states of matter Word Searches

Bethlehem's Significance 2023-10-18

21 Items: innholylandstarjudeaHerodfieldcensuslineageWisemenmessiahJourneyof Davidbiblicalof Breadnativityof JosephEphrathahbirthplacepropheciespilgrimage

Southeast states 2023-02-09

8 Items: georgiafloridaalabamaarkansastennesseemississippisouthcarolinanorthcarolina

CHONDRICHTHEYES 2025-04-14

26 Items: shark.fields.sharks.mother.mother's body.changes in water pressure.The family of rays, also known as eagle rays.The tail fin of a shark or ray, used for propulsion.The family of carpet sharks, including the wobbegongs.A compound found in the liver of sharks, used for buoyancy.The superorder of cartilaginous fish that includes all sharks....

ICP Vocab 4 2025-02-26

16 Items: The ability to cause changeenergy, Energy due to motionIs force applied through a distanceThe rate at which energy is convertedThe ratio of output work to input workadvantage, The ratio of output force to input forceIs anything around which you can imagine a boundarypotential energy, Energy that is due to chemical bonds...

Periodic Trends 2024-12-09

16 Items: The most electronegative of - Cu, Au, AgThe largest atomic radius out of - Cu, Au, AgThe largest atomic radius out of - P, N, B, HThe smallest atomic radius out of - K, Fr, H, LiThe largest atomic radius out of - Cr, Ca, K, TiThe smallest atomic radius out of - Sc, Mn, Zn, FeThe largest electronegativity out of - C, Fe, Fr, Ga...

Jesus Word Search 2024-12-30

15 Items: LordRockJesusChristSaviorMessiahEmmanuelRedeemerThe WordTrue VineSon of GodLamb of GodGood ShepherdBread of LifePrince of Peace

Countries in the World Cup 2022 2022-11-14

29 Items: RicairanqatarspainwalesghanaKoreaStatescanadaArabiamexicopolandbrazilserbiafranceecuadorenglandbelgiummoroccocroatiadenmarktunisiauruguaycameroonportugalargentinaaustralianetherlandsswitzerland

Reformation Word Search 2023-11-29

20 Items: VdietVIIIsectsTudorLutherCalvingenevaghettoCranmerof Trentof Avilatheocracyelizabethcanonizedof Loyolaindulgencewittenbergcompromisepredestination

Circuits 2025-04-24

18 Items: ChargeCapacitanceWhat AWG stands forElectrical potentialCurrent, flow of chargeaccumulation of electronsThe ability to store energy________ in combined circuitsHigher strand count means they are more___'s law is current = voltage / resistanceThe most conductive material but has a high pricea circuit board that is used to make temporary circuits...

M4 Vocabulary review 2024-09-02

15 Items: the energy of motionthe ability to do worktype of reaction A+B= ABtype of reaction AB= A+Btype of reaction AB+C= AC+Btype of reaction AB+CD= AC+BDmoves from areas of high to lowtype of energy stored in an objectreaction or process that takes in heatreaction or process that releases heatsubstances made from a chemical reaction...

cold war 2016-01-30

33 Items: warcoldmoneytrainplanechinaunionTrumanberlinFranceKoreanOttawaatomicunitedstatessovietairliftGermanyVietnamsoliderRussianmarshallEuropeandoctrineautobahnmilitaryattackinginterveneuniformedcommunistsuperpowertechnicallyeconomically

SLAVERY 2018-10-19

35 Items: WarrunBoxawayfreeStarCivilNorthSouthNorthslavesugarcropshouseslavemasterstatesTubmanescaperewardbarrelcottonslaveryLincolnHarrietfreedomrailroadpunishedcatchersPresidentplantationconductorsBloodhoundundergroundabolitionist

The Civil War 2025-05-15

34 Items: warfireFortSouthNorthUnionSumterstatesbattleRobertsecedeShermanAtlantafederalfreedomGeneralAbrahamLincolnslaveryCampaignBlockaderesourcesdestroyedSurrenderpresidentAppomattoxGettysburgPlantationConfederacyEmancipationEmancipationProclamationabolitionistReconstruction

