numbers Word Searches

spanish colors and numbers 2021-03-23

6 Items: catdoglionzebrahippoelephant

Books of the Bible 2015-09-19

71 Items: JobKaiAnnRuthEzraJoelAmosMarkLukeJohnActsJudeLukeJackHoseaJonahMicahNahumTitusJames1John2John3JohnAkilaSilasExodusJoshuaJudges1Kings2KingsEstherPsalmsIsaiahDanielRomans1Peter2PeterHunterGenesisNumbers1Samuel2SamuelEzekielObadiahMatthewHebrewsMadisonNehemiahProverbsJeremiahHabakkuk1Timothy2TimothyPhilemonMrsHardyLeviticusGalatiansEphesiansColossians...

Tommies biblical wordsearch 2023-11-03

71 Items: ofgodjoboldnewholymaryruthezrasongjoelmarklukejohnactsjudelifebiblejesuskingssongshoseaamoasjonahmichanahumtitusjamespeterexodusjoshuajudgessamuelestherpsalmsisaiahdanielhaggairomansheavenchristgenesisnumbersezekielobadiahmalachimatthewtimothyhebrewseternalnehemiahproverbsjeremiahhabakkukphilemonleviticuszephaniahzechariahtestamentgalatians...

japanese numbers to 10 2023-06-15

6 Items: catlionzebrahippoelephantMan's best friend

Algebra 2013-11-08

77 Items: ofAxisDataMeanModepairRateTestUnitZeroConicCurveJointlinesPrimeRangeSlopeValueWholeDomainFactorFiniteGraphscommonfactorLinearMedianOriginSystemCircleVertexVolumeAlgebraFractalInverseNumbersNaturalOrderedTangentnumbersAbscissaAdditionpropertyBinomialfunctionFunctionGeometryGreatestIdentityintegersParallelRadicalsRationalTheoremstriangleVertical...

Numbers skip counting by _______ So EASY 2021-06-11

10 Items: 0112233445566778899

Week 3 Vocabulary 2023-08-23

8 Items: Data that describes things with words.Data that describes things with numbers.A conclusion based on evidence or reasoning.To tell or depict something, in words or in numbers.The better a scientist is, the more they use _________thinking in their work.To explain in advance, based on observation, experience, or scientific reasoning....

Numbers and Countries (Les nombres et les pays) 2019-10-25

17 Items: twosixonefourthreeItalySpaineleventwelvetwentyEuropeFranceGermanyPortugaleighteenseventeenSwitzerland

Books of the Bible 2015-09-19

77 Items: JobKaiAnnRuthEzraJoelAmosMarkLukeJohnActsJude1San4Joh2PetJackLukeHoseaJonahMicahNahumTitusJames1John2John3John1Kinz2Kong1CronSilasExodusJoshuaJudges1Kings2KingsEstherPsalmsIsaiahDanielRomans1Peter2PeterHunterGenesisNumbers1Samuel2SamuelEzekielObadiahMatthewHebrewsMadisonNehemiahProverbsJeremiahHabakkuk1Timothy2TimothyPhilemon1ThessamMrsHardy...

Books of the Bible 2023-03-11

75 Items: joblawruthezrajoelamosmarklukejohnactsjudepaulhoseajonahmicahnahumtitusjamesijohnexodusjoshuajudgesikingsestherpsalmsisaiahdanielhaggairomansipeteriijohnpoetrygenesisnumbersisamueliikingsezekielobadiahmalachimatthewhebrewsiipeteriiijohnhistorygospelsiisamuelnehemiahproverbsjeremiahhabakkukitimothyphilemonepistlesleviticuszephaniahzechariahgalatians...

numbers 2022-05-16

2 Items: URMOM

numbers 2022-05-16

2 Items: URMOM

Ryan's Christian Wordsearch 2023-11-03

86 Items: jobgodruthezrajoelamosmarklukejohnactsjudelordholyloverisehoseajonahmicahnahumtitusjamesjesusbiblepeacecrossexodusjoshuajudgesestherpsalmsisaiahdanielhaggiaromanschristgenesisnumbersezekielobadiahmalachimatthewhebrewsonejohntwojohnmiracleonekingstwokingsnehemiahproverbsjeremiahhabakkukphilemononepetertwopeterkindnesspatiencekindnessgoodness...

