chinese new year Word Searches

NMSI World Environment Day 2024 2024-05-09

10 Items: The process by which fertile land becomes desert.This country is aiming to plant 20 million trees annually.These events are responsible for 60% of worldwide crop loss.The multi-national body who have led world environment day since 1974.Soil fertility has reduced by 60% due to land degradation in this country....

madison 2023-01-25

2 Items: new cast motorcycle overseas quick-witted stomacheache bulletin boarduproar home run headache top-secret teammate wheelchair light bulb well-know throughout life preserver barefoot part-time warehouse overboard post office outspoken up-to-date

January 20, 2026 2026-01-20

11 Items: Ratiothe opposite of creditsa polygon with four angles and four sides.quarters of a plane divided by an x and y axisplane shapes having three or more straight sides.a fraction expressed as a number out of 100 followed by the % symbol.of the Base the surface area of the bottom (or top) face of a 3D shape....

Main types of ecosystems in Mexico with their local characteristics and examples 2025-11-10

10 Items: Low jungles of the Pacific coast (Chiapas, Oaxaca, Jalisco).Mesoamerican Reef (Mexican Caribbean); Veracruz Reef (Gulf of Mexico).Sonoran Desert (Son. /Baja Cal.); Matorral del Valle de Tehuacán (Puebla).lentic bodies; they connect diverse ecosystems, crucial for nutrient cycles....

January 20, 2026 2026-01-20

10 Items: the opposite of creditsa polygon with four angles and four sides.quarters of a plane divided by an x and y axisplane shapes having three or more straight sides.the surface area of the bottom (or top) face of a 3D shape.a fraction expressed as a number out of 100 followed by the % symbol....

LFW- HR POLICY WORD SEARCH 2023-05-18

10 Items: one of the value of LFWExpenses expenses that cannot be reimbursedMandatory three month every new hire has to serveWhat needs to be checked for accurate paid days dataMonth Tenure of notice period an employee has to serveOff leave that has to be utilised within 1 month’s spanMinimum no. of hours an employee has to give to call it a half day...

Your name's fine. Just your name. (Audrey) 2025-04-23

10 Items: The pilgrims were a specific group of?Who published the new testament in Greek?Who was from what is now the Czech Republic?What war ended with the signing of Westphalia?Who called for reform just to divorce his wife?Who was from England and translated the Bible into English?...

Love and Relationships 2025-02-13

15 Items: ‘Porphyria ____ me’ – Porphyria’s Lover‘The ____ had given their all’ – Winter Swans‘They ____ to me from the other bank’ – Eden Rock‘Nothing in the world is ____’ – Love’s Philosophy‘More like a ____ little fay’ – The Farmer’s Bride‘Pale grew thy cheek and ____’ – When We Two Parted‘And breathe within thy ____ a new air’ – Sonnet 29...

WHI.1 Vocabulary Practice 2025-05-24

15 Items: more than necessary ________________________way of life of a society _____________________skilled craftspeople __________________________also known as the New Stone Age ______________________________also known as the Old Stone Age ______________________________way of life characterized by little movement _______________________________...

Voca 4000 Lesson 11 & 12 Review 2025-10-20

15 Items: to go away (le***)to take place; occur (ha****)a problem or trouble (mat***)having little strength or power (we**)a community of people as a whole (pub***)to come to or reach a certain place (arr***)as much or as many as needed or required (en****)all the members of a community or group (soc****)the ability to manage someone or something (co****)...

Final Review 2025-12-17

17 Items: Variations of a trait.A part of a nucleotide.The site of translation.A change in the DNA sequence.Having two different alleles.Made by a chain of amino acidsType of cells produced by meiosis.The process of new species forming.A group of the same species in an area.When the last member of a species dies.A structure that no longer has a function....

WHI.1 Vocabulary Practice 2025-05-25

15 Items: more than necessary ___________________skilled craftspeople __________________way of life of a society ____________________also known as the New Stone Age ____________________also known as the Old Stone Age _________________________way of life characterized by little movement _________________...

NMSI World Environment Day 2024 2024-06-04

10 Items: The process by which fertile land becomes desert.This country is aiming to plant 20 million trees annually.These events are responsible for 60% of worldwide crop loss.The multi-national body who have led world environment day since 1974.Soil fertility has reduced by 60% due to land degradation in this country....

