incl some with Word Searches

DNA Isolation Methods 2024-12-15

30 Items: A buffer designed to lyse cells and release DNA.Biological macromolecules that include DNA and RNA.Using alcohol to make DNA insoluble for easy recovery.A chemical used in phenol extraction to reduce foaming.The amount of DNA recovered from an extraction process.A membrane material in spin columns used to capture DNA....

Greek Mythology & Literature (Module 8, Lesson 4) 2025-11-17

29 Items: — Who was the Greek god of war?— Which Greek god ruled the seas?— Who was the king of the Greek gods?— Who was the Greek god of the underworld?— Which goddess represented love and beauty?— What was the mythical home of the Greek gods?— Which god served as the messenger of the gods?— Who was the queen of the gods and wife of Zeus?...

Key to Literary Analysis Test 2022-12-12

15 Items: yougoodThis theme can be revealed in literature, in the book “Night”, when the horrors of the concentration camps made Elie believe less in god.By revealing their mistakes through their ______________, an author of a memoir risks being judged by the audience for their flaws and mistakes they made....

Places in Matosinhos 2024-10-17

9 Items: The main building where the local government works.A place where you can borrow books to read or study.A building where people go to pray or attend religious services.A sandy or rocky area by the sea where people can swim or relax.A statue or building made to remember an important person or event....

9th-Ethics Committees 2025-02-09

9 Items: one of the activities ethics committees doplace where an ethics committee may work; related to healthscientific career that usually forms part of an ethics committeeplace where an ethics committee may work; related to investigationnon scientific career that usually forms part of an ethics committee...

Biodiversity word search 2025-10-08

9 Items: The cross-breeding of two different species.The number of different types of species in an ecosystem.The physical appearance and characteristics of an organism.All the individuals of the same species living in an ecosystem.Individuals of any given species can have subtle differences or traits....

The Seven Sacraments 2023-05-16

12 Items: There are ________ sacraments.The ______ are signs of God’s love for us.You must receive ________ to become a Priest or Nun.The sacrament that seals us with the gift of the Holy Spirit.Sacraments of _________ are Penance and Anointing of the Sick.This sacrament unites one man and one woman to each other and to God...

Sustainability 2024-10-09

12 Items: The variety of all living species on the planetMass destruction of forests, often for agricultureKind of energy obtained from the heat inside the earthThe process of reusing waste as raw material for new productsThe ability to do work, often obtained from renewable sourcesThe presence of harmful substances in the air, water, or soil...

Biology Vocabulary M6L1 2025-09-29

12 Items: A pure substance made of only one type of atomNeutral subatomic particles found in the nucleusA chemical bond formed when atoms share pairs of electronsThe dense center of an atom containing protons and neutronsPositively charged subatomic particles found in the nucleusNegatively charged subatomic particles that orbit the nucleus...

8th-Ethics Committees 2024-11-13

9 Items: one of the activities ethics committees doplace where an ethics committee may work; related to healthscientific career that usually forms part of an ethics committeeplace where an ethics committee may work; related to investigationnon scientific career that usually forms part of an ethics committee...

Incarceron Chapters 15-21 Vocabulary 2023-04-19

20 Items: suggestiveshinning brilliantlyto remove from existencehaving had plenty to eatextreme disgust and hatredto utter or play loudly or harshlystrength, energy, or determinationelaborately or excessively decoratedthe top or highest point of somethinglacking in warmth, life, or kindlinessstruck with terror, amazement, or horror...

Kenzie's Science Wordsearch 2023-12-18

20 Items: Is earths GalaxyA group of stars making a shapeIt must be big and orbit a starA path that a planet is stuck inThey study of everything in spaceWhen light bounces off the objectA piece of rock floating in spaceDischarged gas air and other stuffA rock that enters earths atmosphereBelief of that signs tell our personality...

PRIMA LATINA LESSONS 1-8 2024-02-21

23 Items: _________, don't run in the hall.Astronauts landed on the _________.Twinkle, twinkle little ___________.Sometimes, school is hard __________.I ________ God with singing at church.Lizards like to __________ warm places.Don't _________ over that toy. Share it.What are we having to eat for _________?The captain ________ his ship on the sea....