numbers 2022-05-16

2 Items: URMOM

Parts of the Face & Body AND numbers 1-10 2024-02-07

18 Items: onetwosixtenfaceearseyesnosearmslegsfeetfourfiveninemouththreeseveneight

Unit 7 Math Vocabulary 2022-11-30

7 Items: A ratio comparing a number of units of one quantityA collection of pairs of numbers that are in equivalent ratiosThe constant value of the ratio of two proportional quantitiesA comparison of two quantities that can be expressed as a:b, a to b, or a/bA number sentence that involves operations, numbers, and contains an = sign...

Lils Bible Word Search 2023-11-03

87 Items: godsinjobzionlordruthezrajoelamosmarklukejohnactsjudejesuscrossdeathtobithoseajonahmicahnahumtitusjames1john2john3johnisraelchristexodusjoshuajudges1kings2kingsjudithestherpsalmswisdomsirachisaiahbaruchdanielhaggairomans1peter2peterbabylongalileegenesisnumbers1samuel2samuelezekielobadiahmalachimatthewhebrewssoldiersnehemiahproverbsof songsjeremiah...

English - Unit 2 (Numbers, Wordbook page 10) --> Horizontal et Vertical  2020-10-15

20 Items: onetwosixtenfourfiveninethreeseveneighteleventwelvetwentyfifteensixteenthirteenfourteeneighteennineteenseventeen

LENT 2024-02-02

15 Items: DONATEDO NOT EATTALK TO GODNOT ON FRIDAYMADE FROM PALMSCOLOR OF PENTECOSTCOLOR OF CELEBRATIONOLD ENGLISH FOR LENTSPRINGTIME/PREPARATIONCOLOR OF ORDINARY TIMEFASTED BEFORE THE FLOODFASTED BEFORE HIS MINISTRYFASTED BEFORE THE TEN COMMANDMENTSCOLOR IN THE CHURCH FOR PREPARATIONONE OF THE MOST COMMON NUMBERS IN THE BIBLE

Otheraspects Word Search 2023-10-15

87 Items: thefixrocsoupnumbersdecadesmixtapenobonesheadspacegigabytesjumpbluesmagicshowmoonbeamsinstreamssoundtestraggaeyardthealmanacgraphiceartherocshowpunchingoutupontheroofbeamculturejunkculturethenightcapmouthsoundsotheraspectscosmicdebrisdapperdoowopmaybeimwrongaudiotouristdopaminedupesoundaffectsgroovegardensmoveablefeastafreesolradiostolenartists...

Otheraspects Word Search 2023-10-15

87 Items: thefixrocsoupnumbersdecadesmixtapenobonesheadspacegigabytesjumpbluesmagichourmoonbeamsinstreamssoundtestraggaeyardthealmanacgraphiceartherocshowpunchingoutupontheroofbeamculturejunkculturethenightcapmouthsoundsotheraspectscosmicdebrisdapperdoowopmaybeimwrongaudiotouristdopaminedupesoundaffectsgroovegardensmoveablefeastafreesolradiostolenartists...

Graphing Terms 2023-11-19

9 Items: The lowest number on the Y axis.The highest number on the Y axis.In the direction of UP and DOWNIn the direction of SIDE to SIDE. (The X axis)Information (data) that deals with numbers and amountsThe numbers you SKIP COUNT by and that are listed on the X axis...

Otheraspects Word Search 2023-10-15

87 Items: thefixrocsoupnumbersdecadesmixtapenobonesheadspacegigabytesjumpbluesmagichourmoonbeamsinstreamssoundtestraggaeyardthealmanacgraphiceartherocshowpunchingoutupontheroofbeamculturejunkculturethenightcapmouthsoundsotheraspectscosmicdebrisdapperdoowopmaybeimwrongaudiotouristdopaminedupesoundaffectsgroovegardensmoveablefeastafreesolradiostolenartists...

trs23 ver3 u16 2023-06-17

10 Items: Begin.Put on clothes.Learn from books.A book for writing in.Put a jacket on a hook.A picture made with paint.We use it to write on paper.A place where we sit and learn.We use it to draw straight lines.A school subject where we learn to add numbers.