July word seach 2023-07-05

13 Items: Name of the L&D newsletterPresident of ICAST (Last name)ICAST was founded in this stateYou might get some great "cooking" tips watching herThe Learning Management System (LMS) we use - called ___1Selected ICAST as the multifamily program implementer in DCOnly ICAST employee in New Jersey (First name) as of 6/30/23...

Mohican People Unit 3 Word Search 2024-10-25

10 Items: Introduced to the Americas by EuropeansDisease that killed many Mohicans brought by EuropeansRiver where the Mohicans originally lived to the west ofCreated after Henry Hudson arrived in the Mohican CommunityWhere the Mohicans moved after conflicts in the early 1700sWho declared the land where the Mohicans lived by "right of discovery"...

Environmental Policy and Global Challenges 2025-04-14

10 Items: Emissions : The release of harmful gases or pollutants into the atmosphere.Sustainability : Meeting present needs without compromising future generations.Ecosystem : A community of living organisms interacting with their environment.Conservation : The protection and preservation of natural resources and ecosystems....

Cotton 2025-10-18

10 Items: The process of crossing threads to make fabric.A large farm where cotton and other crops are grown.Twisting cotton fibers together to make yarn or thread.The time when farmers collect ripe cotton from the fields.A fabric or cloth made by weaving or knitting cotton fibers.The cleaned cotton fibers that are ready to be spun into thread....

Angel Word Search 2024-05-08

1 Item: peace, God, romance, proposal, Bible, Jesus, engagement, abundance, freedom, health, dating, enlightenment, growth, dating, create, new, courage, faith, opportunities, second chance, new job, healing, faith, moving, building, entrepreneur, school, lessons

Angel Word Search 2024-05-08

1 Item: peace, God, romance, proposal, Bible, Jesus, engagement, abundance, freedom, health, dating, enlightenment, growth, dating, create, new, courage, faith, opportunities, second chance, new job, healing, faith, moving, building, entrepreneur, school, lessons

Week 12 2023-05-17

15 Items: Another word for _________________ is new.I would love a ______________ pokemon doll!He _______________ the cookies for the party.Crabs and lobsters are ______________________.Their form of ____________________ is dancing.A cat in a tree writes _______________ for me.The water was too ______________ so I got sick....

Unit 7 Vocabulary 2026-02-19

15 Items: Same structures used in different waysFertilized egg/early developing organismWhen a species is no longer present on earthStudy of early stages of development in embryosDifferent structures used for similar functionsNewly adapted/evolved traits used on a cladogramTwo closely related species evolve together over time...

Plate Tectonics Vocabulary 2026-01-07

17 Items: Plates move apartThe outmost layer of the EarthPlates collide or smash togetherThe innermost layer of the EarthPlates side-slip past each otherThe third outmost layer of the EarthThe second outmost layer of the EarthThe longest chain of underwater mountainsWaves that spread through Earth's interiorThe downward movement of a plate into the mantle...

Life Cycles 2025-11-11

11 Items: The adult bird that lays eggsA young plant that has just started to growThe larva stage of a butterfly that eats leavesThe first stage in the life cycle of many animalsThe stage when a caterpillar changes inside a cocoonThe young stage of a chicken that hatches from an eggThe adult amphibian that can live on land and in water...

A Job Defined: Fashion Buyer 2026-02-23

11 Items: knowledge of a productentering of data into a systemproducts being sold at a particular storebusiness which sells a particular type of productamount of money allowed to spend at a particular timeamount of products and merchandise on-hand at any given timename on a product to help it stand out against the competition...

Encuentra las palabras 2025-08-08

1 Item: steeet Food, cheese, bacon, Wings, sabor paralelo, New York, caprichosa, cariñosa

Angel Word Search 2024-05-08

1 Item: peace, God, romance, proposal, Bible, Jesus, engagement, abundance, freedom, health, dating, enlightenment, growth, dating, create, new, courage, faith, opportunities, second chance, new job, healing, faith, moving, building, entrepreneur, school, lessons

Vowel Team Digraph 2025-04-15

1 Item: clue, crew, fruit, glue, juice, new, threw, true, hue, blew, suit

The Vanderbeeker's of 141st Street 2025-10-01

1 Item: tree, brownstone, Oliver, Hyacinth, Laney, Jessie, Issa, Biederman, Vanderbeeker, New York

08 2025-08-16

15 Items: a footresta footrest for the riderThe part where the rider sitsSmall footrests for the rider or passengerA device for slowing or stopping a motorcycleFootrests mounted on the bike frame for supportA backrest bar for passenger comfort and supporta term used for the first ride of the new seasonFoot controls used to operate brakes or gear shifts...

