AlaskaJuneauDenverAlabamaArizonaPhoenixArkansasColoradoHartfordDelawareMontgomeryLittleRockCaliforniaSacramentoConnecticut

US States and Capitals III 2019-04-06

15 Items: MaineKansasTopekaBostonAugustaLansingKentuckyMarylandMichiganFrankfortLouisianaAnnapolisMinnesotaBatonRougeMassachusetts

US States and Capitals IV 2019-04-06

15 Items: HelenaNevadaJacksonMontanaLincolnConcordTrentonMissouriNebraskaSaintPaulNewJerseyCarsonCityMississippiNewHampshireJeffersonCity

US States and Capitals VI 2019-04-06

15 Items: UtahTexasPierreAustinVermontColumbiaTennesseeNashvilleHarrisburgProvidenceMontpelierRhodeIslandSouthDakotaSaltLakeCitySouthCarolina

Child Welfare Information Gateway 2024-03-19

48 Items: kindatapivottoolsyouthaspirecourtsequitystatestraumatribesexpertslibraryneglectparentswebsiteadoptionlivechatoutreachresearchbelongingdiversityinclusionknowledgewellbeingworkforcecaregiversengagementevaluationfostercarepermanencypreventiontechnologycommunitiespartnershipchildwelfaremaltreatmentpublicationscollaborationgrandfamiliesmodernization...

Important historical events 2023-11-24

10 Items: guy-fawkesmagna-cartablack-deathrenaissanceworld-war-iishakespeare-bornindustrializationbattle-of-hastingsbattle-of-waterloomedical-revolution

Accord Word Search 2023-12-16

10 Items: grow vigorouslyconcurrence of opinioncapable of being believedfeelings of excessive prideput down, place, or press the footcontinuing forever or indefinitelythe rational and systematic study of religionan analytic or interpretive literary compositionan estimate of ability to fulfill financial commitments...

Cardiovascular system review 2023-05-11

19 Items: largest arterythe hearts pacemakerBottom corner of the heartcarry blood toward the heartcarry blood away from the hearttake oxygen poor blood to the lungsPressure when ventricles are relaxedreceiving chambers with thicker wallsreturn oxygen rich blood to the heartSeparates the two atria longitudinallylonger heart sound caused by closing of AV Valve...

Chapter 15 - Key Terms 2023-11-01

10 Items: Mucous membranes of the eyes.A process of cleansing to remove undesirable debris.Complete destruction of organisms after they leave the body.The complete destruction of organisms before they enter the body.Date after which a product is no longer effective and should not be used....

Third Word Search 2022-11-28

36 Items: believable; reliablea story that is not true or is made uprepetition of initial consonant soundsa story written to be performed by actorsa word that imitates the sound it representsthe writer's position on an issue or problema story containing unreal, imaginary featuresthe primary position taken by a writer or speaker...