chinese new year Word Searches

Mia.H's word search 2023-12-18

17 Items: the little bearthe larger bearproviding own lightlight bouncing off other sourcea person who study and explore the spaceasterisms recognizable patterns of starsmeteorite fragment that reaches the groundway the galaxy that includes the Solar Systemicy body that releases gases as it orbits the sunis a celestial body that is in orbit around the Sun...

Understanding Plate Tectonics 2026-02-13

12 Items: – What forms when plates pull apart on land?– What process forms new crust at mid-ocean ridges?– What supercontinent existed millions of years ago?– Who first proposed the theory of continental drift?– What kind of rock records Earth’s magnetic field reversals?– What percentage of earthquakes occur along plate boundaries?...

Loversky Word Search 2025-05-01

9 Items: Favorite Movie: "I am Iron-Man"Favorite Song: "Sing Along! ___ ___, Take Me home"Favorite Color: like from the cookie monster to the skyFavorite Subject: reading and writing to understand our worldFavorite Book: A book where a wardrobe leads you to a new worldFavorite Drink: A refreshing and essential drink most people love...

Walnut Word Search 2025-12-04

226 Items: jiartfayrayleejinbandmathjetsbetznimsguyewadeshawvoselowehornricelangtealeaglelatintrackligonsmithlytleplattpostawolfelloydfalerklothriggsdinizdobbslewismilesmoorerhameowenswilkepatelgerthlazarlukenmylesowensbatesdavismccoycooksmorganchaneynolandfrenchgermanalumnisoccerbeavenlanderthomastulleykrogermillerminanovernoncantergibsonknodlecottonhuskey...

Vocabulary 8 2025-01-23

12 Items: Mrs. Jaggers is very _______.The driven young man _______ to greatness.The girl had the _________ after her cat died.The old lady began to _______ due to dementia.Snail mail ads are sometimes addressed to ________.The class came to a _______ about the theme of the prom.The man was a _______; he ate the entire pie on his own!...

IT'S CORN 2025-10-18

12 Items: The small seed part of a corn cob.The science and practice of farming.The layer of earth where plants grow.The tall, sturdy stem of the corn plant.A person who grows crops or raises animals.The center part of the corn where kernels grow.The process that helps corn plants make new seeds.The process by which plants make food from sunlight....

welcome to post student life 2025-09-04

16 Items: Liquid motivation for 8 a.m. classesOne person works, everyone gets credit.When sleep and sanity file for divorce.When 12 months just isn’t enough stress.That one-page drama of your entire life.The only social media you update monthly.The mysterious force deciding your future.Where “Can you hear me?” is the new hello....

The Gettysburg Address 2025-09-10

16 Items: ___________ in liberty__________ and 7 years ago.a new ___________, conceived in libertywe cannot consecrate, we cannot __________Now we are ___________ in a great civil warto be dedicated here to the ___________ workthat these dead shall not have died in _________we can not ________, we can not hallow this ground....

Places Around Town Word Search 2026-02-12

16 Items: The place where journalists workThe place where you can exerciseThe place that has mass every sundayThe place where football players playThe place where you see dinosaur bonesThe place where you can buy fresh breadThe place that has shops and restaurantsThe place where you fill your car's tankThe place where you can read lots of books...

Blatant Word Search 2024-10-20

10 Items: ( the way someone see something)(creating news using photographs)(done openly and don't care about it)( a claim to make a different point than a earlier claim)(a story written or told on someones account about an event)( assert that something is what is true without using evidence)( using someones name or something they mode with out authorized...

Departments, Disputes, and Fee 2025-03-26

13 Items: Handles charged off debtsAny dispute needs this to be submittedTransfer here when the statement has 2 due dates.Late fees are % of your monthly mortgage payment.Transfer here when 3 or more months behind on paymentsTransfer here if they need help with an insurance policyTransfer here when lender placed insurance needs to be removed...

Benefits Word Search 2025-05-01

10 Items: Who is our Vision providerWho is our 401K/403B provider?Where can I find a list of my benefits? (abbreviation)How many days does a New Hire have to enroll in Benefits?Who is our Dental provider? ____ Cross Blue Shield of TexasWho is our USRC/SHC Employee Assistance Program (EAP) with.Who would receive my life insurance benefit once I pass away?...

0816 Here we go ! 2022-08-16

20 Items: The gas helps the dough ____.These CDs are round and _______.This bread ____ looks very soft.Be careful around the hot ______.These chips are really _________.You can _____ butter on your bread.Water is ________ in the red kettle.Artists ________ beautiful paintings.He sat down in the ______ of the room.You can _____ one and two to make three....