Lilo 1 2025-11-17

14 Items: – Unable to be destroyed or damaged.– Likely to cause harm, injury, or damage.– Caught or arrested by authorities; captured.– An extremely cruel, violent, or shocking act.– Impossible to stop or prevent from continuing.– Not allowed by law; against the rules or regulations.– A statement or situation indicating the possibility of harm or danger....

Plate Tectonics Wordsearch 2023-02-15

14 Items: The outer layer of the EarthWhen one plate slips below anotherThis continents are in constant ___When this rises and cools, it creates new crustWhen plates push up, it creates this kind of landformType of heat transfer that causes tectonic plates to moveLast name of the scientist who proposed continental drift...

Organometallic Chemistry Word Search 2023-11-09

11 Items: Precursor to dihalocarbeneTransition metal found in Grubbs' catalystGas byproduct in Grubbs' olefin metathesisTransition metal used in both Heck & SuzukiReactive intermediate in which C has a lone pair, but open octetTransfer of an R group from a main group metal to a transition metal...

ASTRONAUTS 2024-02-08

13 Items: Soviet cosmonaut and the first woman to travel into space.First person to walk on the Moon during the Apollo 11 mission.American astronaut and the first person to fly in space twice.Soviet cosmonaut who became the first person to conduct a spacewalk.American astronaut known for the "Wright brothers" moment on the Moon....

Sustainability 2024-10-09

12 Items: The variety of all living species on the planetMass destruction of forests, often for agricultureKind of energy obtained from the heat inside the earthThe process of reusing waste as raw material for new productsThe ability to do work, often obtained from renewable sourcesThe presence of harmful substances in the air, water, or soil...

Abraham, Lot and Hagar--Genesis 13 and 16 2026-02-21

12 Items: Command given to Hagar regarding her mistress (16:9)Abram's wife who dealt harshly with her servant (16:8)What broke out between Abram’s and Lot’s herders (13:8)Promise made to Hagar regarding her descendants (16:10)The well-watered region Lot chose for himself (13:10,12)The direction Lot traveled to reach his new home (13:10)...

Spelling Test 3 2022-09-23

28 Items: against slaveryhostile; unkindunfit to be eatenthe act of going awayto repeat or say againone who is not a memberbefore recorded historythat which is not nuclearoccurring twice in a yearto stop or prevent an actionapart from one's choice or willto go do, come down, fall, or sinkof the highest degree or importanceextending across the Atlantic Ocean...

Olivia Word Search 2024-03-12

201 Items: trewinwonshugyanitoshwifewildwoolwordyardyearelseheldideasuitsurewearyelltylershaneahmadcarolshanaarifapryorgracejavonjamesjasonjudahjonahwomanworldwouldwritewrongboardbuildbuiltenjoyfieldfifthgroupheavyknownlaughninthoceanprizequiteradioraisescaresincethrewtiredtriedtrulyuntilvisitwe’llwholewhosewomenwroteyoungamongpieceoliviatakeyabryantfadyaa...

6th Grade Final Review 2025-12-12

33 Items: stored energyball on a hillenergy in motionhow energy movesall living thingsstored in nucleusall water on earthcauses earthquakesheating of objectsability to do workspring or rubberbandcurrents in a circuitwaves, voice, speakercar, skateboard, walkingcauses seafloor spreadingpush or pull of an objectprocess of changing position...

CHOO CHOO! 2025-11-06

88 Items: BHRLRKFLGMRCTUSBFDEMYFNORICSKNDENGRABERNLCWASWILLAKPAKJSPSAVCRNOSCSPTCHIPLOSPIINDWTINEWTOPAKYNOLBOSRTEWORBALBWIALIBRKDETPNTARBMSPWINSTLSEDJANWFHBNCGROFAYSSMSOPFARDVLHASHLDCLAMETNWKTRERATRNOALBBFXNYPYNYSKYCLETOLADMASTPDXSLMHARPHLPGHPVDSPBMEMELPHOSDALPROALXLYHKELALD

Job thingy longer 2025-11-14

171 Items: aIoftoinisitheonasweanifdonoatbeorbyupsomygometheandyouforwasarenotbutallcanhashertwohimseeitsgethisonehadhowoutshewhonowdidwayusemaynewourmantooanydaywhyputoffoldthatwhatwerewhenyoursaidintomoreliketimemakethanbeenlongveryjustmostknowbackmuchalsocamecomeworkwordmustdoespartevenwellwiththeythisfromhavewilleachthemthenmanysomemadeoverdownonlyfind...