Pathophysiology Word Search 2024-11-10

20 Items: Having ketones in urineMucous lining of eyelidsHigh blood glucose levelspace between lens and retina of eyeReceptors stimulated by mechanical forceInflammation or infection of the middle earReceptors stimulated by change in temperatureAutoimmune destruction of beta cells in pancreasDeficit in growth hormone production and release...

Echoes of Honor – Castles & Classes WORD SEARCH 2025-04-24

171 Items: BOTHCAREFARMFOODGATEGAVEGIVEGROWHARDHAVEHELDHEREHILLHOSTKINDKINGLANDLIFELIKELIVELUTEMADEMANYMAZEMOATMOREMOSTPASTPLAYPOORRICERULETAKETELLTHANTHEMTRAPTRUEWELLWEREWIDEWITHWOODWORKABOUTARROWBRAVEBUILTCODESDANCEDOORSENJOYEVERYFEASTGAMESGIANTHONORJAPANLABORLATINLEARNLORDSLOYALMUSICNOBLEODORIPOWERRIGHTROYALRULESSLITSSPEAKSTONESWORDTHEIRTHICKTHOSETRUTH...

Sip and Search 2025-04-26

30 Items: Is left handedIs right handedAnnie's occupationAnnie is this signAnnie's "mi amoray"Wilson's occupationWilson is this signWilson collect theseAnnie's favorite foodWilson's favorite foodWilson's favorite sodaAnnie's favorite seasonAnnie loves shopping hereWilson and Annie met hereWilson's favorite holidayMonth that Annie was born...

Giving 2025-05-15

20 Items: God giveth the __________________ and it shall be given youEvery one of us is given _______The spirit of God hath ______ meGod giveth grace to the _______________ and it shall be given unto youGrace and _______ came by Jesus ChristThou hast given him his heart's __________Who giveth us ________ all things to enjoy...

Selection Word Search 2025-05-16

21 Items: Draws straight lines.Draws ellipse or circle shapes.Cuts paths at specified points.Draws multi-sided polygon shapes.Magnifies or reduces the document view.Selects and moves entire objects or frames.Rotates, scales, or skews selected objects.Applies and adjusts gradients within objects.Creates and edits text frames for adding type....

Shelach 2025-06-15

23 Items: Tahor“Send out”“M’rageleem“Lashon Hara”“sent-out one”Joshua’s father.He spoke against Moses.These symbolize health.To do or build. (Hebrew)To Hear and respond. (Hebrew)These symbolize the Torah lifestyle.These symbolize joy and celebration 🥳This Wilderness area was “home” to Ishmael.To keep, cherish, or hold tight to. (Hebrew)...

Hospital Pharmacy Week 2025 2025-10-06

22 Items: Tum,ta tum, tum tumsGeneric name for Prozac.The opposite of formularybrand name of acetaminophenHumulin R is a kind of____?Our Newest automation/robot.common weight loss injectiondifferent brand name for ozempicGives you a jolt- right to the heart.AKA Easybake oven, stuff of nightmares.Tech with most seniority at the Valley....

PCR word search 2023-10-19

9 Items: the environment the DNA lives inusing heat;process modifying the molecular structure of a protein.one of the structural components, or building blocks, of DNA and RNA.to separate mixtures of DNA, RNA, or proteins according to molecular size.cooling;the process of joining of single-stranded DNA or RNA by hydrogen bonds...

Ethics Committees 2025-02-06

9 Items: one of the activities ethics committees doplace where an ethics committee may work; related to healthscientific career that usually forms part of an ethics committeeplace where an ethics committee may work; related to investigationnon scientific career that usually forms part of an ethics committee...

Door Word Search 2022-09-15

28 Items: A rounded roofA person who designs buildingsHorizontal member of step (stair)Vertical member of a step (stair)A structure that has a roof and wallsA design plan or other technical drawingwood that is prepared for use in buildingA fence or balustrade made of rails and postsThe lower surface of a room that people walk on...

Unit 2 ESS 2024-10-02

20 Items: elongated, closed curve with two fociearth-centered model of the solar systemsun-centered model of the solar systemthe Earth's motion of orbit around the Sunpoint in a planet's orbit that is closest to the suneclipse occurs when the Earth's shadow falls on the Moonthe point in a planet's orbit that is farthest from the sun...