Feelings- Adjetivos-Animals 2023-03-02

20 Items: Its night so it isSpanish word for dog.Its winter so the outside isThe opposite of entertainingThe fact wasn't true so it wasA feeling when someone is cryingThis is a good neighborhood so it isHe is mad, another feeling word for madEveryone is so---of her accomplishmentsA feeling,she is scared around new people...

Vocabulary for Test 2023-05-16

25 Items: an egg or sperma form of a genea fertilized eggrequires one parentpart of a chromosomethe inherited allelessperm and egg combinethe study of geneticsa difference in a traita family tree for a traitan inherited characteristica change to genetic materiala type of asexual reproductionthe process that makes body cellsstructure made of DNA and protein...

Dividends vs. Buybacks 2025-10-12

10 Items: A buyback is also known as a _______.What is the current tax on stock buybacks?Repurchases can be deferred as __________.Buybacks _____ the number of shares outstanding.Dividends are taxed as ________ in the year received.25% of this metric is the cap on the amount of repurchases (it’s an acronym)....

Switcheroo Word Search 2024-04-13

24 Items: Bertle _____Aussie cowboy hatOne main characterWhite trunked treesJool's mum's recipeAn inhospitable regionThe station competitionHayley's New York hobbyThe other main characterOne of the station ownersThe nickname given to HayleyChantelle got fired from hereSlugger's favourite lunch foodHis girlfriend nicknamed him this...

fans 2024-09-10

160 Items: gohimybinbeebusbuncupcandendindigeareyeendfunfanfogfadgodhueheyiceinkivyjimjamjoykitmapnodnewnotnapnagnetowloiloptawedballboonbabybackcoolcoldcampDeepdirtdeskdatedoordivedockfacefrogfeedgamegirlgoalgoldgluegoathoophookhandheadheelheapideainchiranjailjustjacklogomeltmilknamenestnicenotenailnetsbloomblissbirdsbelowchaireagereagleeruptexertglovegoose...

July Wordsearch 2025-05-03

20 Items: A cooking device used outdoors.gear Equipment for outdoor adventures.A popular cold drink served at picnics.Activity involving visiting new places.Eyewear to protect eyes from sun glare.Footwear commonly worn during hot days.Moist air, often high during the summer.A central theme of national celebrations.Handheld fireworks used during celebrations....

Back to School 2025-08-03

20 Items: The adult who teaches the class.Schoolwork you take home to finish.The room where you learn at school.A tool used for writing or drawing.A book with blank pages for writing.A table where students sit and work.A child or person who goes to school.The solution or response to a question.Looking at words and understanding them....

Feelings- Adjetivos-Animals 2023-03-02

20 Items: Its night so it isSpanish word for dog.Its winter so the outside isThe opposite of entertainingThe fact wasn't true so it wasA feeling when someone is cryingThis is a good neighborhood so it isHe is mad, another feeling word for madEveryone is so---of her accomplishmentsA feeling,she is scared around new people...

just about every word 2023-10-01

158 Items: ashiifinnoonupandantbigbutbedbancatcanendelffryfanfatforgetgodhowlowmommannapnewpanpadvetwetyesyumbendbandboatboltcastcasecopydowndumbdoneeasyfirefoodgamegoodhelphandhoophosehowliowajumpjunejulylionlesslumpmoonmissmalemallnoonoverohioridereadstepslamsongsendtimetestundowordwhatwildxrayyarnyoyozoneaprilblamecrapecloneflamefloorfryergummygoosehello...

No Place Like Home 2025-04-29

22 Items: purple Texas wildflowerThe beach we frequentedMy ______ is back in TexasRicky's favorite University- Music festival abbreviationCity where all the yuppies live- Town where Ricky's dad residesFunny name for the collie at A&MExtravagant decor for prom girlsTexas team with pointy head-thingsThe best grocery store in the world...

Echo Word Search 2025-08-09

25 Items: "Sicko Mode" rapper?Kanye West’s new name?"Peaches" singer (2021)?SpongeBob’s best friend?Who is Batman's alter ego?Tony Stark’s superhero name?Who sings “Blinding Lights”?Meme frog known for being sad?Most-used app for viral dances?Who runs fast in the DC universe?GOAT soccer player, Messi or ___?Green Jedi Master from Star Wars?...

traditions and culture 2025-11-03

10 Items: to represent somethinga group of people who sing togethera large meal, typically a celebratory one.something that a group of people usually domusic in the traditional style of a country or communitythe point from which something starts; the cause of somethingto come together, or bring people together, in one place to form a group...