Month of November 2025-11-22

20 Items: Name of brideName of groomNew last nameDavid's favorite animeWho crashed the wedding?Who is your ARC Raiders duo?What property did we stay on?What is your current favorite game?What holiday were you given this on?What is broken bone 1? (Starts with C)What is broken bone 2? (Starts with M)"BLANK" by the sea (Fill in the blank)...

Industrial Revolution Word Search 2026-01-21

24 Items: Steel-making processCo-creator of communismBlack rock used for fuelModernized the steam engineFather of modern capitalismUses steam to power machinesCreator of the Spinning JennyAcute contagious viral diseaseBuilding where goods are producedTurns cotton to threat super efficientlyStimulates immunity to a certain disease...

SS Word Search 2026-02-24

21 Items: Against slaveryForbid Settlement WestRemoving One's Right To VoteCoined The Phrase,"New South"Caused by disputes over SlaveryReplublican Abraham Lincoln WonFighting Over Ohio River ValleyReliied on slavery for economicsPeopleAllowed Black People Voting RightsBelieved In Economic Independence For BlacksA Murder Case Resulting In The Death Penalty...

Alpha Word Search 2026-03-12

178 Items: PCSSEAFLYNEWREDECHOGOLFKILOLIMAMIKEPAPAXRAYZULUCAMOGEARSHIPTECHBASEBLUECAREHOMEKIDSARMYCREWHEROALPHABRAVODELTAHOTELINDIAOSCARROMEOTANGOWHISKASVABBOOTSCODESDRILLDRONEEAGLEHONORPLANESERVEVALORAPRILAWAREBLOOMGREENHEARTPRIDEROOTSUNITYWORLDCADETCADRECHIEFCORPSFLEETMAJORJULIETQUEBECSIERRAVICTORYANKEEATEASEDEFENDDOGTAGHELMETMENTALMORALSSALUTEUNIQUEHANGAR...

Heather's Mortgage Word Search 2022-10-27

20 Items: Fannie MaeFreddie MacWhat is a 1003To buy real propertyThe number of days the lock is effectiveproperty secured to the repayment of the loanThe numeric value issued by the credit bureauFee paid to an appraiser for preparing an reportThe annual cost or fee associated with a serviceThe first individual listed on a loan application...

Giant Wordsearch 2025-02-27

200 Items: FrogFuzzHiveJazzJerkKneeLavaLimeOatsPinkPunkQuipRiffYawnYearYolkZealZeroZestZoneBakedBlitzBrakeBrushCometDeferEerieFaintFrontGatorGrindHobbyKhakiKnackLadleLyricMoodyNinjaNoiseOnionOrganPestoPrizeQuarkSwampTackyThinkThymeTropeVinylWaterYachtYeastAmountBirdieCaringCheesyCicadaDriverEnigmaEraserExhaleFiddleFrenzyGiggleGildedHeraldHiccupHooplaJumble...

7th Grade Final Review 2025-12-16

34 Items: stored energyball on a hillenergy in motionall living thingsstored in nucleusall water on earthcauses earthquakesability to do workheating of objectsspring or rubber bandcurrents in a circuitwaves, voice, speakercauses seafloor spreadingpush or pull of an objectcar, skateboard, airplaneheat transfer through wavesfossil fuels, food, battery...

2423 2024-05-23

174 Items: cambeldomposbohsrsavtpaykpibuypennewluketonysafepicokidsgolfipadbulkoddstagsrateteamsellopensealcodekeysrailagedsizeslimkevinraniafrankjamesrishiluanaanikaethanpricesportsaleslabelvoidsflooralarmbreakcovershiftstoreclosefloatsweepmusicstylerangejordanjelenaoliviahamishreturnpolicyunisextennisbudgetrosterrefundfaultylightssigninoutletreviewmarker...

Hospital Pharmacy Week 2025 2025-10-06

22 Items: Tum,ta tum, tum tumsGeneric name for Prozac.The opposite of formularybrand name of acetaminophenHumulin R is a kind of____?Our Newest automation/robot.common weight loss injectiondifferent brand name for ozempicGives you a jolt- right to the heart.AKA Easybake oven, stuff of nightmares.Tech with most seniority at the Valley....