Ecology: Word Search 2025-10-03

41 Items: Eat plants.Eat other animals.Consume dead animals.Single living entitiesBoth organisms benefit.Living parts of an ecosystemEat both plants and animals.The variety of life in an area.Nonliving aspects of an ecosystemThe number of species in an area.Neither organism affects the other.Consume dead organic matter (detritus)....

Reilly Example PCV 2024-08-16

12 Items: An inert gasK1 Reactor makes this kind of resinK6 Reactor makes this kind of resinWhen in doubt on K6, put on full ______Glycol loss on a K6 Reactor can lead to aSending material to an incorrect destinationThe type of reaction at risk for a runaway reaction isAdding the wrong amount, or wrong material to a batch....

PERSUASIVE ESSAY VOCAB 2025-01-27

12 Items: The reason behind the argument.Methods used to convince an audienceA rhetorical appeal to logic and reasonThe choice of words used in an argument– Acknowledging a point made by the opposing sideA rhetorical appeal to the emotions of the audienceThe logical explanation that connects the evidence to the claim...

Artificial Selection Vocab 2025-11-13

6 Items: The use and application of living things and biological processesEngineering A technology in which the genetic material of a living cell is modifiedSelection The human practice of breeding animals or plants that have certain desired traitsTherapy A technique that places a gene into a cell to correct a hereditary disease or to improve the genome...

FOOD 2022-08-30

8 Items: A small, round cake or piece of breadAn oval, purple vegetable that is white insideA small round fruit on particular plants and trees.Food which is unhealthy but which is quick and easy to eatA small sea animal which you can eat, and which has a shell and ten legsA small, round, soft red or black fruit with a single hard seed in the middle...

Parshat Shemini 2024-04-05

15 Items: Hebrew for "Tabernacle"Moshe gets upset with himHebrew for "Divine presence"Another word for split hoovesKosher fish need _ and scalesHebrew for "impurity" (not found on Chabad)The Torah lists the kosher version of this insectAaron's sons died after bringing this type of offeringKohanim are told not to drink this before doing the avodah...

Vcocab Words 2025-03-05

15 Items: - warn or reprimand someone firmly.– The state of having or owning something.- not discovered or known about; uncertain.- not sufficiently strict, severe, or careful.– Relating to principles of right and wrong behavior.– To place things side by side for comparison or contrast.- (of one or more things) available as another possibility....

MODULE 1C: WORD SEARCH 2025-03-15

15 Items: movement of water through a membrane.Plant hormones that help with growth.A chemical that controls body functions.A nerve cell that sends messages in the body.The long part of a neuron that carries signals.System The system in the body that makes hormones.The tiny gap where nerve signals pass between neurons....

Preeclampsia-May 1 Name: ________________________ 2025-05-06

15 Items: Severe headache may signal worsening preeclampsia.Ongoing assessment of blood pressure, urine, and symptoms.Includes preterm birth, maternal stroke, and fetal distress.Swelling in the hands, face, or feet caused by fluid retention.Presence of protein in the urine, indicating kidney involvement....

August ('25) Vocabulary Word Search 2025-08-07

15 Items: Small and weakTo eat food hungrily or quicklyA painful or horrific experienceOf very great extent or quantity; immenseProduce and/or discharge something; make a soundIn a way that is uncertain, indefinite, or unclearTo shine brightly, especially with reflected lightTo rise from; become apparent, important, or prominent...

MJ9 VOC Review 2025-08-18

15 Items: To follow orders or rulesWhat is the opposite of "cheap"?It is a color that is shiny and gray.A person who writes or broadcasts newsYou can eat it with milk for breakfast.It's Halloween. Let's go ____-or-treating!Harry Potter can perform magic so he is a what?You can use it to cover your body when sleeping....

Pomona Word Search 2023-03-08

21 Items: slept for 57 yearskeeper of the beesgood and wise centaurgoat with the horn of plentywas poisoned by a jealous Circedolphins carried him back to landthe trident was made in her honorthe six stars that brought the rainmother of the twins Artemis and Apollohis lock of hair protected his kingdomhusband and sons killed in a rebellion...

Find the Words! 2023-05-17

20 Items: The top of a mountainTo shoot out with forceAble or likely to explodeHot liquid rock inside EarthCausing great harm or damageTo produce or create somethingA covering or layer of somethingTo come out quickly and suddenlyVery big, impressive, or beautifulBeing in a state of rest or inactivityA large, bowl-shaped hole in the ground...