Units 3-4 Vocab 2024-09-24

29 Items: IonAtomMassheatShellChargeEnergyMatterProtonVolumefusionphotonNeutronNucleusOrbitalfissionElectronwavelengthIntelligencekineticenergythermalenergynuclearenergypotentialenergyvisiblespectrumphotovoltaiccellSubatomicparticlehydroelectricpowerelectromagneticspectrumelectromagneticradiation

Challenge 4 Words 2025-01-27

29 Items: readwithtribetheirwritescrewnativegeniusmattervolumedifferreallyheroeswishesapplaudscarvesinstallcultureminoritylanguageholidaysincreasecontinueresearchbiographyhandcraftcountriestemperatureorganization

Current Events 4-3-25 2025-04-03

34 Items: warallNATOGazatolltradeheavyRubiodeathrisesUnitedStatesstockstumbledamageIsraelgroundviolenttornadoforeigntariffsimportstradingMyanmarArkansasBrusselspartnersresponseSecretaryministersexpandingoperationearthquakenortheastern

Baron Alexander von Humboldt 2023-10-24

20 Items: ofvontheageship17691859¨of¨baronlarrysouthamericaexplorerhumboldtspyglass"father¨¨modern¨alexanderdiscovery¨geography."

Atomic Structure & Periodic Properties 2024-11-25

20 Items: The energy required to remove an electron from an atom.The distribution of electrons among the orbitals of an atom.The energy change that occurs when an atom gains an electron.The outermost electrons of an atom, involved in chemical bonding.Energy levels surrounding the nucleus where electrons are located....

Attic Word Search 2023-02-24

25 Items: the surface of a room that you walk onthe surface of a room that you walk ona window built into a roof to allow light inthe structure that covers or forms the top of a buildingthe part of a roof where the sloping sides join at the topbaked clay used for building walls, houses and other buildings...

Chapter 11 Word Search 2024-05-02

37 Items: water in the form of a gasthe distance above sea levelthe most outer layer with no endThe third layer of the atmospherea device that measures temperaturewhat wind speed can be measured withwinds that blow over short distancesthe way Earth's rotation makes winds curvethe amount of mass in a given volume of air...

Understanding the Atom 2019-09-05

29 Items: ionionatomatomaprotonmatternucleusneutronisotopeelementelectroncompoundjjthomsonnielsbohrproportionjohndaltonmassnumbercathoderaysradioactiveenergylevelsspectrallineatomicnumberelectroncloudjameschadwickfootballstadiumernestrutherfordaverageatomicmassgoldfoilexperimentatomicforcemicroscope

H2O CYCLE 2021-01-12

31 Items: BECGASRUNOFFMASSDEEPCYCLESTATESOLIDOCEANWATERCYCLEMATTERSYSTEMLIQUIDPLASMARECYCLECURRENTSURFACECURRENTSCURRENTSCURRENTSPOROSITYWATERSHEDPERMEABLEPOLLUTIONEVAPORATIONCONDENSATIONACCUMULATIONTRANSPIRATIONPRECIPITATION

What is Weather? 2025-02-07

28 Items: gasairmasswindstateexpandmattersevereweightweatherpressurecompressforecasthumidityparticlevariablepermanentexosphereatmospheremesospherepredictionmeteorologytemperaturetropospherestratospherethermospheremeteorologistprecipitation

Emily's Birthday Word Search 2025-05-27

25 Items: sunteagameemilypartyall y'allcroissantbirthstonehair colormini colorzodiac signplace of birthwhat today is!!!____, emily ____animal i despiseupcoming vacation#1 lady of my lifefavorite breed of dog32 of these on a cakethe month of my birthfavorite kind of cakeband seen the most timescountry visited the most#1 fella of my life (RIP)...