Team Logistics and Knowledge Check 2025-11-11

20 Items: the “R” of VARKleading the preceptor bucketfirst step in the ADDIE processlearning the orientation bucketleading the “just in time” bucketlevels used for learning evaluationleading “back to basics” and ACLS/BLScreator of experiential learning theoryjumping into EDR with approach expertiseverbs used when writing learning objectives...

Black History Month Word Search 2026-03-02

20 Items: Invented the gas maskAn activist and film makerFirst African-American airmenSaid the speech "I have a dream"First person to use a synthesizerCalculated the path for Apollo 11Wrote her first poem at 14 years oldMade the Chicago Defender news paperSecond black women hired by Naval BaseFirst African-American Secretary of State...

Earth and Space 2025-03-13

21 Items: The red planetThe Jewel of the SkyThe planet we live onTo light something upThis planet is a dwarf planetThis means the moon is growingWhat we see in the sky at nightThis means the moon is shrinkingA group of stars creating a shapeThis planet is closest to the SunThis planet has a tilt of 90 degreesThis planet is furthest from the sun...

Global Convergence 2026-03-09

30 Items: propertydestroyednot movingvery profitableextremely dangerousextremely dangerousgold and silver barspeople born in Spainscience of map-makingability to fight diseasesbuilding things with wooda revolt on a sailing shipan open free-market economypirates supported by a countrySpanish explorers and conquerorstravel completely around something...

Geography Unit Word Search 2026-01-13

22 Items: Which Great Lake is the warmest and shallowest of the five?Which Great Lake is the largest freshwater lake by surface area?Which major river flows from Minnesota south to the Gulf of Mexico?Which river flows through Virginia and empties into the Chesapeake Bay?Which mountain range runs from Canada to New Mexico in the western United States?...

Invasive Species Word Search 2025-11-24

16 Items: To shake quickly back and forth.So scary or gross it makes you shiver.To watch or check carefully over time.Needs to be done right away, no waiting!A person you work with or do projects with.An animal that hunts and eats other animals.Very mean or likely to hurt someone or something.To stop something from happening before it starts....

Family Finds 2024-03-12

201 Items: trewinwonshugyanitoshwifewildwoolwordyardyearelseheldideasuitsurewearyelltylershaneahmadcarolshanaarifapryorgracejavonjamesjasonjudahjonahwomanworldwouldwritewrongboardbuildbuiltenjoyfieldfifthgroupheavyknownlaughninthoceanprizequiteradioraisescaresincethrewtiredtriedtrulyuntilvisitwe’llwholewhosewomenwroteyoungamongpieceoliviatakeyabryantfadyaa...

Echo Prea Word Search 2025-08-10

20 Items: The year PREA was signed into lawA person confined in a juvenile facilityA person who has experienced sexual abuseA confidential way for inmates to report abuseKeeping reports and victim identities protectedThe act of notifying staff or authorities of abusePREA standard requiring no tolerance for sexual abuse...

6th Grade Final Review 2025-12-12

33 Items: stored energyball on a hillenergy in motionhow energy movesall living thingsstored in nucleusall water on earthcauses earthquakesheating of objectsability to do workspring or rubberbandcurrents in a circuitwaves, voice, speakercar, skateboard, walkingcauses seafloor spreadingpush or pull of an objectprocess of changing position...

The Role of Nurse Residency Programs in Supporting New Graduate Nurses 2025-11-21

4 Items: SafetyBurnoutRetentionCollaboration

Factors Influencing Selling Techniques Today! 2023-11-23

14 Items: criteriadirectly or indirectlyshare and new product development.The name, logo and attributes of a business.The amount that consumers are asked to pay for a product.The way that a product makes its way from producer to consumerThe goals set by a business to increase sales, brand awareness,...

POSTIES 0407 BIG READ 2025-03-07

6 Items: the ability to seeto get used to a new situation by changing the way you behave and think_____ is a way for people who cannot see well to read by feeling raised dots.the process of helping somebody to return to a normal life after they have been very ill...

Spelling Test 3 2022-09-23

28 Items: against slaveryhostile; unkindunfit to be eatenthe act of going awayto repeat or say againone who is not a memberbefore recorded historythat which is not nuclearoccurring twice in a yearto stop or prevent an actionapart from one's choice or willto go do, come down, fall, or sinkof the highest degree or importanceextending across the Atlantic Ocean...