The Skeletal System 2024-10-15

60 Items: armribnotneckhandnosebonefootnoseulnajointwristskullelbowfeverankletibiaabovefibulasacrumhumerusagainstbetweenhumpbackstraightcartilagesofteningthigh boneboth sidesmany, muchdeficiencyextremitiesfoot; childto the lefttumor; massto the rightwithin, intounder, belowinflammationcrooked, bentchange; beyondtogether, withsolid structuresurgical repair...

Revolution Word Search 2025-01-18

20 Items: Queen of France, married to Louis XVIThe state of being free within societyA form of government without a monarchBrotherhood, a spirit of unity among peopleA period of violent repression and executionsThe state of having the same rights and statusThe social classes in pre-Revolutionary FranceA radical political club during the Revolution...

Water Word Search 2025-05-05

20 Items: A treat for summerA big boom in the sky!Something fun to jump onWhat you take in the summerWhat you feel in the summerA type of meal or gatheringA sweet and freshly productHow you get tan in the summerYour body's reaction to cool offWhat people say it looks like outsideWhen you bath in the sun it's called?A place to go when the weather is warm...

Emor 5.0 2025-05-11

21 Items: KorbanPesach“HaShem”“set apart”“Commandments”‘priests’, Hebrew.The day of complete rest.The 10th day of the seventh month.Punishment for blasphemy of The Name.Animal korbanot are to be without ______.What kind of oil was used in the menorah?The Haftarah Emor comes from the book of ______.A kohen is to marry a ______ from among his people....

my words 2025-09-03

23 Items: my top shipwhat's my namesunoo but girlitachi got thisjapanese word for stupidsunoo but with pink hairour top kpop idol (male)i have two of these monstersmonster i bought from 5 belowthis is a phrase jungwon saidacronym for the loml of my lifemy favorite south park characterwho said "i'm alive and kicking"tik tok kid that does the rizz face...

Onomatopoeia Word Search 2025-09-29

20 Items: An example of blendingCompounding break+fastAn example of compoundingAn example of foreclippingShortening the end of a wordStudy of the meaning of wordsTaking words from another languageA word borrowed from India (Hindi)Words that imitate sounds are calledCombining two words to make a new oneUsing part of a word to form a new one...

wordsearch ***SUDDENDEATH*** 2025-09-30

111 Items: varjmeslogslugdragsakachiprallyalleylewisserveonanahaydnravellisztverdianusahyssopnutmegneymarmbappemullerthiagoskeptachopinmahlerrameaurubatobrahmswagnerdvorakjubileemordentmanmarkmclarengerrardlampardvandijkstarboyacademystormzydebussypuccinivivaldibehemothseraphimcovenantforehandmidblocktractionraphinhasibeliusleviathanaleatoricelshaddai...

Romeo and Juliet Vocabulary #1-2 2025-11-18

20 Items: an enemy or opponenta praiseworthy qualityto make greater more numerousbeing most frequent or commonof a grayish greenish yellow colorgiving rise to loathing : disgustingcharacterized by wiliness and trickerya usually verbal conflict between antagoniststhat is to be regretted or lamented : deplorableprayer, petition, or entreaty in favor of another...

February Word Search 2025-11-24

20 Items: Strong emotion or intense affection.A gentle feeling of fondness or care.To hold someone dear or value deeply.Comfortable and warm during chilly days.Sweet treats commonly gifted in February.To remain in winter rest, nearing its end.Injury caused by extreme cold in late winter.The cold, frosty quality of February weather....

Christmas Tree 2025 2025-12-08

37 Items: tall shoeour planetour countrya tall bushlong reptileshouse of bookshome of a crabprecious stonethe fifth monthmakes you drunkwhere you learndo it two timesJesus's birthdayopposite of eastblack/white bearhouse of envelopesopposite of darknessliquid precipitationgood dirt for plantssit in this at schoolwear them during COVIDwhat boxes are made of...

Britton Glenn 2024-05-16

15 Items: change from solid to a liquid.the turning from a liquid to a gasthe turning from a gas to a liquidcharging an object without touching itexplains how particles in matter behave.anything that has mass and takes up spaceequals the number of protons or electronsincrease in a material's volume when temperature is increased...