Números en Inglés y Español - Numbers in English and Spanish 2024-01-30

20 Items: onetwosixtenfourfiveninethreeseveneighteleventwelvetwentyfifteensixteenthirteenfourteeneighteennineteenseventeen

Los números del 0 al 20 / Spanish Numbers 0-20 2020-10-14

18 Items: unodostresseisoncedocecerocincosietetrececuatroquinceveintecatorcedieciséisdieciochodiecisietediecinueve

500Gigabytes Word Search 2023-10-16

89 Items: fixalmanacdecadesmixtapenobonesnumbersrocshowrocsoupnightcapwayoplayheadspaceinstreamsjumpbluesmoonbeamssoundtestgraphicearreggaeyardbeamculturejunkculturemouthsoundspunchingoutupontheroof500gigabytesaudiotouristcosmicdebrisdapperdoowopdopaminedupegeekgirltalkjoefrankhourmagicrecordsmaybeimwrongmorningloopsotheraspectssoundaffectswitchinghour...

The Impossible Word Search 2024-06-14

93 Items: vethatcapredmayjobschefcoatbluepinkjunejulypilotnursesunnywindyfoggyrainysnowyshoesskirtshirtsocksdressscarfwhiteblackbrowngreenfortyfiftysixtymarchaprildoctorcloudyshortsjacketglovescolorsorangeyellowpurpleeleventwelvetwentythirtyeightyninetymonthsaugustspringsummerautumnwinterfamilymotherfathersisterstylistteacherweatherreadingdancingsinging...

Random stuff 2021-02-17

97 Items: meInRedLOLdayGymBadOutCarPenHatJobBluePinkNameTimeFoodMathGoodNiceYellTalkBallForkBowlCoatFallDoneRaceGoodAdoptGreenDrinkStuffCleanMessyFixedDanceShoutKnifeSpoonSporkPlateStoreGloveScarfBootsShoesWordsStartOrangeYellowPurpleCheeseEasterSocialRandomBrokenGoogleSoccerCerealMeijerTargetCostcoChilisPencilMarkerSummerWinterSpringAutumnSearchGiraffe...

Percentage 2023-07-25

6 Items: entiregoods and services tax.a deduction from the usual cost of something.can refer to the monetary charge for borrowing money.relating to a system of numbers that is smaller than 1.a small or tiny part, amount, or proportion of something

Unit 3 Vocabulary Word Search 2023-10-04

14 Items: number of protons in the nucleus of an atomuncharged, subatomic particle located in the nucleusunit of mass equal to 1⁄12 of the mass of a 12C atomaverage mass of atoms of an element, expressed in amuthe lowest energy state of an atom or other particle.positively charged subatomic particle located in the nucleus...

Ajar Word Search 2024-04-26

12 Items: a large white birdlimated of somethinggoing down in numbersa foot like treatmentsomething that's stickydecline of a unexpected thingsomething that only open a littlegoing somewhere and not coming backsomething or realed to something elseto exandout out ward were your body canta strong dislike to something or someone...

Maths Units 1-6 Wordsearch 2023-11-20

14 Items: Per hundredTaking awayBottom of a fractionA four-sided 2D shapeA collection of elementsThe index, order or ......A fraction of the same valuePositive or negative numbersA number multiplied by itselfCan divide by only itself and 1A whole number times another whole numberInterest accumulated on consecutive years...

Mathcounts Terms 3 2023-12-09

44 Items: Half of a circle.A positive integer.A polygon with four sides.Having the same shape and size.The sum of the digits of a number.A positive or negative whole number.A number without fractions or decimals.The average value of a random variable.The point where a line crosses the y-axis.A set of equations with the same variables....

Sources of finance. 2023-09-02

10 Items: repossesstradepayablesretainedprofitexternalfinanceresources used or owned by a business.Long-term finance secured with propertyfinance provided by the owner of a business.generated by the business from its own means.one or a series of regular payments made until all the money owed has been paid off....