Olivia Word Search 2024-03-12

199 Items: trewinwonshugyanitoshwifewildwoolwordyardyearelseheldideasuitsurewearyelltylershaneahmadcarolshanaarifapryorgracejavonjamesjasonjudahjonahwomanworldwouldwritewrongboardbuildbuiltenjoyfieldfifthgroupheavyknownlaughninthoceanprizequiteradioraisescaresincethrewtiredtriedtrulyuntilvisitwholewhosewomenwroteyoungamongpieceoliviatakeyabryantfadyaaaminah...

Bible Random Word Search 2025-04-25

38 Items: the lastthe firstUriah’s wifedaddy synonymrunaway slaveIshmael’s father12 sent out onesIshmael’s motherJacob’ s new namewrestled with GodJew’s ruling bodyold name was Abrambirthplace of JESUSJew who ruled Egyptname hanged to PaulJew who ruled BabylonMary’s son of thunderrunaway slave’s ownercalled out David’s sinfirst king of the Jews...

Pathophysiology Terms 2026-01-21

20 Items: present at birthcause of a diseaseobjective evidence of a diseasesubjective evidence of a diseasecompilation of signs and symptomsprospect of recovery from a diseasestudy of the structure of cells/tissuesthe nature and cause of a health probleman acute increase of severity in a diseasethe origination and development of a disease...

128.The film The Seven Year Itch featured the famous scene of Marilyn Monroe standing over a subway grate as her skirt blows up. 2023-03-08

38 Items: filmposeplaysceneskirtstylesmilecharmfamousiconicbeautycinemabreezepleatsallureblowsupactressfashionglamourclassicsidewalkelegancehollywoodmoviestarsexsymbollegendarypinupgirlwhitedresshalterneckfemininitysubwaygratephotographynewyorkcitystreetscenemarilynmonroecheesecakeshotblondebombshellthesevenyearitch

Personal Financial Planning 2023-10-17

23 Items: The assets a person ownsPerson who depends on another personLong-term insurance with a savings elementShort-term insurance with no savings elementPayments made by a corporation to its stockholdersThe increase in the value or usefulness of an assetThe decrease in the value of usefulness of an asset...

Welcome to the Team 2025-06-26

23 Items: This person has published a book. (5 letters)I ride a Nija 650 sport Motocycle. (11 letters)Currently training for a Half-Ironman. (7 letters)The office's biggest Ottawa Charge fan! (4 letters)A transplant from the Northwest Territories. (7 letters)Went on a 7-day jungle safari in the Serengeti. (6 letters)...

CROSS SELL WORD SEARCH 2024-07-10

15 Items: MAKE YOUR MONEY WORK FOR YOUTURN MISPLACED CARDS ON AND OFFCHILDREN AND TEENS UP TO 17 YEARS OLDYOU CAN SEND UP TO $1000 TO ANOTHER MEMBEREARN 1.5 POINTS FOR EVERY 1$ THAT YOU SPENDPLAN YOUR NEXT TRIP WITH AFFORDABLE PAYMENTSFIND GECU LOCATIONS AND HOURS OR ATMS CLOSEST TO YOUFOR NEW OR USED VEHICLES TO GET YOU WHERE YOU NEED TO GO...

The Manhattan Project 2026-03-11

15 Items: – The radioactive element used in the "Fat Man" bomb.– The radioactive element used in the "Little Boy" bomb.– The energy and particles released by nuclear reactions.– Refers to the type of bomb developed during the project.– The process of splitting atoms to release enormous energy.– The site in Washington state where plutonium was produced....

manhattan project 2026-03-12

15 Items: – The radioactive element used in the "Fat Man" bomb.– The radioactive element used in the "Little Boy" bomb.– The energy and particles released by nuclear reactions.– Refers to the type of bomb developed during the project.– The process of splitting atoms to release enormous energy.– The site in Washington state where plutonium was produced....

08 2025-08-16

15 Items: a footrest for the riderThe part where the rider sitsSmall footrests for the rider or passengerA device for slowing or stopping a motorcycleFootrests mounted on the bike frame for supportA backrest bar for passenger comfort and supporta term used for the first ride of the new seasonFoot controls used to operate brakes or gear shifts...

Balboa 2025-09-09

15 Items: There is a _________ between right and wrong."Under the weather" is an example of ________."Her smile was a mile wide" is an example of __________."He's as healthy as a horse" is an example of a ________."His mind screeched to a halt" is an example of _________.His new white kicks were ________, with no scuffs on them....

Communism Word Search 2023-12-13

15 Items: 9/11 was an act of _________.Making a law better than it was prior.The Soviet Union had a _________ economy.Occurs when the economy begins to decline.A country that is considered superior to others.This is a type of warfare used in the Vietnam war.A popular political idea associated with Democrats....

