cyber security Word Searches

Customer Service Policies 2026-03-26

17 Items: Who is responsibleExpected behavior from staffsame quality of service every timeSecurity measures to prevent misuseHow you measure whether customers feel supportedPromised performance or commitments to customersThe methods customers can use to reach your teamHow customer data is collected, stored, and protected...

Taxes 2024-12-17

15 Items: Pay Pay before any taxes or deductions are taken outThe first day you can file a tax return for the yearPay Amount of income left after taxes and deductions have been taken out.If an extension to filing your taxes is granted, when is the new due dateTax Day! The deadline to file tax returns (1040) or to request an extension...

Acai Word Search 2026-05-11

230 Items: BowFoxJamAcaiBurnClayCoalCodeDawnDuneDuskGlowGojiHeatKilnKingKissLavaLoveMesaNeonNovaRoseRubyRuneRustSilkWineAlloyAppleBerryBlazeBloomBlushBrickCandyCharmChiliCiderCometCoralCrownCupidCyberDriftEmberFlashFlameForgeGuavaHeartHennaJellyLaserMapleNitroOasisOrbitPeonyPetalPixelPoppyPulseQueenRacerRadarRetroRougeRoyalSatinSmokeSolarSparkSpiceSpellStorm...

Sécurité Word Search 2023-11-17

1 Item: Textes Jeux Site web , Blessures, prévention, Bien-être, Santé, Émotionnel, Soutien, Intimidation, Cyber, Physique, Verbal, Social, Respect, Relations, Parent, Rumeurs, Aime, Supprimer, Technologie

Attachment Wordsearch 2025-04-30

1 Item: comfort, wellbeing, emotions, security, care, connections, content, trust, safe

Class homework 2025-05-21

1 Item: VISA, SUITCASE, LUGGAGE, BOARDING, CUSTOMS, DECLARE, SECURITY, EMBASSY, IMMIGRATION

Quality vs. Safety 2026-02-09

14 Items: Crucial for both quality and safetyA ______ work culture encourages dedication.Safety deparment ______ on-the-job incidentsQuality control ________can uncover potential safety hazaradsEmployee _______ encourages a culture of shared responsibitliy.Employee _______ can provide practical insignts and promote engagement...

DEMOKRASI LIBERAL 2023-11-01

10 Items: Kabinet pertama dalam demokrasi liberal adalah..Prinsip Zaken kabinet terbentuk pada masa kabinet..Perdana mentri dalam kabinet natsir berasal dari partai…Kabinet yang mendukung pelaksanaan Konferensi Asia Afrika…Setelah dikeluarkan Dekrit Presiden 1959 sistem kabinet yang berlaku adalah......

07 2025-08-16

15 Items: name of a motorcycle club movieis what a old timer biker is calledwhat type of clothing bikers preferThe second-in-command in a motorcycle clubafter which war did motorcycle clubs formed ?which US state does not have a motorcycle club ?is what law enforcement requires to operate a bikeThe elected leader of a motorcycle club (short form)...

8/15/2205 2025-08-15

13 Items: -Costs a lot of money-Primary School – Ages 5–11 (K-5)-Money paid in advance as security-The money you earn from work or benefits-Something you can pay for without problems: a person whose job is to find out what happenedCondos are individually owned units in a building-Money paid regularly to live in a house/apartment...

Careers in Computing and Media Word Search 2025-03-16

8 Items: A person who analyzes data or informationA characteristic or quality of someone or something.A particular area of commercial or industrial activity.The duties or obligations that someone has to do something.A fixed regular payment made by an employer to an employee, typically paid monthly....

1. Cloud 2. Server 3. Storage 4. Backup 5. Online Access 6. Zoom 7. Google Drive 8. Scalability 9. Flexibility 10. Data Security 2025-04-16

10 Items: ZoomCloudServerBackupStorageGoogleDriveScalabilityFlexibilityOnlineAccessDataSecurity

10 2025-08-16

16 Items: another term for sportbikeVest displaying club’s patchesa female passenger on the backBell rung to signal a ride’s startOrganizes club records and meetingsSupport attached to motorcycle seatMember responsible for club securityProtects the group from traffic hazardsSymbol representing the motorcycle clubOfficial document forming a club chapter...