The Final Pilgrimage of the Prophet Muhammad (PBUH) 2024-09-26

15 Items: The Prophet left behind the _______ for guidance.The invocation recited by Muslims during Hajj: _______The month in which the final pilgrimage took place: _______The final pilgrimage took place in the 10th year of _______.The Prophet stressed the importance of _______ among Muslims.The Prophet emphasized the _______ nature of life and property....

Monochromatic Word Search 2025-05-27

15 Items: The lightness of darkness of a colorThe brightness or dullness of a colorThe pigment that gives the skin its colorPigments that give yellow tone to the skinBlues, greens and violets fall into this categoryReds, oranges and yellows fall into this categoryThe high color value or the lightness of the color...

Places in Matosinhos 2024-10-17

9 Items: The main building where the local government works.A place where you can borrow books to read or study.A building where people go to pray or attend religious services.A sandy or rocky area by the sea where people can swim or relax.A statue or building made to remember an important person or event....

Chem Chapter 7 2025-11-19

9 Items: Type of stress that can be described as "cutting"Type of stress that occurs when two sections pull apartType of pitting corrosion in the low flow region of a creviceType of stress that occurs when parts press against each otherType of corrosion where the site becomes fixed in a small area...

TLE WORD SEARCH 2025-02-03

25 Items: Used to open cansUsed to hold food in placeUsed to combine ingredientsDesigned for thick sandwichesUsed to separate liquid from solidUsed to slice foods more evenly and uniformlyCome in various length of 6,8,10,and 12 inchesMachine used to chill sandwiches and onther foodsA transparent glass with fractions [1,3/4,2)3,1/2,1/3,¼]...

Swachhta Pakhwada 2025 01st July – 15th July 2025 2025-07-10

37 Items: H1: Used in gardens H2: Removes leavesH1: Water outlet H2: Must be uncloggedH1: Falls from tree H2: Often swept awayH1: Throw garbage here H2: A dirty placeH1: Comes from soap H2: White and bubblyH1: Opposite of dirty H2: Rhymes with meanH1: Use cloth to do this H2: Cleaning actionH1: Must be unclogged H2: Drains dirty water...

HUMAN BODY SYSTEM 2025-12-02

38 Items: Tissues that enable movement.Another word for a nerve cell.Organs where blood gets oxygen.A muscular sac that stores urine.The strong muscle that pumps blood.The watery fluid part of the blood.The red fluid pumped throughout the body.The windpipe that carries air to the lungs.The main control center of the nervous system....

Lesson 7 Terms-to-Know 2024-09-05

6 Items: The freedom to make your own decisions and control your own life.A knowledge and understanding of your own personality or individuality.A group of people or resources that help you achieve your goals and handle challenges.The action of representing one’s own views and interests or making others aware of your needs....

What is a mineral?5 2024-05-04

10 Items: When something turns around in one spot.An imaginary line that an object spins around.When one thing goes around another thing in a circle.Phases: The different shapes of the moon as seen from Earth.Pace: Moving at a consistent speed without significant changes.Side of the Moon: The side of the moon that is not visible from Earth....

HOW A 555 TIMER IC WORKS 2024-05-24

10 Items: How many pins does a 555 Timer IC have?A 555 Timer is an ___________________ CIRCUIT.From which pin on the 555 Timer IC do the pulses come from?The mark or indentation on the 555 Timer IC helps to find which pin?The component which affects the pulse rate is the __________________ ....

Trial 2025-08-01

10 Items: SAS function for current system date?Option in PROC FORMAT to create multilabel formatsGraph type is typically used for time-to-event dataSDTM variable which indicates study treatment groupMacro variable that stores the current system date in SASR function for generating summary statistics for each column in a dataset...

Verbs 2023-12-05

19 Items: We (have)______ a dog ten years ago.He (tell)______ her that he loved her.The parrot (speak)______ three languages.We (walk)______ along the beach yesterday.She (say)______ thank you for the present.The ship (reach)______ Australia yesterday.He (find)______ new neighbors near his home.They (stop)______ work at exactly one o'clock....

8th Grade Forces and Energy Chapter 4 Hints 2024-01-04

13 Items: scientific ruleenergy of electric chargesability to do work or cause changeenergy of stretched or compressed objectsenergy that an object has due to its motionpotential energy stored in the nucleus of an atompotential energy that depends on the height of an objectform of potential energy that is stored in chemical bonds between atoms...