Listen Word Search 2023-12-13

12 Items: You make food to eat.You do this with music.You say the numbers out.You do this with a pencil.You do this with your ears.You do this with your eyes.You do this with your mouth.You say the words on a book.You do this in a swimming pool.Birds do this with their wings.You use a finger to show an object.You make pictures with pencils and color pencils.

early childhood 2024-04-12

111 Items: artgluedesktoyssnacknannytablechairpaperbooksnursepaintmusicstaffwipespencilfidgetrecessschoolshapesblocksdiaperinfantcraftsplantsweeklycareertabletteachercrayonsnumberslettersmarkerspuzzlestoddlerdaycarenewbornsupportanimalsweathersciencedancingnurseryprogramculturecubbiestissuesmagnetssandboxchildrenbackpacklunchboxsandwichemotionslearning...

Unit 7 Math Vocabulary 2022-11-30

4 Items: equationThe constant value of the ratio of two proprtional quantitiesA collection of pairs of numbers that are in equivalent ratiosA comparison of two quantities that can be expresses as a:b, a to b, or a/b

Unit 7 Math Vocabulary 2022-11-30

4 Items: equationThe constant value of the ratio of two proprtional quantitiesA collection of pairs of numbers that are in equivalent ratiosA comparison of two quantities that can be expresses as a:b, a to b, or a/b

Unit 7 Math Vocabulary 2022-11-30

4 Items: equationThe constant value of the ratio of two proprtional quantitiesA collection of pairs of numbers that are in equivalent ratiosA comparison of two quantities that can be expresses as a:b, a to b, or a/b

Math vocab 2023-06-09

10 Items: The most frequent numbera value that acts outsideSubtracting larger from smallestOrder the numbers to least to greatestDivide and add many items in the data setrange the difference between two math termsof central tendency the values that result fromdata points The values that represent statistics...

Technology vocabulary 2024-07-11

7 Items: Very popular on the internetYour online opinion about somethingA picture of yourself with your smartphoneA piece of equipment to make your voice louderInformation about about yourself on a social media siteTo transfer data or files from a computer to the internetInput gadget to enter letters, numbers, and other symbols into a computer

Numbers 90 and 100 2020-06-22

3 Items: oneninetyhundred

early childhood 2024-04-19

116 Items: desknursebookschairtablepapermusicnannyschoolweeklytoddlerecessfidgetblocksshapespencilinfantdaycareteacherlearingprogramnurserysupportculturemagnetspuzzlesnumbersmarkerscubbiestissuessciencedancinganimalscookinglibrarystorageprintercrayonsnewbornsandboxhomecaretrainingfeelingsbabblingemotionsfamilieslanguagesanitizesandwichlunchboxbackpackcomputer...

TA2.2 Day 5 Adjectives 2023-08-18

12 Items: When you feel sure, you are ___When you draw pictures, you are ___When you talk to everybody, you are ___When you study or work a lot, you are___When you do different things, you are ___When you think clear thoughts, you are ___When you want a sucessful future you are___When you are good with numbers, you are ___...

Math Vocabulary Word Search 2024-04-26

100 Items: rise over runa fixed numbera ratio out of 100a six sided figureeight-sided polygona five sided figureone output (y value)a three sided figurethe answer to a problemequal in value or amountthe perimeter of a circlea polygon with four sidesof, relating to statisticsthe slope of a vertical linethe top number of a fractiondistance a number is from zero...

Building the Frozen Ark 2023-11-17

15 Items: necessary (par. 8)causes harm(par. 5)a replacement (par. 4)related to ecology (par.6)poisonous substances (par.6)state of being aware (par. 8)calculate approximately (par.2)a particular kind of material (par. 3)act of preserving or keeping safe (par.7)having the appropriate qualifications (par.7)relating to or consisting of molecules (par.5)...