Terraria Bosses 2024-09-02

17 Items: BeeLordGolemSlimeSlimePrimeTwinsFishronCultistof LightPlanteraof FleshDeerclopsof WorldsDestroyerof Cthulhuof Cthulhu

greek gods 2024-02-02

10 Items: messengergod of wargod of firegod of the seagoddess of lovegoddess of huntthe king of godsgod of underworldthe god of archerygoddess of harvest

chemistry 2 2019-03-18

29 Items: phmattersolutephscaleprotonssolventmisciblemoleculeneutronssolutionlogarithmoxidationsiliconessurfactantssuspensionspuresubstancereducingagentoxidizingagentphysicalchangestatesofmatterphysicalmixtureorganicchemistrythioglycolicacidvolatilealcoholsoxidationreductionphysicalpropertieswaterinoilemulsionoilinwateremulisionvolatileorganiccompounds

Business Words 1 2024-04-03

29 Items: taskbringbranddelayadjustwrapupmatterremarksrevenueperhapsconfirmofftrackworkflowgoodtogoearningsdeadlineshipmentexpensesschedulefollowupestimatepurchaseelaboratetouchbasedisregardmakesensecirclebacktrainofthoughtgetbackontrack

Southeast Region States 2024-11-04

12 Items: GeorgiaFloridaAlabamaVirginiaKentuckyArkansasTennesseeLouisianaMississippiWestvirginiaNorthCarolinaSouthCarolina

The Deluge Wordsearch 2025-03-25

20 Items: GOD"Man of the soil"Made of gopherwoodThe cause of the floodNoah's age when he diesAbundant on the big boatThe symbol of the promiseThe stop to Noah's big boatLasted 40 days and 40 nights2 pairs of this on the big boat7 pairs of this on the big boatAn agreement between God and NoahThe young one whom Noah had cursedThe years of Noah after the Flood....

Lyric genre 2024-11-05

20 Items: stanza with six linespoem with nineteen linesname of a ten syllable line poemit compares by saying one thing is anotherpeople who created lyric poetry in medieval agenumber of verses in the poem Now close the Windowsnumber of stanzas in the poem The House on the HillA figure of speech composed of a striking exaggeration...

BASIC TERMINOLOGY USED IN ATHLETIC TRAINING 2022-08-25

35 Items: broken bonelying face uplying face downblood in a jointpooling of bloodabove or head endcause of an injurytoward the mid-lineswelling with a jointback it sorsal aspectconnect muscle to bonefront or ventral aspectstretch or tear of ligmentbelow or away from head enddecrease in size of body partbruising or crushing of tissue...

Evolution Word Search 2024-11-14

20 Items: LyellAnningLamarckFossilRecordSexualSelectionHomologousStructure"Survival of the fittest"type of bird Darwin studiedchange is a species over timea change in the sequence of DNApreserved remains of an organismselective breeding done by humansdifferences in traits of a speciesmost broad classification of organism...

Math Vocab 2023-10-05

24 Items: basetermsfactorsvariableexponentdiscretemonomialbinomialpropertyequationtrinomialrewritingexpressionsubstitutecontinuouspolynomialtrichotomyexpressionscoefficientcoefficientof equalityof a monomialof operationsof a polynomial

Unit 5 Vocabulary 2024-12-10

28 Items: TERMIMAGESLOPEANGLEANGLESSIMILARVARIABLEDILATIONFUNCTIONVARIABLEROTATIONCLOCKWISECONGRUENTOF CHANGEINTERCEPTREFLECTIONTRANSLATIONTRANSVERSALRELATIONSHIPOF EQUATIONSOF A DILATIONCORRESPONDINGTRANSFORMATIONTO AN EQUATIONTRANSFORMATIONINTERIOR ANGLESCOUNTERCLOCKWISEOF TRANSFORMATION

Respiratory System 2024-10-18

24 Items: The total volume of air moved into and out of the lungs per minute.Hemoglobin bound to oxygen the primary form of oxygen transport in the blood.The movement of chloride ions into red blood cells as bicarbonate ions move out.The additional volume of air that can be forcefully exhaled after a normal exhalation....

