chinese new year Word Searches

19th Century History 2023-03-14

18 Items: to legally voidthe right to votethe idea of withdrawing,system of underground routesexpansion of the united states in size.an individual who wanted to end slaverynative americans forced from their landsemployment based on friendship and loyaltythe way of getting territory through living or by force...

Bed Word Search 2025-11-10

17 Items: – Technical name for the nail.– Half-moon shape at base of the nail.– Area where new nail cells form and grow.folds – Skin that surrounds the nail plate.groove – Slit or furrow along the nail sides.– Dead, colorless skin attached to nail plate.edge – Nail part that extends past the fingertip.– Fibrous tissue connecting bones or holding organs....

Unit 8: Toxicity and Wastes 2024-04-25

18 Items: diseases that are caused by pathogensmostly chemical and construction wastediseases that aren't caused by pathogenschemicals are magnified through food weban increase in death rate over a large areachemicals in the body that build up overtimepathogen causes rapid increase in local death ratetype of infectious disease that is newly discovered...

Unit 8: Toxicity and Wastes 2024-04-25

18 Items: diseases that are caused by pathogensmostly chemical and construction wastediseases that aren't caused by pathogenschemicals are magnified through food weban increase in death rate over a large areachemicals in the body that build up overtimepathogen causes rapid increase in local death ratetype of infectious disease that is newly discovered...

Mouse Word Search 2026-02-06

1 Item: mole cookie bird snail mail summer winter spring fall seed frog toad lizard kite friend year letter calendar Squirrel turtle hibernate

Branding Wordsearch 2025-10-24

14 Items: funnestest class LOLtry-hard funny not so funnywonk wonk wonk classroom funnyrelationship with a distribution partnerconsumer’s commitment to continue using a brandme cant wait to go home and i bet you too classsomeone who is interested, involved and engaged in the eventpractice of using a successful brand name to launch a new or modified product...

Fry words 2023-12-11

1 Item: Over Just Sound Name Take Sentence Only Man Little Think Work New Know Back Live Years Place Sentence Just Sound Little our Name Only Think Work Over Know Place Live Man Back New Take Years

Chemistry Chapter 1 2025-11-13

14 Items: The change from gas to liquidA change that forms a new substanceAnything that has mass and occupies spaceThe process in which a liquid changes into a solidThe process in which a liquid changes into a vaporan example of a substance that undergoes sublimationThe temperature at which a solid changes into a liquid...

BBB4M Unit #1 Review 2026-03-09

18 Items: Sends goods or services to another country.Are taxes or duties put on imported products or services.Is the amount of worth that is added to a product at each stage of processing.Brings products or services into a country, for use by another business or for resale....

Social Studies 2026-02-24

23 Items: Amendment Made Slavery IllegalCommitted by a juvenile that would not be a criminal offense as an adult.Amendment Intended to give all male citizens the right to vote no matter their skin color.involves the breaking of a law set up by the government. Two types include misdemeanors and felonies....

A+Unit 8 2025-05-19

18 Items: –We can trade our toys for fun.–I like to relax by reading a book.–She is not only smart but also kind.–I will be done with my homework soon.–This cake is so delicious, I want more!–We walked one kilometer to get to the park.-We poured condensed milk on the shaved ice.–Long ago, people came to colonize new lands....

The Age of Exploration 2023-11-15

12 Items: A settlement of peole living in a new territoryA leader in the spanish conquest of the AmericasA person mixed with African and European descentThe slave trade route from Africa to the AmericasA large plot of land to grow sugar,cotton,and vanillaA person of mixed European and Native American descent...

Homeroom 204 people: It is important that you know each of your classmates by name. You will address classmates by their correct names this year. 2024-08-24

26 Items: ZOELEOLIAMJOSEKHLOEAKIRACYRUSBRIANLIBNYYIANNAMAGGIEDANIELJULIANJAYDENAUBREYELIANABENICIOCRISTELJANELLEWILLIAMJOHANNAJAYLANIVERONICAREYMUNDOADONISJESUSZYSZCZYNSKI

Boom or Bust 2025-04-02

12 Items: right to votegave women the right to votedark thick liquid commonly called oil.A sudden, extensive, or notable, disaster or event.A town undergoing rapid growth due to sudden prosperityindependent oil operators who searched for new oil fieldsAn economic principle which says that prices change when supply or demand changes...