Verbs 2023-12-16

16 Items: You make food to eat.You do this with music.You say the numbers out.You do this to your hair.You do this with a pencil.You do this with your ears.You do this with your eyes.You do this with your mouth.You say the words in a book.You do this with a toothbrush.You do this in a swimming pool.Birds do this with their wings....

for my love 2024-06-04

14 Items: my nameby clairoI ____ you_______ toileti love ____ (you are ____)source #1 for con to the domsOGRE NOISE TUTORIAL CREATOR NAMEthree numbers we say i love you withaction that i love that involves the lipsmy amazing boyfriend's name muwah muwah muwahthe sound of a kiss that we like to text each other...

SOF final project 2024-06-05

15 Items: Putting values where the letters area polynomial, which has only one termvery different from the usual or traditionalalgebraic expressions that consist of variables and coefficientsa straight line that is used to define a curve or a conic sectiona quantity that may be changed according to the mathematical problem...

Palabras al Azar 2023-03-07

20 Items: a sneaky animalan extoic fruitMan's best friendthe color of an applemoisture for the skina device you play withword describing an injurya color on the Honduras flagwhat people drive on an dailytrips people take to get awayword describing having to waittype of support to help you seeword describing a tiring feelinga subject dealing with chemistry...

anything 2023-10-17

130 Items: foxelfbobgrut5grumlegarmsunsindayredpitcatdogabsicealexlinkwolfferbryanolafelsaannasmg4smg3smg2smg1smg0taribookbootkidscakerakezurgxmasreadgearkingnosejakenerdricelambfaceveryvasepinkbluejokelakelakeirisbearmariopeachstevewariozeldaganoncappysamussnakemidassloneluigikirbykevensantaplutogoofypeteymeggyjonesdumboblazeninjatablesnackapplewoodymelon...

Melanie Martimez 2024-04-09

138 Items: runvoidevilwombcakesoapracezzzzak47mazejinxplutogluedalonesmoketwinspowdertestmerecesstheoneschizoseesaweraserabsorbcorpsegardensirensleechescrybabynumberscopycathauntedballpitcootiesheartediscreampatientringpophistoryemeraldmagnetscarouselsippycupplaydatenotebookdeadtomecurlycuepapercutmilkywaydrowningjumpropemistakesyouloveieraseherfunction...

for my love 2024-06-04

14 Items: my nameby clairoI ____ you_______ toileti love ____ (you are ____)source #1 for con to the domsOGRE NOISE TUTORIAL CREATOR NAMEthree numbers we say i love you withaction that i love that involves the lipsmy amazing boyfriend's name muwah muwah muwahthe sound of a kiss that we like to text each other...

Listening Word Search 2022-07-05

10 Items: This quality makes sure you don't give up.This skill means you are good with numbers.This skill means that you can direct others.This skill allows you to keep thing in order.This skill means you have good written skills.This Skill makes sure you get the right answer.this might be a word used for a problem solver....

Melanie Martimez 2024-04-09

138 Items: runvoidevilwombcakesoapracezzzzak47mazejinxplutogluedalonesmoketwinspowdertestmerecesstheoneschizoseesaweraserabsorbcorpsegardensirensleechescrybabynumberscopycathauntedballpitcootiesheartediscreampatientringpophistoryemeraldmagnetscarouselsippycupplaydatenotebookdeadtomecurlycuepapercutmilkywaydrowningjumpropemistakesyouloveieraseherfunction...

Math 6 Vocabulary 2023-04-18

15 Items: Part of a wholePer one hundredA comparison of two ratiosA comparison of two quantitiesThe measurement of the space aPositive or Negative Whole NumberA statement of an order relationshipA math statement that shows equalityThe measure around the outside of a circleThe measurement of the outside of a polygonMath phrase with numbers and operation sign...

New Testament Books in Order (minus the ones with numbers and Revelation). 2020-06-26

10 Items: MarkLukeJohnActsJudeTitusJamesRomansMatthewPhilemon

Melanie Martimez 2024-02-22

138 Items: runvoidevilwombcakesoapracezzzzak47mazejinxplutogluedalonesmoketwinspowdertestmerecesstheoneschizoseesaweraserabsorbcorpsegardensirensleechescrybabynumberscopycathauntedballpitcootiesiscreampatientringpophistoryemeraldmagnetscarouselsippycupplaydatenotebookdeadtomecurlycuepapercutmilkywaydrowningjumpropemistakesyouloveieraseherfunctionstitches...