Westward Expansion and Mexican-American War 2025-03-18

20 Items: people that investigate unknown regionsthe northwest section of modern day United Statesa system of mail-carriers that traveled west on horsebacka 2,000 mile trail leading to the west toward Oregon Countryan agreement in which Texas declared Independence from Mexicoa later name for the Church of Jesus Christ of Later-day Saints...

Dani & Jake 2025-05-25

30 Items: Bride's SiblingBest Man's NameGroom's SibilingCouple Coaches AtGroom's Birth MonthBride's Birth MonthPlace of EngagementMonth Groom ProposedMaid of Honor's NameHoneymoon DestinationTown Groom Grew Up InBreed of Couple's CatsCouple's 1st Cat's NameCouple's 2nd Cat's NameName of Bride's CollegeCouple's Favorite SportDating App Couple Met On...

Force and Motion 2025-05-22

13 Items: A push or a pullSpeeding up or slowing downSpeed in a certain directionThe time it takes for motion to happenA force that resists an object's motionThe scientist who created laws of motionThe law of Newton's that is about inertiaThe change in an object's position over timeThe energy something has based on its height...

2nd Quarter Literature 2022-11-25

28 Items: The main character of a story _____________A type or category of literature _____________Prose that tells of real people and events _____________A literary tool to make the audience laugh _____________An expression of one thing in terms of another _____________The major turning point for the main character _____________...

Bethlehem's Significance 2023-10-18

21 Items: innholylandstarjudeaHerodfieldcensuslineageWisemenmessiahJourneyof Davidbiblicalof Breadnativityof JosephEphrathahbirthplacepropheciespilgrimage

The United States: A Nation of Immigrants 2014-01-14

12 Items: censustreatyreformattitudeCatholicgovernmentProtestantreservationimmigrationBeringStraitLatinAmericadiscrimination

Science Vocab 2025-03-03

12 Items: to sendto take into give offa substance that takes up spaceto be sent back off of a surfaceany object that lets off visible wavesthe ability to make things move or changethe maximum distance moved by a vibrating wavetransferring energy from one place to the nextdistance between one peak of a wave to the next...

Saffron and Ashley OO 2024-09-17

25 Items: Groom hobbyMonth we metGroom hometownGroom Star SignBride star signBride eye colourFlower girl nameBride birth monthWhere did we meetGroom Middle nameBride middle nameGrooms high schoolNumber of best menMonth of engagementPlace of engagementMost recent concertMother of Bride nameMother of groom nameGrooms favourite carCouples first holiday...

Ash & Bhav 2025-04-25

24 Items: Their surnameMonth they metFirst movie dateBhavik's dream carBride's middle nameCity where they metAashini's dogs nameMaid of honor's nameMonth Bhavik proposedBride's brothers nameHoneymoon destinationBhavik's brothers nameBhavik's football teamBhavik's birthday monthColour of bride's dressAashini's birthday monthDream holiday destination...

Lesson 4: Reformation and Reaction Word Search Puzzle 2023-03-21

45 Items: sectromejewsbiblejesusspainparisfaithghettoLutherchurchThesesCalvinof GodjesuitsaintsXaviergermanypriestsconventmuslimscatholicof Wormsreformerof AvilaPaul IIIof Trentreligionsacramenttheocracyisolationchristiancalvinismof LoyolacarmeliteindulgencecorruptionprotestantgovernmentreformationtemperamentlutheranismcatholicismInquisitionpredestination

christmas history 2022-12-03

15 Items: A Roman feast celebrating children.In the early years of Christianity, ______ was the main holiday.Christmas wasn’t declared a _______ holiday until June 26, 1870.For some Romans, this god's birthday was the most celebrated day of the year.This reindeer was created to advertise for the Montgomery Ward stores in 1939....

8th grade Jillian Griffith 2024-05-15

15 Items: temperature at which a solid meltsCharging an object without touchingtemperature at which liquid freezestype of Matter with fixed compositioncannot be separated by physical meanschange from a liquid to a gaseous statepoint temperature at which gas condenseschange from a solid state to a liquid statechange from a liquid state to a solid state...