Space 2023-03-09

14 Items: the biggest asteroid is namedhow many lightyears across is the milky waythe name of the largest volcano in our solar systemThe Hertzsprung-Russel Diagram of stars (see other)the element inside the tank that exploded the Apollo 13rounded to the nearest hour, how long is a day on jupiter...

Topic 7 Part 2 2026-02-12

14 Items: deliverance from sinto see in the best possible lighta person who wanted to end slaverythe protection of natural resourcesthe views held by people, in generalthe campaign against alcohol consumptiona person who cannot pay money he or she owespeople who have a certain concern or belief in common...

Famous places around the world 2024-07-19

12 Items: - Home to the pyramids of Giza and Sphinx.- Known for its Opera House and harbor bridge.- Famous for its canals, gondolas, and St. Mark's Square.de Janeiro - Famous for its carnival and Copacabana Beach.- Known for its ancient history, Colosseum, and Vatican City.- Known as the City of Lights and famous for the Eiffel Tower....

Revelation Word Search 2025-06-29

1 Item: Times, Kingdom, New Covenant, Abomination, Sixth Seal, Trumpets, Bowls, Theif In The Night, Bridegroom

Madagascar 2025-07-08

1 Item: marty gloria Melman penguins leemers zoo zookeepers king Julian rainforest Africa New York madagascar

1st grade spelling 2026-01-29

1 Item: nail, train, rain, tail, boat, float, coat, load, one, would, could, new, were, come

Patterns of Earth & Sky 2026-01-30

14 Items: To move around another object in spaceA dark shape made when an object blocks lightThe brightest star seen in the night sky from EarthA large, bright star found in the constellation OrionA scientist who studies stars, planets, and other objects in spaceA tool that uses the position of the Sun and a shadow to tell time...

Plant Diversity 2025-11-11

13 Items: The part of a plant that makes foodThe part of a plant that holds the seedsplant A plant that does not produce flowersplant A plant that produces flowers and seedsThe part of a plant that can grow into a new plantA tall plant with a thick, woody stem called a trunkA tiny non-flowering plant that grows in damp places...

Executive branch 2025-04-23

17 Items: The spread of a secretCovering of a wrongdoingHighest-ranking diplomatic officerlead staff member of an administrationWritten directive, signed by the president,Process of electing president & vice presidentResponsible for the day-to-day management of the governmentOversees the performance of federal agencies, and administers...

Fleet Farm Word Search! 2025-07-20

17 Items: Where we work.Each zone has one of their own.The city our store is located in.The color most associated with us.We sell these in the Garden Center.Auto has a large selection of this.We have our own brand with Eileen's.Our biggest promotional event every winter.You can get this exclusively at our C-Stores....

Technological Innovations of the 21st Century 2025-04-14

10 Items: CLEANENERGY : Energy that is produced using renewable and non-polluting sources.GENETICEDITING : The manipulation of an organism’s DNA to achieve desired traits.VIRTUALREALITY : A simulated environment that can mimic or completely alter reality.INNOVATE : To introduce new ideas, methods, or devices to improve or advance a field....

U2-1 2025-08-02

10 Items: The way that someone or something looks.To express the sense of words or text in another language.Elaborate or decorative; or, to feel a desire or liking for.To cause (someone) to believe firmly in the truth of something.A person who is in charge of a department, organization, or film....

Journals, Documentation Standards, and NOAs 2026-01-28

8 Items: The amount of time to convert notices to Large Print and Data CD.Form provided to customer after completing a telephonic signature.One of four standard options for alternate formats provided by DHCS.This is required to document all customer contacts and all case actions in CalSAWS....

Unit 4: Spelling Quiz 3 2022-12-16

30 Items: an advantagepeacefulnessunintentionalto make worseaccountabilityentirely; completelyfeelings of sympathyimpenetrable by lightat every time; foreverone of the United Statesto accept as true or realone half of a school yearthe quality of being calmright fine; satisfactory; goodone who is sent out on a missionthe principle of life; vigor; energy...