Posties 0101 Cover 2023-12-08

6 Items: a type of pumpkin soup that Haitians eatbeing successful and having a lot of moneyused to describe something that is very bad and harmfulPeople in America watch a _____ drop to celebrate the new year.a sequence of numbers said in reverse order, marking the time remaining until a specific event...

Numbers 2020-05-22

1 Item: forty

Numbers 2023-04-23

1 Item: zero

Numbers 2023-05-30

1 Item: two

Balak 2024-07-13

18 Items: Son of Beor.Balak’s fatherThe Prophet of the HaftarahThe last station of the ExodusHe was once a priest of MidianA son of Abraham’s wife Keturahthe art of black magic; witcheryThese were the descendants of LotHis name means “Devastator” or “Waster”Balaam was a role model for spiritual _____.commonly used to describe the trumpet blast....

Balak 2024-07-13

18 Items: Son of Beor.Balak’s fatherThe Prophet of the HaftarahThe last station of the ExodusHe was once a priest of MidianA son of Abraham’s wife Keturahthe art of black magic; witcheryThese were the descendants of LotHis name means “Devastator” or “Waster”Balaam was a role model for spiritual _____.commonly used to describe the trumpet blast....

UPS Label Requests 2023-09-25

19 Items: A UPS label requires _________ _________ to be created.On the confirmation page, what should you copy for later use?UPS labels should be created in possible __________ situations.Box 3 - What are you shipping? - What is the correct Packaging Type?Box 1 - Where is this shipment going/coming from? - What should you click?...

Can You Spot the Best Math Coach at MWE? 2024-05-20

1 Item: Coachlife, mathwhiz, scientist, numbers, lines, geometry, 3Dshapes, 2Dshapes, numbers, matharoundtheworld, stmath, gigi, missionwestelementary, lessons, problemoftheday, leadership, modeling, coteach, numberline, measure, time, gregtang, acute, triangle

Adjectives 2022-06-04

23 Items: square, roundwarm, cool, hotold, young, newMexican, Peruviantall, massive, hugered, orange, yellowwooden, glass, metalHis father died. He isAnother word for joyfulthree, ten, a few, severaldelicious, charming, cleanA man that is 6 feet tall isThe country home was very...The man was 3 feet tall. He isShe is only 3 years old. She is...

ROBBERY PROCEDURES 2023-01-16

14 Items: A fake form of currencyThe color of security foldersWhat we do to suspicious emails.Where do you find the security manual?A more professional way of saying branches.The people who pick up/drop off our currency.The first step to do in an active shooter drillThe type of check we can cash for a non-customer....

Lesson 15 Vocabulary 2024-01-05

6 Items: to rewrite an expression as a product of factorstwo or more terms that have the same variable facorsa number, or expression with parentheses, that is multipliedtwo or more expressions in different forms that always name the same valuea number that can be expressed as the fraction a/b, where a and b are integers and b doesn't equal 0...

Chapter 6 Vocab Word Search 2022-09-27

15 Items: shows the expected cash outflowsplan for future in quantitative termsexpressing company's goals and objectivescompilation of all budgets/schedules preparedschedule that shows anticipated cash collectionsstandard achieved if operating conditions are perfectdifference between reported budget and realistic budget numbers...

chapter 2 - tools of environmental science 2023-09-06

17 Items: factor of interestchance that something will happen.representations of objects or systems.the probability of an unwanted outcome.associations between two or more events.a procedure designed to test a hypothesisgroup that receives the experimental treatmenta piece of information we gather using our senses...

Communication 2023-12-09

16 Items: worldwide computer networka dishonest plan to steal moneysystems to send and receive informationdevice that can connect to the internetwhen more than one thing is joined or linkedwhat you can do to go to another page onlinetricking someone over the internet or by mailwhen a computer system is broken into illegally...