Alpha Word Search 2026-03-12

178 Items: PCSSEAFLYNEWREDECHOGOLFKILOLIMAMIKEPAPAXRAYZULUCAMOGEARSHIPTECHBASEBLUECAREHOMEKIDSARMYCREWHEROALPHABRAVODELTAHOTELINDIAOSCARROMEOTANGOWHISKASVABBOOTSCODESDRILLDRONEEAGLEHONORPLANESERVEVALORAPRILAWAREBLOOMGREENHEARTPRIDEROOTSUNITYWORLDCADETCADRECHIEFCORPSFLEETMAJORJULIETQUEBECSIERRAVICTORYANKEEATEASEDEFENDDOGTAGHELMETMENTALMORALSSALUTEUNIQUEHANGAR...

Office 2026-02-05

174 Items: CPRFaxJanJimMugPamBossDeskFireGabeGolfJokeMoseSpamSuitTobyYogaAnnexBanjoBeetsChiliCreedEmailFluteHollyJellOKarenKevinLunchPaperPartyPizzaSabreSalesSnackTrustAngelaCameraClientDarrylDwightEthicsGossipHotDogIsabelMoraleOfficeReturnSitcomTriviaCandlesCheckInDayCareDundiesFloridaJobFairKitchenManagerMeetingMichaelMifflinNewYorkNiagaraParkourPhyllis...

RESILIENC WORD HUNT 2026-05-11

25 Items: — Continuous observation of systems— Automatic switch to backup systems— Measures implemented to reduce risk— Adherence to regulatory requirements— Duplicate copy of data for restoration— Identifying threats or incidents early— Process of restoring systems and services— Defined procedure for handling situations...

CORRECTIONS 2023-12-04

169 Items: jailvesttaserradiolunchfloydcourtbadgechiefdrugsscansjudgesirencrimewoundcodespoliceinmaterookiebookedlawtondinnerfisherbentonshowerreportpatrolarrestbondedtypingintaketicketbuckleweaponmurderdangerorangesweatherbookinghousingboredommedicalofficerfifteenscanlonuniformdayroommonitorcamerascaptaintrusteekitchenrankingcustodyfederalwriteupodyssey...

Slot P&P #5 - Paying Jackpot Winners 2024-12-09

20 Items: An alternative to cash.Handheld device used by Slots.This must be dropped in an audit box.A winners check is issued by a _______.Jackpot funds can be obtained from a _____.ID's that cannot be photocopied or scanned.Any jackpot over $1200 is considered _______.Change from a jackpot is printed on a ______....

Alpha Word Search 2026-03-25

180 Items: PCSSEAFLYNEWREDECHOGOLFKILOLIMAMIKEPAPAXRAYZULUCAMOGEARHULLSHIPTECHBASEBLUECAREHOMEKIDSLOVEARMYCREWHEROALPHABRAVODELTAHOTELINDIAOSCARROMEOTANGOWHISKASVABBOOTSCODESDRILLDRONEEAGLEHONORPLANESERVEVALORAPRILAWAREBLOOMGREENHEARTPRIDEROOTSUNITYWORLDCADETCADRECHIEFCORPSFLEETMAJORJULIETQUEBECSIERRAVICTORYANKEEATEASEDEFENDDOGTAGHELMETMENTALMORALSSALUTE...

Alpha Word Search 2026-03-27

180 Items: ATPCSSEAFLYNEWREDECHOGOLFKILOLIMAMIKEPAPAXRAYZULUCAMOHULLGEAREASEBASECAREHOMEBLUELOVEARMYNAVYCREWHEROALPHABRAVODELTAHOTELINDIAOSCARROMEOTANGOWHISKHONORVALORBOOTSDRONEPLANEASVABEAGLESERVEDRILLCODESAPRILWORLDUNITYAWAREGREENHEARTROOTSBLOOMHEARTPRIDEMAJORCADRECORPSCADETFLEETCHIEFJULIETQUEBECSIERRAVICTORYANKEEMENTALMORALSDOGTAGHELMETSALUTEDEFENDHANGAR...

Vocabulary Lesson 10 2023-01-10

9 Items: In _____, I could have been nicer than.The seven _____ of light are commonly referred to as ROYGBIV.The fortune teller told of an _____ future, full of happiness.The inhabitants of Jonas's community are under constant _____.Agatha Christie's mysteries let us _____ who the true criminal is....