Unit 13 Word Search 2026-01-31

29 Items: a five-pointed stara shape with four sidesa shape with five sidesa shape with three sidesa period of three monthslikely to argue or fightoccurring every five yearshappening four times a yeara vehicle with three wheelsa solid shape with five facesmade in three identical copiesa musical scale with five notesan animal that walks on four legs...

Precision in Academic Vocabulary 2025-04-14

10 Items: EVALUATE : To assess the value, quality, or significance of something.SYNTHESIZE : To combine different ideas or information to form a new whole.ANALYZE : To examine something in detail to understand its structure and meaning.FORMULATE : To create or develop a clear and systematic plan, theory, or solution....

Pathways to Excellence Knowledge Word Check! 2025-01-31

10 Items: Strategy in place to address physical fatiguePromoting a Culture of Interprofessional decision makingMethod to involve direct care nurses in hiring decisionsAward received by nurses promoting a culture of staff recognitionSurvey that allows staff to provide input into wellbeing initatives...

Griffith Observatory Glossary 2023-11-14

20 Items: a fluid state of matterthe study of space & everything in itthe layer of gas that surrounds Earththe 6th element & chemical basis for lifea place for observing & studying objects in spacea pure substance containing only one type of atoma celestial body of gas that generates light & heata zone around a star where temperatures are just right...

Unit 4: Spelling Quiz 3 2023-01-04

30 Items: an advantagepeacefulnessunintentionalto make worseaccountabilityentirely; completelyfeelings of sympathyimpenetrable by lightat every time; foreverone of the United Statesto accept as true or realone half of a school yearthe quality of being calmright fine; satisfactory; goodone who is sent out on a missionthe principle of life; vigor; energy...

Sip & Search 2025-09-18

29 Items: Who is older?Bride’s Last Name?Groom’s middle name?Who is the flower girl?Who is the maid of honor?Who said I love you first?What does the Bride collect?Who was the wedding planner?Who made the bridal flowers?Bride’s favorite football team?Who played cupid for the couple?What school did the couple go to?What is the Bride’s favorite color...

Age of Discovery 2025-12-09

1 Item: Columbus, New World, exploration, slave trade, discovery, gold, plantation, old world, tobacco, disease, Magellan, columbiaexchange,

Taxes & Investing 2024-12-12

13 Items: cash or currencyimpose a tax, fee, or finetax, tax imposed on the sale of goods and servicesloan that the bond purchaser, makes to the bond issuersomething that a person or company owes, usually a sum of moneytax or duty to be paid on a particular class of imports or exportsincome taxes, levied by federal and state governments on business profits...

Taylor's Word Search 2023-11-26

1 Item: ceremony, bulldog, reveille, MIT, trumpet song, mean girls suck, new friends are awesome, gas chamber, covid,new car, Christmas, Portdawg, San Antonio, Marching, drill, sleep, ice cream, dress blues, coffee, family, I miss my phone, accomplished, proud, F

commerce find a word 2024-10-17

16 Items: items of valuebest teacher in the worldvery safe and secure sharesa tax on the profit of a companya part ownership of a public companyvalue of an asset increases over timeacceptable to society’s current standardsall the investments owned by an individualplace where shares in public companies are bought and sold...

Vocabulary Text Smart 1 Station2 2026-03-09

10 Items: BildThe white keys of old pianos were often made from ...After walking in the sun, I was so ... that water never looked so good.My little sister thinks she’s a ________ because she has 200 followers.The doctor told me to take my ________ twice a day so I can feel better.Polar bears will become ... in a couple of years: There are only a few left....

Chapter 2 - Age of Exploration - myWorld Social Studies 2023-01-26

16 Items: great harma conquerorto travel completely aroundan instrument used in navigationa person who buys and sells goodsa settlement far away from the country that rules ita group of nations or peoples ruled by a single authoritythe process of charting a course for a ship or an aircraftan organized group of people taking a journey for a purpose...

Loss Drafts Module 2023-09-21

16 Items: _____Authorizations last 24 hours.The tab you go to to open a new claimIn claim documents S stands for _____.In claim documents P stands for _____.In claim documents U stands for _____.We base the timeframe on the ______ date.We typically search for claims using the ____.Where we leave notes on the claim about the call....