Fall (in) Love 2025-10-31

1 Item: woody halloween october pumpkin, thirtyfirst disneyland festivities date one year surprise costumes loveofmylife spooky bestfriend

Word Search, Geography and Places of Rome 2025-12-31

18 Items: The river where Rome began.The peninsula shaped like a boot.City later renamed by Constantine.Modern name for much of ancient Gaul.Continent where Carthage was located.City where Jesus was said to be born.The sea surrounded by many Roman lands.“New Rome,” capital of the Eastern Empire.Mountains Hannibal crossed to invade Italy....

ASU Well-being Word Search 2025-02-27

8 Items: Humana's well-being program is called?In March, we focus our wellbeing on this.How many VTO hours do full-time associates receive?April will kick-off Humana's largest belonging event, the 100-day....What provides quarterly metrics and updates on Humana's well-being initiatives?...

Spelling/Vocabulary word search puzzle 2022-11-10

15 Items: not alivebring to lifestrong disliking.a small, yellow birdrelating to metaphysics.an animal that feeds on flesh.the form and size of a persons bodythe rebirth of a soul in a new body.a traveling amusement show or circus.a person qualified to practice medicine.relating to the body as opposed to the mind....

Project Management 2024-10-03

15 Items: Moving from the old to the new."a push in the right direction".8-Step Project Management Theory.Going against the flow of change.Run according to law or regulations.Carrying out change within a business.Kotter and Nudge are 2 examples of this.The process or activity of running a business.Competition to your business is referred to as......

The Electoral College 2024-10-21

15 Items: ________ DC has 3 electoral votes.This state has 40 electoral votes.Indiana has how many electoral votes?Symbol of the Republican party (animal)Symbol of the Democratic party (animal)This state has the most electoral votes.This southern state has 8 electoral votes.This southern state has 30 electoral votes....

A+ Unit 9 2025-05-29

17 Items: – Not fun or interesting.– About health or doctors.– Feeling scared or worried.– To show something clearly.– Has something as a part of it.– Programs you watch on television.– Wanting to know or learn something.– Someone getting help from a doctor.– When someone or something stops living.– Being alive or the time a person is alive....

A+ Unit 9 2025-05-29

17 Items: – Not fun or interesting.– About health or doctors.– Feeling scared or worried.– To show something clearly.– Has something as a part of it.– Programs you watch on television.– Wanting to know or learn something.– Someone getting help from a doctor.– When someone or something stops living.– Being alive or the time a person is alive....

MARVEL CINEMATIC UNIVERSE FILMS WORD SEARCH 2024-05-22

37 Items: THORBLADEANT-MANIRON MANETERNALSBLACK WIDOWTHE MARVELSTHE AVENGERSTHUNDERBOLTSBLACK PANTHERDOCTOR STRANGETHOR: RAGNAROKCAPTAIN MARVELAVENGERS: ENDGAMETHE FANTASTIC FOURTHE INCREDIBLE HULKTHOR: THE DARK WORLDANT-MAN AND THE WASPAVERGERS: SECRET WARSSPIDER-MAN: HOMECOMINGAVENGERS: INFINITY WARTHOR: LOVE AND THUNDERDEADPOOL AND WOLVERINE...

DNA Replication & Protein Synthesis 2024-10-06

22 Items: start codonReplicate AAGBackbone of DNA & RNAWhat does GCU code for?What does UAA code for?The process of making mRNACytosine binds with _______The process of making proteinsProteins are a made of _______Transcribe the DNA code: GATGCACTAThe process in which DNA is replicatedUnlike DNA, mRNA can _____ the nucleus...

Funny Ham Radio 2024-11-19

25 Items: "More power!""Beep boop beep.""How strong am I?""Is this thing on?"Wart (power supply)"Ham radio in space!""Hopefully it's low!""I need more spectrum!"Load (not the operator!)"Chasing those rare ones.""Who can talk the fastest?""Gotta keep the noise down.""My other antenna is a dish.""Just chatting with friends.""Sounds like a blender in here."...

Tide Terms 2024-01-20

13 Items: the zone between high and low tidewe ____ through the two tidal bulgesterm for when celestial bodies line upgravitation of this is main cause of the tidesthe changing water levels experienced on earththe tide pattern when the sun earth moon are in syzygythe tide pattern when the sun moon and earth are at right angles...

IIM And LD Module 2023-09-29

26 Items: Where we put notes in the module.The tab you go to to open a new claimWe find documents in the module here.In claim documents S stands for _____.In claim documents P stands for _____.In claim documents U stands for _____.We typically search for claims using the ____.We send the procedure packet on the _________ tab....