Week 1 Tricky Nouns Words Word Search - 5/07/2024 2024-07-04

13 Items: - This is your own _________- This is your secret __________- We speak this, it is our _________- You sign contracts with your ___________- This is healthy for you they are a ________- We step on this and call it home as it is our __________- This has all the words in it, its a big book called the __________...

Curse Word Search 2025-04-08

13 Items: – Extremely tired or worn out.– Under the influence of a magical spell.– A magical spell that brings bad luck or misfortune.– A piece of information that is sent or communicated.– Something that is difficult to understand or explain.– A magical action or words said to produce a special effect....

Unit 1: Vocabulary Word Search 2025-09-15

10 Items: Two rays sharing a common endpointA pair of adjacent angles on a straight lineTwo non adjacent angles formed by two intersecting linesThe first point in a ray that marks where the ray starts.angles Two angles whose measure have a sum of ninety degrees.A location that has neither shape nor size. Denoted by a capital letter...

Warli Word Search 2023-07-10

20 Items: Palghat devi is a goddess ofWarli painting were made duringGeru is used to create which color?The folk dance warli tribe is known asThe Warli community speaks this languageThis artform is always mistaken as WarliRice paste is used to create which color?Chauk which is made for Gods are known asThe word Warli originates from which term?...

Industrial Revolution Word Search 2023-07-27

16 Items: jethro tull's stellar inventionjoseph foljambe helps farmers outa noun denoting a period of big changea problem with industrial revolution citiesa problem with industrial revolution citiesperson who introduced the dutch four-field systemsomething workers didn't really have at this timethis machine could work eight bolts of thread at once...

Scarcity Word Search 2025-01-16

15 Items: A tax imposed on imported goods.A plan for managing income and expenses.The action of buying and selling goods and services.The amount by which expenses exceed income or revenue.The financial assets used to produce goods and services.The financial gain obtained when revenue exceeds expenses....

ICP Vocab 4 2025-02-26

16 Items: The ability to cause changeenergy, Energy due to motionIs force applied through a distanceThe rate at which energy is convertedThe ratio of output work to input workadvantage, The ratio of output force to input forceIs anything around which you can imagine a boundarypotential energy, Energy that is due to chemical bonds...

08 2025-08-16

15 Items: a footrest for the riderThe part where the rider sitsSmall footrests for the rider or passengerA device for slowing or stopping a motorcycleFootrests mounted on the bike frame for supportA backrest bar for passenger comfort and supporta term used for the first ride of the new seasonFoot controls used to operate brakes or gear shifts...

SOLDERLESS CIRCUIT BOARD 2024-05-07

10 Items: The SOLDERLESS CIRCUIT BOARD is made of sets of ________________ holes.A SOLDERLESS CIRCUIT BOARD is designed to be _________________ many times.Inside the holes on a SOLDERLESS CIRCUIT BOARD are ________________ strips.Each hole on a SOLDERLESS CIRCUIT BOARD is designed to fit __________ wire....

puzzle 52 2024-11-02

10 Items: What is always coming but never arrives?What has a head and a tail, but no legs?I'm at the centre of gravity. What am I?You cast me without an audition. What am I?When questioned, I always reply with a question. What am I?You can create me by shooting, and I can be thin. What am I?...

Economics and Business 2025-04-14

10 Items: Tariff : A tax or duty imposed on imported goods and services.Profit : The financial gain after subtracting expenses from revenue.Monopoly : Exclusive control of a product or service by a single company.Equity : Ownership in a company, usually in the form of stocks or shares....

Anointing of the Sick 2025-05-22

10 Items: What number sacrament is Anointing of the Sick?or Priests, Who can perform Anointing of the Sick?with Illness, Who can receive the Anointing of the Sick?Who cannot perform the sacrament of Anointing of the Sick?of the Sick, What oil is used as a sign of Gods grace and healing?Grace, What is the gift from God that heals and sanctifies our soul?...

Messianic Prophecies 2025-04-04

15 Items: the Lord has laid on him the ____ of us all. Is 53:6and his kingdom is one that will never be ____. Dan 7:14They divide my ____ among them and cast lots for my garment. Ps 22:18his dominion is an ____ dominion, which shall not pass away, Dan 7:14Yet it was the Lord’s will to ____ him and cause him to suffer,Is 53:10...