Re’eh 5.0 2025-08-16

20 Items: Yeshua said, “I am the bread of _______.”This festival recalls leaving Egypt in haste.Yeshua said the bread He gives is His ______.What kind of birds are specifically forbidden?In the Shemittah year, what is to be released?This festival is also called the Feast of Weeks.What food did the fathers eat in the wilderness?...

Volleyball 2025-09-14

20 Items: A serve that lands untouched for a pointMen’s team that won the 1976 Olympic gold medalThe men’s net height in volleyball is 2.43 metersDefensive move at the net to stop an opponent’s spikeNation that dominated women’s volleyball in the 1990sCity and year where volleyball made its Olympic debutPlayer responsible for attacking the ball over the net...

Juliana 2025-04-23

11 Items: Started a group called the JesuitsWrote institutes of the Christian ReligionBurned at stake as a heretic hint (born in Bohemium)who revived the old idea of the divine right of kingsPublished a new Latin and Greek version to Nee Testament______ people were dead after wars between Catholics and Protestants...

Thin Word Search 2025-05-09

200 Items: newpieinnwaydiebayegothinbushsoakweardealmonkfacebiteplugselfcasequitmaskbellhelpsizeroofcropkillsavebombcarehangmovefearbarklovevainmazemildfroggaspfadesellmeatfearfoolsandwillglowstirtickfirsttradequeenplaceabuseshellswinggaffeslumpdancetermsgianttrainwoundbuildblamelearnsiegetwistdelayawarestriptiredsleepdeterqueueswipemanagepublicstrollnotion...

Toys 2025-05-30

25 Items: Large fluffy toys.A classic fidget toy.Where does Elmo live?First manga card game?Toy cars made since 1968Make a face on a vegetableNoughts and _______________A small doll in your kieszen.Has a new sister called Evie.A gun that shoots foam bullets.The best place to play Mario KartThis has 54 small coloured squares....

Galaxy Christmas Party 2025-12-16

74 Items: deanblockcoachcourtdrivejalenlayuppivotstealtysonassistcarterchargedeaniejaydenkainoapeytoncharliedefensedribbleinboundjabstepoffensereboundtimeoutbackdoorbaselinedeadballeurostepfadeawayhalftimehelpsideslamdunkturnoverbackboardbackcourtbreakawayfastbreakisolationperimetertravelingbasketballbouncepassdoubleteamoutletpasspointguardstrongside...

Week 8 Thursday 2023-10-06

25 Items: course of studyTo buy somethingMario's occupationWorthy of attentionwritten communicationto support with evidenceHappens at the same frequencyBelonging to a particular personFirst in the order of importancea math sentence with an equal signA number that is not a whole numbersharing an edge or boundary; touchingConvert waste into a reusable material...

Chapter 2 Review Word Search 2023-11-10

25 Items: to approveto prohibit tradeanother word for lawsHe wrote Common SenseFirst US Vice PresidentFather of the ConstitutionThe ____-fifths compromiseword for political disorder"no taxation without ________"___________ or Great CompromiseHe wrote the Declaration of IndependenceThe NJ Plan wanted these to hold the power...

Run It Back 2025-10-09

30 Items: Aka OJ.The metro.Worn by legs.Pancake maker.Cheese selector.ASH'S x ________Hola! in English.Hello! in Spanish.The capital of Spain.The opposite of walk.It's lonely at the top.A classic pancake topping._____________ to your cup!!How pancakes should be served.Bean juice that keeps you awake.Flies by when you're having fun....

Thanks Giving 2025 2025-11-19

188 Items: AteDayEatGodHamJamNapNewPieTexBakeBuckBunsCokeColdCookCornDeerDineDishFallFishFordGiftGiveHomeHugsKrisLeafLoveMealMeatOvenPansPotsSailSaltSnowTreeAaronAcornAppleBasteBeansBingoBreadCanoeCarveCiderCritzDavidEarthFeastGraceGravyLunchMacysMaizeMimziPecanQuailRoastRollsSaladSauceServeSweetTasteTastyTexasTobinTonysWorldAutumnBanditChurchCowBoyDinner...