CORRECTIONS 2023-12-22

180 Items: jailmalevesttaserradiolunchfloydcourtbadgechiefdrugsscansjudgesirencrimewoundcodespoliceinmaterookiebookedlawtondinnerfisherbentonshowerreportpounitpatrolarrestbondedemailstypingfemaleintaketicketbuckleweaponmurderdangerorangesweatherbookinghousingboredommedicalofficerfifteenscanlonuniformdayroommonitorcamerascaptaintrusteekitchenrankingcustody...

2423 2024-05-23

174 Items: cambeldomposbohsrsavtpaykpibuypennewluketonysafepicokidsgolfipadbulkoddstagsrateteamsellopensealcodekeysrailagedsizeslimkevinraniafrankjamesrishiluanaanikaethanpricesportsaleslabelvoidsflooralarmbreakcovershiftstoreclosefloatsweepmusicstylerangejordanjelenaoliviahamishreturnpolicyunisextennisbudgetrosterrefundfaultylightssigninoutletreviewmarker...

Employee Appreciation Week- Who Is It? 2026-02-19

27 Items: OT, PT, SpeechDelivers babiesRegisters patientsRecruits employeesOperates on patientsSterilizes equipmentDept that draws bloodKeeps our hospital safeKeeps our hospital cleanTakes images of patientsTeaches certification coursesdelivers mail across the hospitalTransports patients around the hospitalPresident, CNO, VP of Operations, etc.,....

Economics 2025-11-21

12 Items: Tax imposed on imported goodsOrganization of South Asian countries founded in 1985Measures the responsiveness of quantity to price changesCosts of production that do not change when output changesSituation of high inflation, low growth, and high unemploymentA valuable asset that a borrower pledges as security for a loan...

Executive branch 2025-04-23

17 Items: The spread of a secretCovering of a wrongdoingHighest-ranking diplomatic officerlead staff member of an administrationWritten directive, signed by the president,Process of electing president & vice presidentResponsible for the day-to-day management of the governmentOversees the performance of federal agencies, and administers...

10 2025-08-16

17 Items: another term for sportbikeVest displaying club’s patchesa female passenger on the backBell rung to signal a ride’s startOrganizes club records and meetingsSupport attached to motorcycle seatMember responsible for club securityProtects the group from traffic hazardsSymbol representing the motorcycle clubOfficial document forming a club chapter...

commerce find a word 2024-10-17

16 Items: items of valuebest teacher in the worldvery safe and secure sharesa tax on the profit of a companya part ownership of a public companyvalue of an asset increases over timeacceptable to society’s current standardsall the investments owned by an individualplace where shares in public companies are bought and sold...

8th Grade Science Word Search 2023-05-17

23 Items: heat energyform of energy in the sunused in night vision gogglesenergy of an object in motionatom or compound with a chargesubatomic particle with no chargeused for cell phone communicationform of energy in food and batteriesform of energy resulting from motionpositively charged subatomic particlenegatively charged subatomic particle...

Paris Peace Conference 2026-05-06

22 Items: The agreement to stop fighting in 1918.The demilitarized buffer zone near France.Territory returned to France after the war.Wilson's plan for a just and lasting peace.The reduction of a nation's military forces.A nation's right to control its own affairs.The British Prime Minister at the conference.The Italian leader who wanted more territory....

Work 2026-04-16

30 Items: Time to eat!Place of workGoes up and DownUse to make callsWear to make callsWhere you eat lunchAcronym for Test LabAcronym for DivisionFlat table used for workA place to call your ownScurries around the floorSoftware to join meetingsSoftware that repeats tasksLast environment to test inNeeded to get physical accessEnvironment that the public uses...

Terminology D 2025-03-19

28 Items: a directory for Internet Protocolsa method of measuring print densityunprocessed pieces of digital informationa small circuit board containing RAM chips.collection of indexed information in a structured formatfunction that shows the date as a number in serial formatpre-selected option to assist in data entry or selection....

Media Literacy Vocabulary Detective! 2024-06-17

1 Item: internet, plagiarism, authentication, security, phishing, copyright, cyberbully, netiquette, malware, citation, upstander, credibility, encryption, firewall, blockchain

Contras Word Search 2026-05-12

8 Items: The president who had approved the sale of arms to Iran in 1986.The Mediterranean country where the kidnapping of Americans triggered the Iran-Contra scandal.The illicit cargo that was shipped through intermediaries to reach Tehran; a synonym for “arms”....

Invisibleaudience Word Search 2024-10-18

11 Items: VPNincludes our emotional, psychological, and social well-beinga hacking method that uses trial and error to crack passwordsthe pursuit of an intentional and healthy relationship with technologysecurity or authentication credentials that are used to access the Software...