New start 2022-11-11

1 Item: exercitiufizic apa soare temperanta aer recreere incredereindumnezeu

Calvin and Maya 2024-09-02

20 Items: Maya’s favorite hobbyCalvin’s favorite hobbyMaya’s favorite food that Calvin cooksCalvin’s favorite baked good Maya makesCalvin and Maya’s next travel destinationMonth of the year that Calvin and Maya metRoom in BHS where Calvin and Maya first metCalvin and Maya’s favorite local restaurantCalvin and Maya’s favorite food to eat together...

Easter Word Search 2025-03-31

20 Items: Time off workSeason in which Easter fallscompany who makes the Crème EggWhat most Easter Eggs are made fromSpring flower famously from AmsterdamSmall yellow bird that’s newly hatchedDay of the week you get your Easter EggYellow spring flower associated with WalesTraditional roast meat eaten on Easter Sunday...

Películas clásicas icónicas de los años 70, 80, y 90 2024-09-13

15 Items: friendly alien wants to phone homeGiant shark terrorizes Amity IslandHenry Hill’s rise and fall in the mafiaDinosaurs run wild in a modern theme parkMafia family drama led by Don Vito CorleoneUnderdog boxer rises to fame in PhiladelphiaA priest battles evil to save a possessed girlA time-traveling cyborg is sent to kill Sarah Connor...

Week 17 Thursday 2024-02-04

25 Items: PersonTo excludeA group of alliesIn a joyous mannnerAn arm, leg or wingCareful or cautiousOpposite of backwardTo show or point outSharp-edged utensilsThe right to use powerAble to do many things wellWanting what someone else hasCompeting for a better positionThe first person to create somethingTo rub fat on a surface while cooking...

Golf 2025-09-14

20 Items: Left-handed golfer nicknamed “Lefty”Charismatic golfer nicknamed “The King”German golfer who won the 2014 U.S. OpenSouth African who won the Masters in 2008Golfer who won a record 82 PGA Tour eventsScottish course known as the “Home of Golf”Won the 1997 Masters by 12 strokes at age 21South African golfer Gary who won nine majors...

Hogwarts Magic! 2025-10-13

20 Items: Hagrid's scary pet nameWas killed on Halloween 1981Most haunted place in EnglandWas reopened on Halloween 1992sacrificed herself on HalloweenWho was the Death Day Party for?The creature studied on page 394Needed to be saved on Halloween 1991Attacked the Fat Lady on Halloween 1993This character was petrified on Halloween...

AMAZING 2018-02-20

156 Items: heyhaydaybaymaytaypaywaynayfaycaykayjaywonwintinbinminlinpinfinrinsinzinvinyinvancanmandanlanpantanranyansanwanjanboytoyhoyjoypoyloyroywoymoynoyvoycoyzoysoykidbidfidpidridsidwidcidzidfornownewnottontennetwetfewdewpewtwofanboypoddottotpotmotnotlotyothotjotgotfotrotwotzotcotvotsotwipdiplipsiptipripviphipcapgaphaplapmapnapvaprapyapwapsapbundungunguy...

F6 Module 3,3a 2023-11-20

44 Items: (n) uba(n) õlg(n) mask(n) rütm(n) pähkel(n) kostüümellu ärkamavaimustuses(adi) kuldne(adj) tüdinud(adj)pettunud(adj) ovaalnetänavarongkäik(n) toit, roog(v) valmistamahiilgav, särav;(n) ahv, pärdik(adj) üllatunudtraditsioonilineparaad, rongkäikmuistne; antiikne(adj)kurb; õnnetu(n) orkester, bändpidulik tähistaminegigantne, hiiglaslik...

Earth Structure Word Search 2024-04-24

20 Items: study of rock layersmolten rock above Earthmolten rock below Earthmovement of rock overtimesmaller particles of rockbreakdown of rock overtimehottest part of Earth's layersettlement of rock in a new locationpart of Earth's layer that we step onrock formed by the cooling of lava/magmarock formed from compaction of sediments...

September 21st 2024 2024-07-02

20 Items: The officiant's name?What soroity was Taylor in?What month did George Propose?What is Taylor's new last name?Who was Taylor's only Prom date?what is Taylor's first degree in?What is Taylor's favorite animal?What is the couple's favorite sport?Who was George's favorite Prom date?What sport did Taylor do in college?...

the scourge made in psd 2025-05-20

35 Items: chainsdiseaseconfessstarvingto scarecurse worda hospitalto put downdellas fatherlong windy pathfeel bitternessbusy and crowdedno pity or mercyto commit or helpani's best friendhard piece of skinto heavily destroyhanging in the airable to catch firea guard of a prisonto try and break freevisible or vulnerablebetter than or greater...