My 2026-01-04

196 Items: CarBusBedPenBagBoxCupTeaIceSunSkyDogCatCowPigArtRunCrySadRedBigHotNewOldBadFunPearPlumLimeBikeBoatShipRoadHomeRoomDoorLampBookForkFoodRiceMilkSaltCakeSnowRainMoonStarWindLakeSandRockTreeLeafParkBirdFishGoatLionBearFrogDeerMathSongGamePlayWalkJumpSwimReadDrawMakeHelpCalmBabyNameBluePinkFastSlowColdGoodEasyHardAppleGrapeMangoPeachLemonMelonBerryTrain...

WW1 vocab 2025-02-05

28 Items: Theory of general Relativitylongest-serving U.S. presidentThird Realm" or "Third Empire"aims to revolutionise human experiencePowers Germany, Japan, and Italystaying out of the affairs of other countries.German philosopher, essayist, and cultural critic.the first nonstop solo flight across the Atlantic Ocean...

Ancient China Word Search 2025-03-26

25 Items: complete disorder and confusionthe sovereign ruler of an empirea class of people of high social ranka sequence of rulers from the same familya white vitrified translucent ceramic; chinaa Hindu or Buddhist temple or sacred buildingan official order or commission to do somethingdecorative handwriting or handwritten lettering...

language 2024-12-09

1 Item: English, Spanish, Arabic, French, Persian, German, Russian, Malay, Portuguese, Italian, Turkish, Lahnda, Tamil, Urdu, Korean, Hindi, Bengali, Japanese, Vietnamese, Telugu, and Marathi. Chances are you speak at least one of these languages fluently.

x 2023-02-03

191 Items: menasddsmmomdadsonhugpopseesawyouonetwokinnewoldfunaceawekeylabpepskyvexwaywhywhowrytoyslyspyorbactadohexeastwestalpsmaleboysadhdpureshutmemegoodfineauntcarenicekindloveaxispingpeekpokefeelfeltfaceseekwisegemsgoalminemindmorejustkindsingplaygamebossusedfreefunkheadopenwhennorthsouthbraingirlswomenloyaleagertruthplainquickshortreadyalertrulesblush...

Thin Word Search 2025-05-09

200 Items: newpieinnwaydiebayegothinbushsoakweardealmonkfacebiteplugselfcasequitmaskbellhelpsizeroofcropkillsavebombcarehangmovefearbarklovevainmazemildfroggaspfadesellmeatfearfoolsandwillglowstirtickfirsttradequeenplaceabuseshellswinggaffeslumpdancetermsgianttrainwoundbuildblamelearnsiegetwistdelayawarestriptiredsleepdeterqueueswipemanagepublicstrollnotion...

Assist Word Search 2025-12-16

74 Items: DEANBLOCKCOACHCOURTDRIVEJALENLAYUPPIVOTSTEALTYSONASSISTCARTERCHARGEDEANIEJAYDENKAINOAPEYTONCHARLIEDEFENSEDRIBBLEINBOUNDJABSTEPOFFENSEREBOUNDTIMEOUTBACKDOORBASELINEDEADBALLEUROSTEPFADEAWAYHALFTIMEHELPSIDESLAMDUNKTURNOVERBACKBOARDBACKCOURTBREAKAWAYFASTBREAKISOLATIONPERIMETERTRAVELINGBASKETBALLBOUNCEPASSDOUBLETEAMOUTLETPASSPOINTGUARDSTRONGSIDE...

Mesopotamia / Egypt 2026-01-14

1 Item: Greece pharaoh aqueducts Hindu-Arabic number system Polytheistic Athena India Roman Empire Caucasus Mountains Israelites Silk Road China/Chinese Kingdom of Israel Southern Kingdom/Judah Colosseum Mediterranean Sea Tigris River emperor Mesopotamia Tribes o

Unit 2 2025-12-23

51 Items: (n) a thingvery or a lotliving, not deadbut, even thougha trip in a planefind something newwhat you talk aboutno sound; very quietbefore; up to a timethe planet we live onsomething that happensasleep to start sleepingbeing safe, not in dangerhappening now, right awaylike to seem like somethingwhen two people get married(somebody) know tell someone...