Odd 2023-03-09

1 Item: ufo conspiracy ghost mesopotamia myan inca chaco tomb pyramid alien nazca hyroglyphics wow signal aerocebo stealth hypersonic ram aurora biohazard cyber code defcon enigma kgb nro fbi nsa musad misix raider infrared flir hack nvg

Accountability Word Search 2026-02-26

22 Items: Abuse of public office for private gain.Acting fairly and without political bias.Political independence of civil servants.Strong commitment to public service duties.Ability to act independently and proactively.To simplify procedures to increase efficiency.To adapt policies or services to specific needs....

Abughraib Word Search 2025-09-18

31 Items: 2007 U.S. troop increase.city of two major battles.improvised explosive device.weapons of mass destruction.U.S. armored fighting vehicle.fortified district in Baghdad.ethnic group in northern Iraq.massive 2003 bombing campaign.meal ready-to-eat field ration.U.S. general who led The Surge.Iraqi dictator deposed in 2003....

Nonfiction Memoir VST 2025-10-09

20 Items: To give a false representation ofa state that is controlled and protected by another.(of a person) not recognized as a citizen of any country.An organized, state-sponsored attack on a group of people.a person who carries out a harmful, illegal, or immoral act.To surrender often after negotiation of terms, to cease resisting...

Spanish Word Search 2025-09-12

24 Items: Person who travels on the plane.Another way to say boarding pass.A row of seats, or line of people.A journey from one place to another.Bumpy movement of a plane in the air.What security does to check your bags.The team of people who work on a plane.Suitcase you pack clothes in for a trip.The walkway between the seats on a plane....

CMS 855S 2025-10-13

45 Items: I Make TIFFSDo Not ForwardStop The ClockDate of ReceiptDoing Business AsStatement of WorkUS Postal ServiceLogging & TrackingWeb Based TrainingLegal Business NameAdverse Legal ActionBusiness Test AnalystChange of InformationCorrective Action PlanCritical Response TeamEnrollment Data ReportSocial Security NumberApplication Data Report...

Reaort 2026-02-10

213 Items: bargymriospafijipoolsafewifiarubabeachdiscodubaigrillhotubibizalobbymiamiparispatiosaunatulumvaletbikinibuffetcabanacancuncoffeecoolerdaybeddrinksdrybagfacialhawaiimexicophuketsandalsnackssunhattahitibalconybanquetbellhopbermudacarryoncheckincozumelcuracaodayclubdaypassgardensjamaicajacuzzikeycardkeywestmassageminibaropenbarpoolbarroomkeysailing...

Unit 210 2025-10-05

30 Items: Use these to access the till-The reason we have a billing system-A payment point should have spare of theseRestrict this for the security of the till-a float should have a... of notes and coins-This is for anyone who uses the payment point-Await this as the 4th stage of a card payment-more of this change is a good maintained float-...

Compliance Week Privacy Word Search Game 2022-10-24

10 Items: HIPAA _______ and security RulesWhat regulation provides protection for health data?In order to properly dispose of paper PHI you must _____ itWhat is the three-letter acronym for protected health information?What word do you put in the subject line to encrypt your confidential emails?...

Ambassador Word Search 2025-04-21

17 Items: Actionof Management and BudgetA group of presidential advisersan intentional disclosure of something secret or privatea formally concluded and ratified agreement between countriesSecurity Council a group of high-ranking government officialsthe action of forgiving or being forgiven for an error or offense...

Presentation Activity - Word Search 2026-05-06

31 Items: Fight forcesA balanced stateThe act of helpingA ripple-like effectThe study of the pastIn relation to offenseA violent, taxing fightThe opposite of EasternTogetherness in a societyRussia's "biggest friend"An extreme amount of moneyWhat people are referred toHaving a plan/course of action12 letter bonus word; brainrotThe act of turning ones back on...

Shh...Confidentiality Inside! 2025-03-03

1 Item: Breach, Caution, Compliance, Disclosure, Integrity, Misuse, Privilege, Privacy, Protection, Restricted, Security, Sensitive, Vigilance, Confidential, Secure, Private, NDA, Secrecy, Unauthorized, Personal, Prudence, Judgement

Tugas 1 TTS B.Inggris 2022-09-15

25 Items: Bill Gatesan upright pillarThe .... is lava!The base for buildingBase security or doorThe thing to put at a floorthe thing o put in a windowThe main piece for a buildinga waterflowing system for rainwatera certain place for storing vehiclesa system for flowing water in or outglue for placing material in building...