Natural Skincare Foods 2024-08-27

5 Items: Honey is a great moisturizer and helps to keep the skin well-hydrated.Aloe vera makes an excellent home remedy for glowing skin & healthy hair!Cucumber is cooling for the skin. It replenishes and rejuvenates dull skin with its antioxidants...

Finger/Thumb/Hand Word search 2024-07-15

18 Items: One of Bontrager's image evaluation criteria.One of Bontrager's image evaluation criteria.An oblique hand requires a __ __ degrees of obliquityThis happens when the finger is not parallel to the IRWhat is the centering for a PA, oblique, and lateral thumbWhat is the minimum amount of wrist needed on a hand image?...

Passover 2024-03-03

15 Items: A SACRED RELATIONSHIP WITH GODA CELEBRATION OF AN IMPORTATNT PAST EVENTTHE NATION THAT GOD CHOSE TO BE HIS PEOPLEA SERIES OF DISASTERS GOD BROUGHT UPON EGYPTTHE WORDS OF JESUS THE PRIEST REPEATS AT MASSTHE BREAD GOD GAVE THE ISRAELITES IN THE DESERTA MEMORIAL MEAL RECALLING THE EXODUS FROM EGYPTAN ISRAELITE GOD CHOSE TO SAVE ISRAEL FROM SLAVERY...

a seach 2024-01-26

13 Items: Definition Audioand Definitions TableRenewable energy generated from heat within the earth.A pipe that feeds into a turbine within a hydropower dam.The movement of materials due to differences in temperature.Photovoltaic cells that turn sunlight directly into electricity.A fuel that is made from living matter. Includes ethanol and biodiesel....

Review 2024-04-16

13 Items: Another word for the right to vote?This document freed the southern slaves.Hamilton was in favor of a national __?__.The colonists called the Coercive Acts the __?__ Acts.This was granted to all slaves with the 14th amendment.Someone that is actively against slavery is known as an __?__What is the process for territories to become states known as?...

4 MAJOR DATA COLLECTION METHODS 2023-01-26

4 Items: Real-time data collection and describes behaviours that are happening at the present momentMost widely used technique for collecting data in organisation design - can be done in groups or individualFixed-response queries about various features of an organisation and can be administered to larger amounts of people simultaneously...

Animal 2023-10-24

20 Items: The fastest land animal.The world's largest land animal.Bat The world's smallest mammal.Shark The largest species of shark.Penguin The largest species of penguin.An animal that sleeps upside down in caves.A snake known for its hood and deadly bite.An animal often called "man's best friend."Eagle The national bird of the United States....

Science Y4-Y5 2025-07-04

19 Items: How high or low a sound isHow loud or soft a sound isA plant that makes its own foodWhen light bounces off a surfaceThe natural home of a plant or animalThe largest planet in our solar systemThe ability to do work or cause changeThe path a planet takes around the SunThe force that pulls things down to EarthThe star at the center of our solar system...

Rise of Christianity 2023-07-27

10 Items: 30 CE: _____ and resurrection of Jesus Christ.200 CE: _____ of Christians by the Roman authorities.312 CE: Conversion of Roman Emperor _____ the Great to Christianity.4 BCE: Traditional birth date of _____ _____, the central figure of Christianity.80-100 CE: Writing of the _____, the earliest accounts of Jesus' life and teachings....

10 Signs of an Unhealthy Relationship 2025-06-27

10 Items: When someone has a really strongWhen someone keeps you away from friends, family, or other peopleWhen someone tries to control your decisions, actions or emotionsWhen someone is disloyal or acts in an intentionally dishonest waywhen someone repeatedly makes excuses for their unhealthy behaviors...

Ornithology Not-Test 3 (Community Ecology) 2025-04-28

19 Items: The role a species plays in the environmentDiversity in birds decreases with increasing ___An interspecific relationship in which both or all species benefitA ___ niche is the resources and conditions a species actually makes use ofA ___ niche is all the possible conditions an resources a species could make use of...

Norse Cosmology 2022-07-25

12 Items: The Realm of the Aesir is _____.The Realm of the Giants is _____.The realm of human beings is _______.Norse cosmology divided the universe into ____ realms.Bestla gave birth to the first of the gods: ____, Vili, and Ve.Odin's famous hall of _______, where his throne may have been located, is in Asgard....