Women of UPS (March, 2023) 2023-02-24

13 Items: EVP & Chief Corporate Affairs and Sustainability OfficerFirst woman package car driver, beginning in 1943, Los AngelesBoard of Director - President and CEO of Lumen Technologies, Inc.UPS’s first woman pilot, joining the newly founded airline in 1988Board of Director - Group President, Pfizer Biopharmaceuticals Group...

[Autumn] September 23, 2025 [Vocab Worksheet] 2025-09-23

30 Items: Bonus sectionUnder a spell; magical.Dark, shadowy, or obscureFear of the number thirteen.A ghost or haunting presence.A form of literary expression.Strange, mysterious, unsettling.An illusion or ghostlike figure.To enchant or cast a spell over.Mysterious or hidden in meaning.Horrifyingly shocking or dreadful.An unexpected or ghostly appearance....

New Year's Resolutions 2023-12-14

1 Item: Auld Lang Syne, Smash plates, Dress in Dots, Lucky grapes, Wear white, open doors and windows, carry empty suitcase, burn scarecrow, polar bear plunge, make some noise, fireworks, drop whipped cream, Times Square ball drop, light sparklers, midnight kiss,

TS2 Training Day 3 2022-10-25

12 Items: Credit limit less than $5kThis status does not effect card usageWhat screen would you use to cancel a card requestWhat is the screen name to maintain account hold codesWhat type of card has a credit limit of $5k or greaterWhat screen would you use to request a replacement cardWhat is the screen name to maintain account processing type indicator...

Country Capitals 2025-04-20

192 Items: BakuSuvaRomeRigaCityMaleCityOsloLimaDohaApiaTownJubaBernDiliLoméKyivVilaKabulDhakaMinskLaPazSofiaPraiaQuitoCairoParisAccraDelhiTokyoAmmanVaduzRabatAbujaDakarSeoulTunisHanoiTiranaLuandaViennaNassauManamaGitegaOttawaBanguiBogotáMoroniZagrebHavanaPragueRoseauMalaboAsmaraBanjulBerlinAthensBissauTehranDublinBeirutMaseruBamakoMajuroMonacoMaputoNiamey...

BSFDE S 70 2025-11-12

20 Items: A global streaming company exampleAdapting a product to fit a local marketA company that operates in multiple countriesThe main technological driver of globalizationA major benefit of globalization for consumersA positive impact of globalization on educationtrade Global business cooperation between regions...

Search N' FInd 2026-01-13

12 Items: Quality of being trusted or believableAn argument that supports the opposing viewpointDetails from texts that are specific and observableThe struggle between two opposing forces in a story.the spoken conversation between characters in a story or playA sudden realization or insight that offers a new perspective...

Latin 10-12 Review 2025-04-14

61 Items: wenogodyouournewyesgiftfirenamecavelikealsohorseflameenemyangernightqueenstormcrueltheredangerforestto sendto moveto killto showso greatto buildto fightsuddenlytogetherright handto consumeto destroygrief, painyour, yoursyour, yoursto do, makeimmediatelykeen, fierceand not, norbrave, strongto put, placeto desire, wantfortunate, happy...

The Great Depression 2025-01-10

22 Items: (CCC) gave unemployed people unskilled jobs.Successful in material terms; flourishing financially.The condition of having paid work; a job or profession.act gave drastic new powers to labor unions, causing another economic collapse.40,000 World War I veterans who marched to Washington DC for money promised to them....

words 2024-05-06

1 Item: pupil morning afternoon desk chair eleven twelve please window bird present know new kite help again

Patriot Day Word Search 2025-09-10

30 Items: Which building was taller?(2 words)The 9/11 Memorial has _____ memorial pools.September 11 is known as a Day of _________.The 9/11 Memorial pools are ____ _____ deep.The name of the location struck on 9/11.(3 words)The city where the one non-military plane flew to on 9/11.The length of time the fires at Ground Zero burned.(2 words)...

TC Jan Review Word Search 2026-01-28

12 Items: TC's new scheduling tech (2 words)Should be rounding during the shift (2 words)Beginning Feb 22 TC will begin staffing a (2 words)only urgency verbiage still used by TC and ASL (1 word)ASL will no longer be completing these to SLC (3 words)Staff use this to mark themselves off on TC updates (1 word)...