Level 2 Word Search 2025-10-15

11 Items: Key word revealed later in Challenge #3Software that securely stores all your credentials (2 words, 15 letters total)An additional layer of security beyond just a password (abbreviation, 3 letters)Minimum number of characters for Micron User account passwords (1 word, 6 letters)...

Switching and Routing Terminology 2023-03-29

34 Items: A port that allows traffic from only one VLAN.A logical grouping of computers through segmentation in a LAN.A set of computers and devices connected in one physical location.A naming system that converts human readable domain names into IP addresses.A security feature on some switches that filters out untrusted DHCP messages....

Core Values 2023-08-04

222 Items: funjoycalmworkhopeloveriskclearsensedrivefocusgracehonorlogicorderpeacepoisepowerrigorskillsmarttrusttruthunityvalorvigorbeautycandorcleverenergyfamilyfamousgeniusgivinggrowthhealthlawfulreasonspiritstatustalentvisionwealthwisdomwonderbalancebraverycapablecarefulcharitycomfortcontrolcouragedignityempathyempowerethicalfreedomharmonyhonestyjustice...

Featival 2026-02-11

219 Items: FanBandBassBeatEchoFlagGatePassTentZoneArenaBoothCrowdDanceMerchMixerMusicQueueStageVenueArtistBannerChorusDrinksEncoreEnergyGuitarLineupRhythmScreenSingerTalentTicketVendorBarAreaCheckInConcertDayPassDecibelDJBoothDrumKitDrummerFanZoneMainActMoshPitPitAreaSetListSingingSpeakerTourBusVIPAreaVIPPassAllNightAmbienceBackdropBasslineBraceletCampsite...

Between The Wars 2025-03-07

1 Item: inflation, fascism, dictatorship, genocide, Nazism, isolationism, appeasement, regime, censorship, indoctrination, liberalism, diplomacy, mandates, reparations, collective security, global interdependence, communism, league of nations, suffrage, Jazz Age,

Jake Word Search 2025-09-11

14 Items: jakeA type of malware that attaches to a program or file andThe use of digital devices to harass, threaten, or humiliate someone.Negative or unfavorable feedback from customers about a product or service.False or inaccurate information that is spread without the intent to cause harm....

WHAT I VALUE 2025-01-28

238 Items: FunJoyCalmDutyFameHopeLovePlayRestRiskDepthDriveFaithFocusLogicMeritOrderPeacePowerPrideTrustTruthUnityValorValueVigorBeautyCandorCaringChangeFamilyGrowthHealthHonourImpactPeopleGrowthSafetyHumourStatusTalentUsefulVirtueVisionWarmthWealthWisdomWonderAgilityBalanceBraveryCapableCarefulCharityComfortCourageDecencyDignityEmpathyEthicalFitnessFreedom...

∞ Official Big Mountain Word Search ∞ 2025-06-01

25 Items: How you made it back homeThe ___ Deconstruction plantThe X-2 Transmitter ___ ArrayA scientist aware of his flawsMobius' home; Forbidden to you!The honorifics of the Think TankThe leader and head voice of the DomeThe programmed fate of the Think TankA loyal companion, through and throughThe third piece removed from your body...

Banking Terminology 2026-04-28

11 Items: A bank account with no financial activityAn interest-earning deposit account that is liquidThe act of removing money from a financial accountSomething pledged as security for repayment of a loanA deficit in a bank account caused by drawing more money than the account holds...

Containformation: Word Search 2025-09-11

13 Items: A type of malware that attaches to a program or file andThe use of digital devices to harass, threaten, or humiliate someone.Negative or unfavorable feedback from customers about a product or service.False or inaccurate information that is spread without the intent to cause harm....

War, Word Search 2026-03-31

1 Item: army, soldier, military, government, department, defense, security, leader, secretary, command, officer, general, rank, operation, mission, base, equipment, strategy, battle, force, service, national, history, law, organization, training, headquarters, br

WHAT I VALUE 2025-01-28

238 Items: FunJoyCalmDutyFameHopeLovePlayRestRiskDepthDriveFaithFocusLogicMeritOrderPeacePowerPrideTrustTruthUnityValorValueVigorBeautyCandorCaringChangeFamilyGrowthHealthHonourImpactPeopleGrowthSafetyHumourStatusTalentUsefulVirtueVisionWarmthWealthWisdomWonderAgilityBalanceBraveryCapableCarefulCharityComfortCourageDecencyDignityEmpathyEthicalFitnessFreedom...