Fantastic Fiction 2025-03-06

20 Items: This title character travels to the islands of Laputa & LilliputPeter Beagle wrote of 'The Last ___' who lived alone "in a lilac wood"Home of House Tyrell, Highgarden is a fertile wine-growing region on this continentThis sword-wielding barbarian from ancient Cimmeria was created by Robert E. Howard...

Nasso 5.0 2025-06-02

25 Items: “Kohen”“Asah” Englishson of Shedeur“Nasso” English“Shema” English“Shamar” EnglishThe prince of the tribe of Gad.This clan of Levi totaled 3,200.The prince of the tribe of Judah.resentment against another person.This vow separates you for Adonai.This gift can never be taken away.The Hebrew “Gershon” means _______.The prince of the tribe of Zebulun....

Coloum 2022-09-15

25 Items: A rounded roofThe pillar of a buildingA person who designs buildingsHorizontal member of step (stair)Vertical member of a step (stair)A structure that has a roof and wallsA design plan or other technical drawingA fence or balustrade made of rails and postsThe lower surface of a room that people walk on...

Rojo Word Search 2023-03-07

20 Items: color of grasscolor of the sunMan's best friendcolor of the oceanking of the junglefruits grown on vinestom from tom and jerrySpongeBob lives in onejerry from tom and jerrymonkeys ¨favorite¨ fruithad a color named after itthe color of cirrus cloudsbiggest animal in the worldthe color of stratus cloudsfruit that rhymes with tango...

Chapter 3 Vocabulary 2023-10-19

41 Items: Earth's outer layer _____________Earth's thinnest layer______________Earth's innermost layer______________layer beneath the crust __________________when magma reaches the surface _____________layer above the troposphere _____________________water vapor forms water droplets on dust particlesLayer beneath the lithosphere ____________________...

Cleaning/ Word Search 2022-11-01

20 Items: dispose of an itemhow well a product worksan item that cannot be reusedpotent disinfectant chemicalsa chemical used to whiten or sterilizethe process of removing dirt and debristhe process of killing all bacteria and microbesthe process that kills most bacteria and microbesan item that is able to be disinfected and reused...

Roof Word Search 2023-02-24

26 Items: highest limitdivide into parts.Top of the buildingheavy base supportingsupport building structurecontact two vertical levelsextend from side to side ofthe entrance to a building, roomplace giving temporary protectionvertical brick or stone structurebuilding materials used ascoatingsthe top surface of a step or stair....

Holocaust 2023-03-23

20 Items: Hitler's ideal raceintolerance of others' beliefsa person present but not involvedlawfully removing a group of peoplean act of extreme cruelty and wickednesslacking humanity, pity, kindness, compassionsecret state of police of Nazi occupied Europethe act of getting rid of, especially by killingthe opposition to and discrimination against Jews...

AI and AML 2024-10-09

7 Items: ActStatesQualitySubjectiveCloud-basedMorgan Chasepublic-private

United Word Search 2023-12-10

30 Items: peruiranjapanegyptindiaitalychinaKoreakenyaStatescanadabrazilrussiaAfricamexicofranceturkeyArabiaswedengreecepolandgermanynigeriavietnamZealandthailandcolombiaaustraliaargentinaindonesia

A Matter of Trust voc. 1-5 2023-10-18

10 Items: glaredcorpserippledfitfullyconcededpersistedcondimentsobservatoryhumiliationsophisticated

Density and Matter (Try to define all the words) 2017-03-09

30 Items: gassinksizemasswaterfloatsolidcolorshapematterliquidvolumedensitymeltingboilingtexturemixturefreezingpropertydissolvesolutionchemicalphysicalparticlemoleculesevaporatemagnetismcondensatesolubilitycharacteristic

Biology Word Search 2024-02-29

30 Items: cellatomforcetheoryenergymatterbiologyphysicselementorganicecologyspeciesnaturalgeneticsmoleculecompoundreactionresearchanalysischemistryevolutioninorganicecosystemexperimenthypothesismicroscopeartificiallaboratoryconclusionbiodiversity