Waybill Word Search 2023-01-18

19 Items: Storage/Flip questionsInvoice sent to customerCompany goods are sent toUser ID & password issuesAble to perform all functionsDerived from the customer’s BOLCompany that sends goods by railTerms which indicate when payment is duePays authorized invoices and print invoicesFor any invoices that are scheduled to pay to AOW....

Sacred Scripture 2025-08-22

19 Items: – Trust and belief in God.– A follower or student of Jesus.– Being saved from sin through Jesus.– Following God’s will and commands faithfully.– God making Himself and His truth known to humanity.– Beliefs and practices passed down through the Church.– Compassion and kindness shown, even when not deserved....

Ramadan 2026-02-10

27 Items: The pre-dawn meal eaten before the fast begins for the day.Voluntary acts of charity and kindness done to help others.The new crescent moon that marks the beginning and end of the month.The Arabic word for fasting, which is one of the Five Pillars of Islam.The meal eaten at sunset to break the fast, often started by eating dates....

Truthinsavingsact Word Search 2023-11-30

15 Items: People before _______.Be an effective _______.You should not be eating or ______ gum while assisting customersAnyone entering the bank is either a customer or a _________ customer.Annual Percentage Yield should always be expressed to ____ decimal placesA percentage rate reflecting the total amount of interest paid on an account....

Unit 8 word search 2024-11-07

19 Items: Think of Maui, the demi-god lolAn android is like a human in its...If something is legible, you can ... it.To adapt is to ... into a new environment.People often ... if miracles can really happen.Doing a vocal exercise helps to exercise your...If you get a question correct, then you got it...Metaphors can often ... the meaning of a sentence....

Holidays Around the USA 2023-12-08

15 Items: A cookie made with molasses and ginger.A festive song or hymn sung at Christmas.A Spanish phrase meaning “Happy Christmas.”A grouchy spoilsport who doesn’t enjoy Christmas.A nine-branched candelabrum used during Hanukkah.A small, decorative sphere hung from a Christmas tree.A candle holder for the seven candles lit during Kwanzaa....

Chapter 18 to 21 2024-09-26

12 Items: Who is the founder of Liga FilipinaTo whom did Rizal dedicate El FilibusterismoThe place he described as an ideal setting for romanceNumber of years it took Rizal to finish El FilibusterismoWhere was Rizal busy writing his second novel, El FilibusterismoWhere did Rizal lost a locket that contains Leonor Rivera's image...

Year 3 wordsearch 2023-04-27

1 Item: photographer musician beautiful shells purple lifeguard dentists volleyball summer armchair bookcase windsurfing gymnastics crisps flour omelette noodles cheeseburger museum

YEAR 6 HOMEWORK 2025-03-25

1 Item: opportunity weather microscale survive module experienced sequence absence adequate compulsory documentary impact stationary dispatch switch pressure rigours

Rosa/Ruby Bridges Vocabulary 2024-02-09

12 Items: I _______ my seat at the concert.Ms. Sampson painted the room in ______ colors.The cat thought he was ______ to another treat.The students _____ out the words in this word search.The goalie had to ________ where the ball was going to go.Frederick Douglass was an ______, he fought to end slavery....

Geoscience Processes 2025-06-11

8 Items: soil and rock, are worn awaygiant waves caused by earthquakes or volcanic eruptions under the seasudden ground shaking caused by movement along faults in the Earth's crusta natural phenomenon or a series of events that occur within the Earth's systems...

Chapter 25 Vocabulary 2025-01-28

15 Items: native to a regionnot mapped; unknownto take advantage ofthe established customs of a peoplea property of land usually with a large housethe extension of a nation’s power over other landsa governor who ruled as a representative of a monarchto send a product or service for sale to another country...

Our Universe 2024-12-13

18 Items: Where Nuclear Fusion beginsWhere stars are first formedWhat galaxies are classified by90% of all stars are in this stageAt the top middle/right of an HR DiagramOval shaped galaxy with mostly old starsExtremely bright explosion of a high mass starThe absolute last stage of an average mass starUnit of measurement for long distances in space...

Groundhog 2026-01-17

7 Items: A last name no one would wish upon anyoneGrace's role in New York City Ballet's production of The NutcrackerMay you have a hint of spring in your step on this most under-celebrated holiday.The witty Cole Porter musical we are all looking forward to watching Lydia co-star in this March...