Getting away 2023-12-09

20 Items: feeling calm,quietsomething that is very oldbeing the only one of its kindwhen a place has lots of peopleto go on a difficult journey on footsolid substances such as wood,plasticsomething that makes you feel relaxedsomething that makes you feel excitedunusual and often from another countryto become larger and rounder than normal...

Mattot Massei 5.0 2025-07-20

20 Items: SaltHaShem’s footstoolThe place where Aaron died.Who can annul a women’s vow?Where is The Holy Ones throne?The Holy One looks for the _____.What is never quenched in Gehenna?He spoke to the heads of the tribesWhere did Israel begin their journeys?Hpw many cities of refuge were appointed?This tribe requested land East of the Jordan....

Units 6-9 2026-02-24

20 Items: Main cause of civil war, supplies, and international aid.A union strategy to restrict the south of itsAdmendment that gave African Americans equal rights.Admendment that gave All males, colored or not, voting rights.Admendment that officially freed all slaves in the United states...

Landmark HTN Trials 2026-02-22

13 Items: In high-CV-risk patients without diabetes, an SBP target < 120 vs < 140 reduced major CV events and all-cause mortalityBenazepril–amlodipine was superior to benazepril–hydrochlorothiazide in reducing CV events in patients with high-risk HTN...

S2U7 Vocab Practice 2026-01-28

61 Items: whennearlazyto goneverundergrosswhileto seealwaysbehindshowermirrortoiletwe wereall dayyou wereat timesentranceto stalkto bullythey wereevery dayevery dayto botherevery yearfrequentlyfrequentlymany timesreflectionI/he/she wasevery Mondayevery Fridayevery Sundayall the timehe/she threwwe used to goevery Tuesdayso many timesseveral timesI/he/she knew...

Sukkah Word Search 2023-09-21

19 Items: schach must grow from thisschach must be _ from the groundschach can't become spiritually _animal _ can't be used for schachThe sukkah must be at least 10 _ tallThese must be put up before the sechachThe sukkah can't be higher than 20 _ tallThis must be put on the sukkah every yearThe sukkah must be at least _ tefachim wide...

Animal Farm Chapter 10 2025-04-02

19 Items: The farm was more… (128)Who visited the farm? (134)Animal Farm’s “new” name (138)The windmill was used for this (128)How many commandments are there? (133)What did Napoleon carry with him? (132)Died in another part of the country (127)Clover was two years past _______ age (127)Clover saw a pig walking on his what? (131)...

Climate 2025-11-20

20 Items: What climate is the coldest on Earth?What climate is found at the highest peaks?What word describes rain, snow, sleet, or hail?What describes average weather over a long time?What is changing worldwide due to human activity?What word means the amount of moisture in the air?What climate is hot, dry, and has very little rain?...

European Age of Exploration 2024-08-12

10 Items: What was the name of the reconquest of Hispaniola?What nation discovered a new route to India and China?What were southern cities of Spain in terms of religion?What was the name of the trade route from Asia to Europe?What land was known for the large amount of spices produced?What city fell to the Ottoman Empire and cut off the silk road trade?...

Vocuabulary Unit 1 Focus 2025-12-11

10 Items: ... but A and C only are connected...There is a... connection between points A and B...A sign that says “…” warns you not to enter a place.Tom can’t cook so he eats junk food. Not all the time but …With some people … is difficult because they just won’t listen.I was … to water my friend’s plants, but I forgot, and they all died…...

CLIMATE 2025-11-20

20 Items: – What climate is the coldest on Earth?– What climate is found at the highest peaks?– What word describes rain, snow, sleet, or hail?– What describes average weather over a long time?– What is changing worldwide due to human activity?– What word means the amount of moisture in the air?– What climate is hot, dry, and has very little rain?...

Sustainability 2025-09-26

15 Items: The act of using goods, energy, or food.Bringing nature back to a healthy state.The variety of animals and plants in nature.Harmful materials in the air, water, or land.Fair treatment for all people and the planet.When people have the same rights and opportunities.Things we use from nature, like water, trees, and oil....

fetertre 2023-08-24

7 Items: Legally recognised partnersAny transaction or occurrence that results in a tax consequence.It is specifically excluded from the definitions of ‘goods’ and ‘services’.Permanent transfer or disposal of business assets where input tax credit has been availed on such assets....