Chemical Processes & Thermal Energy WORD SEARCH 2024-11-12

30 Items: heatflowmuirmodelinputarrowenergysystemoutputmatterokeefechangeabsorbthermalprocessreleasesciencetransferproductsequationreactionradiationparticlesreactantscomponentsconductionconvectionexothermictemperatureendothermic

Week 10 Spelling 2024-11-14

30 Items: actorhumorangermajormayorpolarlunarenterhonormirrorpowderbannerpillarflavorfingerclovermatteranswercollardoctorclamortremortheaterburglartractorquarterscholarchamperthuundercharacter

Photosynthesis 2025-01-07

30 Items: leafgreensugarwaterenergymatteroxygenplantsgrowthglucoseproductconvertstorageradiantreactionreactantsunlightcytoplasmabsorptionchloroplastcalvincyclechlorophyllchloroplastrespirationmitochondriareproductionmicroorganismphytoplanktoncarbondioxidephotosynthesis

Rocks Word Search - Bonus 2025-02-06

30 Items: rocklavaheatmeltcoolcyclemagmamatterenergybasaltcementlayersOKeefemineralcrystaligneousgranitecompacterosionScienceobsidianpressureconserveintrusiveextrusiveweatheringdepositionsedimentarymetamorphicunderground

Cycle 1 S2 Week 12 2025-05-01

13 Items: the loan on a homea strict adherence to core principlesthe quantity of matter within a given objectthe equation of a straight line in y=mx+b formHaving more than one possible meaning; unclearto express a math expression into its lowest termsa character who recounts the events of a literary work...

ENVIR 302 Final Project - Technology and its Environmental Impacts 2022-12-08

23 Items: The use of resources.The creation of gases or radiation.The act of getting rid of something.The amount of energy used per unit time.Using less energy to perform the same task.A form of energy resource like coal, oil, and natural gas.An energy resource that is not able to grow again or be made again....

Outer Space Objects 2024-03-20

20 Items: cometmeteornebulagalaxyquasarasteroidwormholesatellitesupernovaplanetoidred-giantblack-holesolar-flaredark-matterwhite-dwarfstar-clusterdwarf-planetconstellationcelestial-sphereinterstellar-dust

Boyd/Magnus Science Buddies 2024-11-18

29 Items: BOYDPULLPUSHMASSCROCSGASESENERGYFORCESMAGNUSMOTIONWHALESNEWTONMATTERSTATICSOLIDSBUDDIESGRAVITYPICKLESSCIENCELIQUIDSBALANCEDFRICTIONMIXTURESMAGNETISMHYPOTHESISUNBALANCEDPROPERTIESSUBSTANCESEXPERIMENTS

Voters and Voter Behavior 2022-10-04

25 Items: having an influence on politicsa person with no party affiliationillegal voting or tampering in an electiona person who has been convicted of a serious crimethe practice of voting for candidates from only one partythe practice of voting for candidates of more than one partya set of basic beliefs about life, culture, government, and society....

Discover Italy 2024-09-03

21 Items: Capital of ItalyItaly's currencyMeans "Cathedral"Italian famous cheeseItaly's national sportSea to the east of ItalySea to the south of ItalyLives in the Vatican CityCity famous for its fashionVolcano that destroyed PompeiTasty meal originated in Naples95% of Italians are this religionA country that borders with Italy...

Estates Word Search 2023-11-24

18 Items: 1793, January 21: Execution of _____.1793, October 16: Execution of Marie _____.1789, August 4: _____ abolished in France.1789, May 5: _____-General convened in Versailles.1795: Establishment of the _____, a five-member committee.1799-1804: The Consulate period, with _____ as First Consul....

Months of the Year 2022-10-16

12 Items: Fill in the blank: April, May, June, ________, AugustWrite the name of the last month of the year. __________Write the name of the third month of the year. __________Write the name of the sixth month of the year. __________Write the name of the first month of the year. ___________Write the name of the second month of the year. __________...