Law 2025-09-04

1 Item: Justice, Community, Law, Police, Evidence, Prosecutor, Rights, Arrest, Teamwork, Training, Trial, Defendant, Firefighter, Emergency, Warrant, Sentence, Response, Rescue, Security, Appeal, Safety, Lawyer, Dispatch, Protect, Court, Jury, FirstAid, Patrol, C

Devops, Word Search 2025-09-24

1 Item: SRE, Delivery, Continuous, Automation, Testing, Agile, Cloud, Integration, Deployment, Pipeline, Monitoring, Quality, Feedback, Collaboration, Chaos, Code, Infrastructure, Security, Release Performance, One Team, Scalability, Reliability, Bug, Feature, En

FINANCIAL SAFETY 2024-06-04

14 Items: How often you should check your credit reportA person who phones you to sell you products is known as thisThe act of stealing personal information from your credit cardYou should always do this to your documents and credit card applicationsYou can make sure no one is using your money or debit card by checking this...

March Stall Wall Word Search 2023-03-14

1 Item: acclimate, safety, security, limited areas, escort, prohibited, controlled articles, safety expo, compliance, rules, regulations, guidelines, requirements, protected areas, behavior based, brake on speeding, heart walk, heat, stress, LSIT, BBS observation

Vocab 2026-03-16

20 Items: To give a false representation offear and hatred of strangers or foreignersnot recognized as a citizen of any countrya person who moves from one place to anotherThe roll call of prisoners that could take hoursa state that is controlled and protected by anothera disease caused by rickettsia or orientia bacteria...

Adventure Word Search 2026-02-15

249 Items: BarCryGigGymJobPetRunTryBankBossBusyCafeCalmCashChatCityDebtGlowLoveRentSlowSoloTestTripWorkYogaZoomAloneBillsBonusCleanDecorDreamDriveEmailEventFocusGoalsLeaseLoansMoneySleepTaxesTrustAirbnbBrunchBudgetCareerChangeClientCoffeeCollabCreditDatingDinnerDreamsEnergyFutureGlowupGrowthHabitsHealthIncomeInvestMentorMoveInMoveOnMovingOfficeResumeSalary...

Word Search for Chapter III 2025-05-13

12 Items: A 1972 U.S.-Soviet agreement to limit missile defenses, helping reduce the arms race.Official forgiveness for a crime; President Ford gave one to Nixon after he resigned.A 1972 U.S.-Soviet deal that froze the number of nuclear weapons each side could have.Interfering with a legal investigation; Nixon was accused of this for covering up Watergate....

Application Management 2023-03-29

26 Items: You use this option to check and fix an applications files.This is the name of the application store for android devices.A program that installs applications, software, or drivers onto a system.This folder stores 64-bit files, while Program Files (x86) keeps 32-bit files....

AP Gov Review 2024-04-24

15 Items: the judicial concept when the court upholds precedentSCOTUS case that declared racial gerrymandering as unconstitutionala list of potential policy ideas, bills, or plans to improve society__________ action; institutional efforts to diversify race, gender, etcthe judicial concept when the courts strike down laws or reverse public policy...

word search 2024-09-12

7 Items: Software designed to gain unauthorized access to and disrupt or damage a computer systemMalicious software that blocks access to a phone or computer system until a sum of money is paid.Access The ability to control your device through another phone or computer it usually requires downloading some kinds of apps or software...

current events 2025-10-02

1 Item: event press television newspaper blog radio news accurate false safety national regional international terrorism release affair government federal state democracy present past social media statement situation intentional damage security border opinion fa

All About Mortgages and Escrow 2024-03-18

17 Items: FHA stands for _______This is an example of a lender.Escrow analysis are done on a ________ _______.These are the consumers looking to finance residences.Financial Protection Bureau CFPB stands for _______.,Typically the cushion will be _____ ______ of escrow paymentsthe company to whom borrowers pay their mortgage loan payments....

words stuff 2024-09-12

7 Items: software designed to gain unathorized access to and disrupt or damage a computer systemmalicios software that blocks access to a phone or computer system until a sum of money is paidaccess the ability to control your device through another phone or computer it usually requires downloading some kind of app or software...