4B 0519 2023-05-18

25 Items: The three biggest ________ are at Giza._____________ were kings in ancient Egypt.A ________________ is a person who puts out fires.Sardines, pike and cod live in the sea. They are _______ fish.Honeybees are social insects and they live together in a _______.The baby ______ down when his mother picked him up from the cradle....

AAA list - how many can you remember? 2025-12-14

15 Items: autumn road trip next year?another winter on-water activitya big walk we want to scrapbook abouta safe place to think about your dad inour first attempt was derailed by a stormone of many wholesome activities to do at an orchardhow you know winter is coming to somerset, apparentlywe love a dance and a sing along and a chance to dress up...

Cardiac Rehab Word Search 2023-02-23

15 Items: cessation To stop smokingweight in pounds divided by heightRisk Factors risk factor YOU can changeattack obstruction of blood flow to heartmonitoring continuous monitoring of a patient's EKGWhat you will experience in our cardiac rehab departmenttype of chest pain caused by reduced blood flow to the heart...

Burberry 2024-07-26

15 Items: Who is the new CEO?where are Burberry bags made?The peg bag is made from what?How should a bag be stored in SB?What closure does the snip bag have?Which bag is inspired by a child’s toy?Where are Burberry cashmere scarves made?What tones are used in the AU24 collection?What is one of the AU24 seasonal micro prints?...

Legendary Sports and Athletes 2024-09-20

15 Items: Golf legend, won 15 major championships.Brazilian soccer star, won three World Cups.NFL quarterback with seven Super Bowl victories.Tennis champion with 23 Grand Slam singles titlesSwimmer with the most Olympic gold medals in history.Gymnastics superstar with multiple Olympic gold medals.First African American to play in Major League Baseball....

Budget Word Search 2023-01-17

27 Items: Using envelopes to budgetLabor marker for free-lancersThe opposite of fixed expensesCost the same amount each monthDivide your income into three categoriesA spending plan based on income and expensesThe amount of money needed to cover basic expensesThe cost required for something; the money spent on something...

Staten Island AA Trivia Wordsearch 2025-10-21

12 Items: AA started on Staten Island in what year?Staten Island had its first ______ in 1983.In 1995, SIGS sponsored the first ______ Marathon.Staten Island had a Post Office Box for what kind of work?Staten Island General Service was formed in the Early ______.The second AA clubhouse on Staten Island was called the _____ Club....

9.The 1950s saw the emergence of a new youth culture, as teenagers became a distinct demographic group with their own music, fashion, and attitudes. 2023-03-04

20 Items: souldoowopmotownthetwistbillhaleydickclarkalanfreedchuckberryfatsdominobuddyhollyedsullivanrockandrolltheplattersthecoastersstaxrecordselvispresleylittlerichardjerryleelewisrhythmandbluesamericanbandstand

Elfie's Middle Name 2025-10-31

1 Item: Candyland, Covert, Clever, Cookie, Collin, Conch, Chad, Chinese, Cheerful, Chaotic, Casper, Callum, Cole, Carlotta, Caroline, Catherine, Cecil, Cecily, Charles, Camila, Cali, Clementine, Cleo, Clinton, Clyde, Cora, Corinne, Callahan, Cassian, Chestnuts,

modern history 2023-07-17

20 Items: 1918 CE: The end of _____ _____ _.1904 CE: The Russo- _____ War begins.1933 CE: Adolf Hitler became the Chancellor of _____.1925 CE: Benito _____ gains dictatorial powers in Italy.1925 CE: Hitler's autobiography, ____ _____ is published.1928 CE: _____ _____ was created at the Walt Disney Studio....

OurDay Work Search 2022-08-29

1 Item: The name of the new ERP system that is being implemented at MUSC

11.The 1950s saw the rise of consumer culture in the United States, as Americans began to embrace a new era of abundance and materialism. 2023-03-04

20 Items: ibmpepsifordismcocacolakelloggsbrandnamesadvertisingconsumerismcreditcardsassemblylineshoppingmallspopularbrandsgeneralmotorsmassproductionappliancestoresgeneralelectricinstallmentplansdepartmentstorespostwarprosperityplannedobsolescence

0817 Let's do it ! 2022-08-16

18 Items: Baguettes are from ________.definition: very smooth, not bumpyIn the past, bad ____ lied to people.May I have some _____ cookies, please?We should _________ our homework soon.Betty never lies. She is very _______.That's why "a baker's ______" means 13!This necklace is worth a lot of _______.definition: to move something around an area...