Waves and Their Behaviors 2023-10-09

11 Items: A form of radiation wave that travels though the universe.To cause (light, heat, sound, etc.) to pass through a medium.The number of waves that pass a fixed point in unit time (Hertz).A point on a wave where the displacement of the medium is at a maximum.The distance between identical points in the adjacent cycles of a waveform....

Classify Matter 8.P.1.1 2023-09-13

20 Items: atomsprotonneutronnucleuselementsmixturessolutionelectroncompoundssubscriptmoleculesatomicmasscoefficienthomogeneousenergylevelatomicnumberheterogeneouselectroncloudchemicalformulavalanceelectron

Unit 6 Matter Vocab & VMO 2025-01-22

32 Items: GasIongasmassrulemetalAnionModelGroupMetaltableSolidmetalnumberCationIstopeLiquidperiodProtonIsotopeHalogenNeutronNucleusElectronNonmetalParticleElectronConductorMetalloidReactivityearth Metaldot diagram

Unit 4: Spelling Quiz 1 2022-11-29

30 Items: comicaltruthfulnessshowing mercymarking a distinctiona physical disabilitydefiance of authoritythe operation of aircraftto set or keep apart; dividenasty or disgusting in naturean overseer or head of a groupto grasp suddenly and forciblyof a particular person; privatethe pouch which encases a letterthe biological science of animals...

Jake and Bailey OO 2024-07-10

27 Items: Bailey’s talentName of the bandMother of the brideMother of the groomFather of the brideFather of the groomCouple’s street nameBailey’s maiden nameCity Bailey was bornMonth the couple metLocation of proposalNumber of bridesmaidsHoneymoon destinationJake’s birthday monthNumber of venues touredBailey’s birthday monthJake’s favorite wrestler...

World War 1 Aftermath 2025-01-30

20 Items: founder of fascismeconomy slows downbook Adolf Hitler wroteGermany, Italy, and Japanleader of German Nazi partyfather of modern physiologyJapan longest serving monarchknown for Theory of Relativitystrong leader has full controlfounder of modern macroeconomicsmajor influence of existentalistspresident during Great Depression...

Odin Word Search 2023-06-21

34 Items: EyeGodGododinthorgeriyuleHuntymirwodanbaldrfrekimimirof Warfenrirwolvesravenswisdomhuginnmuninnasgardmidgardsleipnirmagicianof poetswandererwednesdayand Emblayggdrasilberserkerallfatherof Wisdomof Vili & Veof Bestla & Borr

Main Sciences Word Search 2024-12-14

3 Items: The study of matter (9 letters)The study of living organisms (7 letters)The study of the natural world (7 letters)

Balak 2024-07-13

18 Items: Son of Beor.Balak’s fatherThe Prophet of the HaftarahThe last station of the ExodusHe was once a priest of MidianA son of Abraham’s wife Keturahthe art of black magic; witcheryThese were the descendants of LotHis name means “Devastator” or “Waster”Balaam was a role model for spiritual _____.commonly used to describe the trumpet blast....

Nominating Word Search 2025-02-16

23 Items: HawkPartyPartySystemCrisisCabinetWebsterof 1837SequoyaOsceolaDoctrineof TearsDemocracyVan BurenTerritoryC. Calhounv. GeorgiaConventionsv. MarylandRemoval ActHenry Harrisonof Abominationsof Indian Affairs

Year 7 Science 2022 2022-12-07

18 Items: Not depleted when used.An animal lacking a backbone.An organism that makes it own food.An imaginary line about which a body rotates.Any substance that has mass and takes up space.The process of turning from liquid into vapour.A substance made by mixing other substances together.A system of interlocking and interdependent food chains....

Chapter 13 Matter 2014-11-20

9 Items: massvolumeweightdensitycondensationphysicalchangechemicalchangephysicalpropertychemicalproperty

Aerial Word Search 2025-03-27

15 Items: Related to the air; often used to describe military operations conducted by aircraft.A type of military aircraft designed primarily for air-to-air combat against other aircraft.The quality of being open to attack or harm, often used in the context of military defenses....