Safeguarding Customers and the Bank 2023-10-30

26 Items: Fraud perpetrated by someone who works inside an organization.An employee who reports fraud or other wrongdoing within a company.Authentication by two or more of the following: something the user has, is, or knows.aAn area that allows computers equipped with wireless fidelity to receive internet connection....

Networks 2026-03-25

31 Items: The largest WAN accessible to the public.This is a network that covers a larger geographical area.refers to all of the devices that are connected to the internet.is a set of agreed rules that state how to format, send and receive data.A company that provides Internet access to homes, schools, and businesses....

US History Eras 2024-12-02

10 Items: 1890s to the 1920s - period of political and social reform1929-1939 - period of economic crisis and government response with New Deal programs1945-1991 - the power struggle between the Soviet Union and the United States after World War II...

BF130 Chapter 10-17 Review 2025-10-13

13 Items: an intentional misrepresentation of a material factBreaking into a building with the intent to commit a felonyA legal doctrine indicating that parties meant to do what they did.Written defamation, or defamation published over radio or televisionan artificial, intangible entity created under the authority of a state’s law....

AP LANG VOCAB 2025-09-17

27 Items: – severely critical– intervene with something– a security guard or watcher– being everywhere all of the time– something causing misery or death– to provoke or incite somebody into action– of, characteristic of, or resembling a lion– marked by doubt, uncertainty, or skepticism– to indicate something by action or implication...

Chapter 7 Econ 2025-03-13

19 Items: Market structure characterized by a single producerGroup of firms producing similar or identical productsIllegal agreement by firms to charge a uniform price for a productPhilosphy that government should not interfere with business activityReal or imagined differences between competing products in the same industry...

Banking Vocab Word Search 2 2024-12-17

15 Items: An account that you can put money into and use it any timeThe right column in a two-column chart that records business transactionsWhen an account doesn't have enough money to cover a transaction or withdrawalThe amount of money in an account at the beginning of a new accounting period:...

IL: Unit 3 Budgets SUMMATIVE Review (Independent Living, Summ. Tues. 03/11) 2025-03-09

13 Items: Money set aside for unanticipated expenses or loss of income.The main reason athletes go broke is because of __________________ debts.A cost that appears irregularly or that changes in amount (e.g., utility bills)______________________ ______________________ help athletes manage their money....

IL: Unit 3 Budgets SUMMATIVE Review 2025-03-09

13 Items: Money set aside for unanticipated expenses or loss of income.The main reason athletes go broke is because of __________________ debts.A cost that appears irregularly or that changes in amount (e.g., utility bills)______________________ ______________________ help athletes manage their money....

Networking Chapter 13 Terminology 2023-05-15

31 Items: Using more than one method to authenticate users.Updates for other Microsoft products like Office.Use this command on a linux system to create a user account.This authentication type uses the unique way you do something.Non-Microsoft driver updates that are applicable to users' devices....

Marvel Strike Force Word Search 2023-01-26

250 Items: SifBlobDraxEchoHelaHulkKorgLokiNobuNovaPyroThorToadVahlWaspWongX-23BeastBrawnCableCloakCosmoGhostGrootMagikMordoNakiaNamorOkoyeQuakeRhinoRogueSersiShuriStormSwarmVenomYo-yoYonduBishopDaggerDominoFalconGambitGamoraIcemanIkarisKarnakMantisM'BakuNebulaRescueScreamStryfeSylvieThanosUltronVisionAnt-ManCarnageCrystalCyclopsDazzlerElectroElektraHawkeye...

WWII word search 2026-04-14

25 Items: British leader of WWIIthe organized massacre of a minority grouphostility towards or discrimination against jewsthe act of not getting involved with war conflictWhen Germany, Italy, and Japan forming an allianceJune 6th 1944,the massive allied invasion of Normandythe mass retreat of 330000 allied troops to avoid defeat...

Intellectual Property and Digital Media Ethics 2026-03-02

20 Items: A notorious type of malicious software that encrypts all your files and demands a payment to unlock them.This term refers to false information spread unintentionally, without a malicious motive to deceive others.This is false information that is deliberately created and spread to deceive people or cause specific harm....

Great Depression New Deal 2023-11-07

29 Items: Tuesday - October 29, 1929- New deals most radical Program- problems for farmers after WW I- New deals most complex programs- The main impact of the CCC was to create- New Deal Programs were similar to ___ agenda- What New Deal Program protected bank deposits- Which group benefited least from the new deal?...