Overall Insurance Training 2025-04-14

13 Items: Letter of Map RevisionLetter of Map AmendmentWhat does WO mean under coverage type for LP?What the annual price of the policy is called.Sharepoint form you use when trying to cancel LPWho is responsible for the flood zone assignments?Where you can look for documents that were sent to usThe only type of payment that can be made the same day...

AI Vocabulary 2025-04-29

37 Items: The data used to train an AI model.Data that is defined and searchable.A type of neural network architecture used in many LLMs.The input text given to an AI model to guide its output.A specific type of LLM that uses a transformer architecture.How computers can gain understanding through images and videos....

European Age of Exploration 2024-08-12

10 Items: What was the name of the reconquest of Hispaniola?What nation discovered a new route to India and China?What were southern cities of Spain in terms of religion?What was the name of the trade route from Asia to Europe?What land was known for the large amount of spices produced?What city fell to the Ottoman Empire and cut off the silk road trade?...

P52 2024-11-02

10 Items: What is always coming but never arrives?What has a head and a tail, but no legs?I'm at the centre of gravity. What am I?You cast me without an audition. What am I?When questioned, I always reply with a question. What am I?You can create me by shooting, and I can be thin. What am I?...

Physics and Chemistry Wonders 2025-04-14

10 Items: VALENCY : The combining power of an element to form chemical bonds.IONIZATION : The process of gaining or losing electrons to form ions.ISOTOPE : Atoms of the same element with different numbers of neutrons.INERTIA : The resistance of an object to a change in its state of motion....

TERMS TO KNOW WHEN BUYING A HORSE 2024-01-18

11 Items: Horse is not yet trained to be ridden.Injury that affects the horse’s movement or health.Horse runs off suddenly and will not respond to aids.Standard measurement unit of height (1 hand = 4 inches).No injuries that prevent the horse from regular performance.Horse equipment used to ride, drive, or care for your animal....

Chapter 3 the biology of psychoactive substances 2025-09-12

11 Items: Fetal _______ spectrum disorder.______ use is a confounding element of drug research.______ explains past events and predicts feature events._______ doubles, the likelihood of sudden infinite death syndrome.________ drugs mimic neurotransmitters, and attached to receptor sites...

AP Gov Word Search 2025-12-05

25 Items: The legal right of an individual or entity to bring a lawsuit in court.The party who initiates a lawsuit by filing a complaint against another party, known as the defendant.The process of manipulating the boundaries of electoral districts to favor one political party over another....

Organs so scary yet so cool! 2024-07-19

11 Items: Organ storing urine before it is excreted from the body.Digestive organ where food is broken down and mixed with digestive enzymes.Pair of organs involved in respiration, exchanging oxygen and carbon dioxide.Long, coiled organs where nutrients and water are absorbed from digested food....

Mathcounts Terms 3 2023-12-09

44 Items: Half of a circle.A positive integer.A polygon with four sides.Having the same shape and size.The sum of the digits of a number.A positive or negative whole number.A number without fractions or decimals.The average value of a random variable.The point where a line crosses the y-axis.A set of equations with the same variables....

AI Vocabulary 2025-04-29

37 Items: The data used to train an AI model.Data that is defined and searchable.A type of neural network architecture used in many LLMs.The input text given to an AI model to guide its output.A specific type of LLM that uses a transformer architecture.How computers can gain understanding through images and videos....

Sales and credit checking wordsearch 2024-01-22

11 Items: creditThe security deposit per fuelThe kind of credit check we runSecond step in our sales journeyA type of customer we wouldn't credit checkA type of customer that we may not complete a sale withFirst thing we have to do after taking a security deposit paymentan agreement whereby your prices stay the same for a set amount of time...

22425ECO - PRO1 - Unit 2 - PED and PES 2025-02-11

15 Items: Economists are interested by how much the ____demanded will fall.(B)Good availability of substitutes results in a ______ value of PED.(A)________ are interested by how much the quantity demanded will fall.(A)Some products are more responsive to changes in ____ than other products.(B)...

Competition Word Search 2025-12-01

14 Items: a living thingthe process of creating offspringthe ability to make things move or changewhen something stays mostly the same over timea model that shows what eats what in an ecosystemwhen two or more populations use the same resource________ populations eat organisms from another populationa small part that is meant to s how what the whole is like...