Term 1 RE 2024-03-26

16 Items: Ordersspiritbaptismof workcatholicreligionpresenceeucharistmatrimonyimmersionsacramentssimplicityof the Sickconfirmationreconciliationthe way of Mary

Fourth Grade Rules 2024-06-05

5 Items: mathbandrecessscienceand capitals

the great depression 2024-10-08

14 Items: when you do not have a jobgetting a loan from your brokeragethere it a not much water and no rainthe United States stock market crashedwas a bad drought during the depressioncorps conserve the country's natural resourceschanges were made to make the U.S. banking systemone of the worst natural disasters in American history...

schwa sound /er/spelling list 2013-05-27

30 Items: actorhumorangermajormayorpolarlunarenterhonormirrorpowderbannerpillarflavorfingerclovermatteroysterclamortremoranswercollardoctortheaterthunderburglartractorquarterscholarchamber

Science Word Search 2023-06-02

30 Items: sungasbiomheatsolidearthatomsforceliquidmatterphasesvolumeenergyscienceprotonsdensitysolutionneutronsevidencedissolveconsumergeosphereecosystemmoleculesparticleselectronsatmospheredecomposerhydrospherecondensation

Science Practices & Crosscutting Concepts 2023-08-31

30 Items: dataplanmodelcausescaleeffectenergymatterchangeengagedsystemsdevelopanalyzethinkingargumentpatternsquantityfunctioncarryoutquestionsstructurestabilityinterpretconstructconceptualproportionexplanationcommunicateinformationinvestigation

Grade 3 Science - Scientific Method 2024-09-11

30 Items: datahelpspaceearthrecordmatterenergylivingbiologygeologyresultszoologyvariablediscovercomputerinterpretscientistquestionspersevereequipmentcooperatebrainstormentomologyexperimentlaboratorypredictioninvestigateconclusionsobservationsinterconnected

The Search 2024-10-26

30 Items: blutriobaolpelolevimaterleechdeityliderflakesnowymaskyhingerainermatterheraldentitypyritepicklebasuraintentstewardrasgadobracketmanifestvestatronindividualglowsterioantimatterthirdentity

space 2024-12-18

25 Items: WayStarHoleYearCometOrbitGalaxyPlanetNebulaMeteorSystemRocketCosmosQuasarMatterEclipseGravityAsteroidSatelliteTelescopeAstronautExoplanetSupernovaAndromedaSpacecraft

first 3 topics 2025-02-05

30 Items: DenseAtomsGroupcellsStainMatterLiquidEnergyBrittleMagnifyInfraredElementsHalogensParticlesNonmetalsStrontiumconductionInsulatorsTransitionMicroscopeEvaporationElectricitySpecialisedCellmembraneRedbloodcellEyepiecelensLivingthingsDoubleglazingPeriodictablephotosynthesis

bones 2024-05-21

15 Items: the jaw or jawbone.any bone of the wrist.protect your internal organsThe area of the body below the abdomen.located in the central part of the chest.the skeleton of a person's or animal's head.lower limb extending from the hip to the kneeouter of two bones of the lower leg or hind limbone of the three bones that make up the hip bone...

Pathophysiology, Word Search 2024-09-09

20 Items: something that is subjectivedefects that are present at birththe form and structure of organismsobjective and observed manifestationthe likely outcome or course of a diseasethe increase in severity signs or symptomsthe decreased in severity signs or symptomsthe study of reasons for certain decease phenomena...

American Revolution 2024-10-25

24 Items: ActActsArmyPatriotBoycottof 1763MilitiawarfareCongressLoyalistMassacreFranklinMonarchyRedcoatsMinutemenTea PartyJeffersonDemocracyRevolutionParliamentof SaratogaMercenariesConfederationof Independence

Unit 4 Review 2025-02-06

18 Items: way of Romanizing the Chinese wordsthe Latin spoken by the common peoplearticulator engaged to nasalize a soundsounds made without the use of the lungssound made with little obstruction of airthe forcing of air through the nasal cavitywhat the letter "h" is on French and Spanishlangauge family to which French and Spanish belong...