Space and Technology Word Puzzle 2023-01-03

25 Items: The endless voidA new thing to createA thought or a feelingAnother word for modelSomething used to divedThe continue or to makeThe subject with numbersSomething used to times itA bright source or a movementTo get more of an understandingThe element on the periodic tableUse it to make something organizedA branch of physics and technology...

SOLDERLESS CIRCUIT BOARD 2024-05-07

10 Items: The SOLDERLESS CIRCUIT BOARD is made of sets of ________________ holes.A SOLDERLESS CIRCUIT BOARD is designed to be _________________ many times.Inside the holes on a SOLDERLESS CIRCUIT BOARD are ________________ strips.Each hole on a SOLDERLESS CIRCUIT BOARD is designed to fit __________ wire....

Unit 4: Fixing Your Credit 2023-04-02

15 Items: Money that you owe.People who provide credit.Total amount of money originally agreed to pay back.Credit that is extended for a short term, 30 days or less.Created the credit scoring model that assigns a numeric score.The ability to borrow funds that will be repaid in the future.Credit allowing consumers to borrow up to a preset maximum amount....

SOL Review Terms #1 2024-03-13

15 Items: the feelings we associate with words ________________the dictionary definition of a word __________________a mini-dictionary at the back of a book ________________an extreme exaggeration used to make a point ______________words that make or represent sounds (e.g. meow) _______________...

Attachment Word Search 2024-05-31

10 Items: to post photos or videos to the interneta file that is sent together with an email messageto look for information on a computer, the internet, etc.to move a file from the internet to your computer's memorya computer program that is designed for a particular purposethe system for using computers to send messages over the internet...

Clay's Vocab 2023-09-26

23 Items: made a choiceto show clearlycontaining nothingyoung cows or bullsa quantity of somethingto form a mental pictureto total numbers togetherreflection of sound wavesa way to get into somethinga value that does not changea breaking of a law or promisedownward measurement from a surfacea sweet, brown food that is made from cocoa...

Computer Definitions 2023-11-09

12 Items: Phishing - A type of email/message sent by scammersMouse- A small device that allows us to point and clickBackspace - the key used to delete letters to the left.Email - A electronic message sent through the internet.Attachments - Files or photos that are added to a email.Printer - A device used to print paper copies of a document....

Lender Placed 2023-10-25

12 Items: Who is the insured on an LP Policy?LP insurance covers protection for what?The Level numbers help us identify the ______ on the loanIf the coverage for LP shows WO that means it's for what risk?What's the acronym of the agency that regulates LP requirements?The status of the LP when there's no current preferred coverage on file...

Chapter 6 Chemistry Review 2023-01-10

10 Items: 6.022·10^23The mass in grams of 1 mol of the substance.A small unit of mass equal to 1.66·10^-24 grams.Which has more mass, 1 mol of silver or 1 mol of lead?The number equal to the number of carbon atoms in 12.01g of carbon.The weighted average of the masses of all the isotopes of an element....

SOF final project 2024-06-05

10 Items: a polynomial, which has only one termvery different from the usual or traditionalalgebraic expressions that consist of variables and coefficientsa straight line that is used to define a curve or a conic section)a quantity that may be changed according to the mathematical problemthe calculation of an outcome or the chance of an event ever happening...

SOF final project 2024-06-05

10 Items: a polynomial, which has only one termvery different from the usual or traditionalalgebraic expressions that consist of variables and coefficientsa straight line that is used to define a curve or a conic section)a quantity that may be changed according to the mathematical problemthe calculation of an outcome or the chance of an event ever happening...

numbers and colors 2022-12-15

1 Item: one two three four five six seven eight nine ten red yellow blue green orange purple

Cell Organelles 2022-10-06

29 Items: the DNA of a prokaryotethe carrier of genetic informaciónhelps in the storage of proteins and lipids.An organelle that helps sequester waste productsynthesizes and stores proteins, bound with ribosomesthe basic unit of life in organisms of the kingdom Plantae.the basic unit of life in organisms of the kingdom Animalia....

Unit 5: Spelling Lesson 1 2023-01-12

25 Items: composed of onefoolish or sillyan eating establishmentcomposed of more than onea shortened form of a wordslanted cursive or type characterscomprising everything; comprehensiveconsisting of diverse things or membershappening as a minor result or by chancethat which had being before something elseuninfluenced by emotion; based on the factual...