Getting Paid 2024-04-29

20 Items: A tax on earned and unearned income.Outlines the deductions made to wages.Agreement between an employer and employee.The regular schedule that employers pay employees.A person who relies on someone else for financial support.A check written to a worker in the amount of money earned.A fee that a salesperson receives upon completion of a sale....

Three Word Search 2025-10-10

25 Items: failure to repay a loan on timeA car loan is an example of what?How many types of credit are there?Fees keep people in a cycle of what?How many years does a mortgage loan lastan asset that increases in value over timeWhat percent of Americans have a credit card?How many categories should you have in a budget?...

Series 6 Review 2023-07-19

75 Items: accountA radio interview is a public _________Rule 147 is regarding _______ offeringsSelling group members are paid a selling ______A final prospectus is also known as a _______ prospectusThe firm in which must complete the transfer of an accountThe “A” under discretionary orders that describes buy or sell...

Banking Terminology 2025-09-04

24 Items: disbursement of fundsa bank account with no financial activitypayment into a retirement savings or pension planthe act of removing money from a financial accountan interest-earning deposit account that is liquid.something pledged as security for repayment of a loanelectronic movement of funds from one bank account to another...

Banking Terminology 2025-09-04

24 Items: Disbursement of fundsA bank account with no financial activityPayment into a retirement savings or pension planAn interest-earning deposit account that is liquidThe act of removing money from a financial accountMovement of funds from one bank account to anotherSomething pledged as security for repayment of a loan...

Appropriationbill Word Search 2026-04-02

32 Items: sales of used goodstax on imported productsannual dollar income to determine povertygross domestic product on a per person basisbranch of US treasury department collects taxeslegislation authorizing spending for certain purposesagreement to fund government agency at certain levelsgross domestic product after adjustments for inflations...

Night Weeks 1-5 Vocabulary 2024-11-19

50 Items: CARRIEDGERMAN SOLDIERSDEEPLY RELIGIOUSWEARING EYEGLASSESTHE JEWISH NEW YEARTHE SOUND OF A BELLSOMETHING BURDENSOMEA RUFFIAN OR HOODLUMA PERIOD OF TWO WEEKSHANDCUFFED OR FETTEREDANOTHER NAME FOR A PIGA FALSE SHOW OR PRETENSETHE CLUB CARRIED BY POLICESEVERE PAIN IN THE ABDOMENA PERIOD OF FORCED ISOLATIONOUTWARD ASPECT OR APPEARANCE...

9 weeks 2 test review 2023-12-07

31 Items: japan.- Factories and farms produce more goods than people can buy.Young women of the 1920s that behaved and dressed in a radical fashionNew Deal program which gave electricity and jobs to rural Appalachia, including ALGovernment programs passed by Congress to help the U.S. get out of Great Depression...

Memoir Unit - Holocaust LIt 2025-10-09

20 Items: To give a false representation ofa state that is controlled and protected by another(of a person) not recognized as a citizen of any countryAn organized, state-sponsored attack on a group of peopleA person who carries out a harmful, illegal, or immoral act.To surrender often after negotiation of terms, to cease resisting...

Astronaut Word Search 2025-08-13

50 Items: Space where data is saved.A place to organize files.Connected to the internet.Creating software using code.The display area of a device.Not connected to the internet.A copy of data kept for safety.A portable touchscreen computer.The physical parts of a computer.Software used to access websites.Online storage for files and data....

Health Information Technology for Nurses 2025-08-30

25 Items: WVCThe recipient of medical care.Relating to the direct care and treatment of patients.Raw facts and figures collected about a patient's health status.A controlled set of terms used to ensure consistency in data entry and analysis.An abbreviation for Bachelor of Science in Nursing, an academic degree for nurses....

: The Consequences of the Industrialization 2022-12-01

26 Items: The action or process of appeasing.Centralized control by an autocratic authorityTreaty that ended the first Opium War in China.A law that restricting Chinese immigration in the U.S.A law that restricted non-European immigration in Australia.A German philosopher that came up with the theory of Communism....

Death Word Search 2026-03-18

20 Items: A 2013 study found that exposure to racism can cause high blood ______ and stress.The second article argues that dismissing marginalized people's concerns about hate speech is ______.Freedom of speech is the most widely recognised of the ______ freedoms protected by the First Amendment....