Module1: Introduction to pathology/Skeletal system 2023-12-20

18 Items: The primary site of ossificationThe most common form of arthritisA generalized decrease in cell sizeA generalized increase in cell sizeHaving more than one illness at the same timeAn abnormal change occurring in mature cells.The forward slippage of one vertebra on anotherA specific cancellous bone located in the skull...

Year 2 words 2024-09-11

1 Item: again, any, bath, beautiful, because, behind, both, break, busy

Year 5 Spellings 2025-06-27

1 Item: appreciate, attached, available, average, awkward, bargain, bruise, category, cemetery, vegetable, vehicle, yacht, accommodate, accompany, according, achieve, aggressive, amateur, ancient

All things Cases 2024-05-15

10 Items: Secondary case reason and where quotes are createdSecondary case reason and where ESS proposals are createdResolution used if you created 3 new print listings in KGENThis primary and secondary case reason should rarely ever be usedThis field should have the issue, CUID Business Name and initials...

The Universe 2025-05-01

10 Items: A baby starThe path an object takes as it moves around another object.A big group of stars, gas, and dust held together by gravity.A cloud of gas and dust in space where new stars can be born.A change in light that shows an object in space is moving away from us.A tool that helps us see faraway objects in space by making them look bigger....

4B 0512 2023-05-11

15 Items: Cycling to school is __________ than walking.A wonderful activity we can do on _______ days is flying kites.Krista has lots of _______ ideas so we want her to be on our team.It is always necessary to wear a _______ when you ride a motorcycle.Bruce Willis is a famous _________. He has starred in many action movies....

wordsearch 2025-06-14

1 Item: sweet, real, true, kind, safe, warm, new, calm, wild, deep, bold, pure, hot, full, soft, free, cool, easy, rich, open, strong, whole, big, good, fast, slow, close, close, sure, rare,fun, sweet, real, true, kind, safe, warm, new, calm, wild, deep, bold, pu

Neuron Word Search 2025-09-17

14 Items: Basic nerve cell that transmits electrical and chemical signals.A neurotransmitter linked to reward, motivation, and movement control.Fatty insulating sheath around some axons that speeds neural conduction.— A neurotransmitter involved in muscle activation, attention, and memory....

City Word Search 2025-04-14

1 Item: Year provides service, volunteering, community, education, youth, schools, support, mentoring, tutoring, development, skills, experience, growth, impact, opportunities, leadership, teamwork, communication, collaboration, students, learning, engagement, Am

Review activity - vocabulary 2025-05-26

18 Items: Not used a lot or enoughA set of ideas you have about someoneSomething you own that has value if soldTo move money from one account to anotherControlling someone to your own advantageSomething that can make you a lot of moneyLearn about the writers, novels and poetryI need to ____ some cash from the the ATM....

Earth and Space Science 2023-03-20

16 Items: a medium-sized star in our solar systemTrue or False-The sun orbits the Earth.the way in which the Earth slants on its axisThis planet is made of gas and has a very long orbit.Earth’s closest star and the center of our Solar SystemThe 4 planets that have long orbits and are made of mostly gas...

Word Search - 2nd Game 2025-04-10

24 Items: Famous rice dish with chickenMost popular bun in BreadtalkA popular savory fried dough snackA small, steamed bun with a filling-BaoSoft and tender grilled skewers of meatSweet, chewy dessert made from glutinous riceMinced meat and dough and being fried afterwards.A thick rice porridge served with different toppings...

PhT 100 Word Search 1 (Spring 2024) 2024-05-09

17 Items: To grind to a smooth substance with moisture.The basic unit of weight in the apothecary system.The dating of any medication that has a short shelf life.The liquid in which another substance is being dissolved.The determination of the covererage an insured is entitled.Complete destruction of organisms after they leave the body....

China and India Vocabulary Word Search 2024-10-11

26 Items: upper or ruling classTo make certain that something happens or is the case.To keep in existence or continue a practice, system, or structure over time.The exclusive control of a commodity or service in a particular market, preventing competition.Related to war or the military, often used to describe skills, training, or laws governing armed forces....