T14 - Word Search #2 2023-07-12

26 Items: best team on EIDLEIDL loans are not...transfer type for the CESCpayments apply here first...most transfers to the CESC will go hererequired for all meetings and trainingsrefer caller's here who suspect ID thefttransfer physical home disaster loans herewe are no longer referring here for paymentsfunds begin accruing interest from this date...

spanish colors and numbers 2021-03-23

1 Item: rojo

Ham Radio 2024-07-12

20 Items: High power operation, typically more than 100 watts.A device used to transmit and receive radio signals.Extremely low power operation, typically less than 1 watt.A contact or conversation between two amateur radio operators.A combined transmitter and receiver unit used for two-way communication....

Atoms 2024-01-07

13 Items: The fundamental unit of a chemical element.High-energy photons generated by radioactive decay.A solid material made of atoms arranged in a geometric pattern.A chemical element with the same number of protons but different numbers of neutrons.An atom or molecule with a net electric charge due to the loss or gain of an electron....

3B 0726 2022-07-23

25 Items: unwisegreatly surpriseda very large expanse of seafeeling or showing surprisehighly pleasant to the tasteknown and recognized by many peoplea piece of land surrounded by waterfeeling fear or anxiety; frightenedcome or go back to a place or personcoming before all others in time or orderpursue in order to catch or catch up with...

October Security Summit Wordsearch (Harder) 2023-08-18

20 Items: What term means having permission or approval to access something?What is the unique address used to identify a location on the internet?What term refers to the ability to enter or use a system, service, or area?What term describes a widely accepted or established norm or specification?...

Yr 9 Atomic Structure 2023-11-07

26 Items: Discovered the electronsAll metal ions are _________Which element is in group 3, Period 3?Which group does not readily form ions?The charge of an oxygen ion is _________ 2The subatomic particle with a negative chargeWhich element forms a -3 ion and has 2 shellsThe periods on the periodic table are the _______...

Greenhouseeffect Word Search 2023-06-13

30 Items: a place to dispose of waste\When fertile land becomes a desertloss of resources though soil erosiona species that is non native to an arearadioactive waste from nuclear reactorstravel and appreciation of nature areaspower obtained by harnessing of the windThe uncontrolled expansion of urban areasthe decrease in the ph levels in the ocean...

7th Grade Review 2024-05-07

20 Items: FCCLA's official flowerWhat the F in FCCLA stands for.The acronym for the 4 areas of child development.A kitchen tool used to flip pancakes or turn hamburgers.A kitchen tool used to beat eggs and add air to mixtures.The type of stitch we used for our final sewing projects.The type of project we did where you chose what you would cook....

Marketing - Branding Test - Use vocabulary words to complete word search. 2024-03-04

20 Items: gives the brand name, trademark, or logo.products that does not carry a company identity.the physical container or wrapping for a product.using packages to promote social and polital causes.two or more different products or services in one package.A specific type of brand mark, one with human form or characteristics....

Marketing - Branding Test - Use vocabulary words to complete word search. 2024-03-05

20 Items: States the quality of the product.The brand name, trademark,or logo.Products that do not carry a company name.the physical container or wrapping for a product.Using their packages to promote social and political causes.incorporates a unique symbol, coloring, lettering, or design element....

Computer Hardware1 CAT 2023-07-24

24 Items: the computer works on the dataI am also known as optical mediaI measure your unique biological features.computer keeps a permanent record of our workPresenters use me to show their audience a presentationI am a small radio device that stores and transmit datacomputer gives feedback on the results of its processing...

Rwandan Genocide of 1994 [Checkers] 2024-04-25

45 Items: Related to agricultureGuidance or guardianshipPeople engaged in farmingUnauthorized armed forcesArmed resistance or revoltUp to this point or until nowMajority ethnic group in RwandaTemporary or provisional periodTo instigate or stir up troubleAn extremely wicked or cruel actExemption from punishment or lossRestoration of friendly relations...