Ghost word search 2025-12-19

20 Items: Ghost's real name?The persons mom diedGhost enemy at school?Main characters nicknameWhat is the team called?The boss of the track teamThe only girl on the team?What Ghost does for Coach?Who's store does Ghost go to?What Ghost wants to do one dayWhat is Ghost and his friends?He is now what on the track team?What did Ghos's dad try to use on them?...

Fun trivia about the birthday girl 2026-02-04

21 Items: Alma materFavorite movieHer Dad’s nicknameCity where she grew upHer animal hobby as a kidHer Mom’s “grandparent” nameHer Dad’s “grandparent” nameHer favorite alcoholic drinkWhat city did she work in FL?Her favorite non-alcoholic drinkHer favorite cable movie channelWhere did she first live with Ted?Her 3 siblings' names concatenated...

SPRING 2026-03-13

165 Items: AIRBEEBUDBUGDEWDYEEGGHAYMAYNEWOAKSKYWETANTSBABYDIRTDUCKFARMFERNFROGGIFTGROWHUNTIRISJUMPKITELAMBLEAFLILYLIMEMELTNESTPINKPLUMPONDROOTROSESEEDSTEMTHAWTWIGWARMWINDYARDAPRILARBORBERRYBLOOMBLUSHBOOTSBUNNYCANDYCHICKCHIRPCLOUDDAISYEARTHFAITHFEASTFIELDFRESHGRASSGREENHATCHHONEYLILACMARCHPETALPEACHPEEPSPEONYPOPPYROBINSNAILSTORMSUGARTULIPVIVIDAZALEABASKET...

Unit 4 2025-09-09

10 Items: First permanent English settlement in North AmericaSpanish conquistador who defeated the Aztecs and conquered Mexico (1485-1547)The transfer pf plants, animals, and disease between the American and Europe, Asia and AfricaA trade route that exchanged goods between the West Indies, the American colonies, and West Africa...

Unit 2 Key Terms and Vocabulary Word Search 2025-10-05

25 Items: Weapons portable towers and catapultsChinese sailing ship that developed during the Song Dynastya very wealthy and world-renowned center for Islamic learningSaddle saddles developed by South Arabians as the use of the camel spreadHorde Batu’s army that pushed westward through Russia and then into Europe...

Guymontag Word Search 2022-08-19

20 Items: The first fireman.The author of the book.What they call earbuds.Mildred Montag's nicknameThe main character of the book.Montag has these hidden in his vent.Mildred's "family" can be found here.Clarisse says that she is 17 and _____.The captain of Montag's fire department.This smells like a perfume to Guy Montag....

Dublin Word Search 2025-06-17

29 Items: Epic ___ DayOur couple’s nameLynda’s dream jobOur favourite teamOur go to take outName of our Big BuddyName of Shawn’s droneWhere does Shawn workCity we got engaged inMonth of our first dateName of our flower girlName of our first danceWhere we had our first dateShawn’s favourite instrumentSport Lynda played growing upWhere Shawn went to university...

Love Story 2025-11-22

20 Items: Who introduced us?Tim's minecraft nameSasha's minecraft nameWhat year did we meet?What is our anniversary month?What month did we meet in-person?What game did you help me download?What will be the name of our first cat?What is the name of our first Stardew child?What game did I give you a coupon to cash in?...

New beginnings 2025-12-11

1 Item: positivehabits, routines, personalgrowth, health, meditation, yoga, hobby, gratitude, selfcompassion, organized, financialclarity, socialactivities, volunteer, goals, january, accomplishments, reading, environment, relationships

SIMPLE PAST 2023-08-31

15 Items: We _____ the movie last week.She _____ 24 years old in 2015.The kids _____ to school by bus.They _____ the teacher to speak slow.The athlete _____ 5 miles in 24 minutes!I remember I _____ about animals in class.Mr. Johnson _____ a cat, but it died in March.My roommate _____ all the cookies in our house....

All about the Lab Word Search 2025-04-08

15 Items: AlarmingThe name of our labThe platform we analyze raw data onThe last master mix that is made is_Name of the folder .txt files go into_ process has Molecular Inversion ProbesAn equipment that fluctuates temperaturesCompare these on the tubes and worksheetsThe machine needed to spin down a plate is a _SOP version of the document we use for Analysis...

Unit 4 2025-09-09

10 Items: First permanent English settlement in North AmericaSpanish conquistador who defeated the Aztecs and conquered Mexico (1485-1547)The transfer pf plants, animals, and disease between the American and Europe, Asia and AfricaA trade route that exchanged goods between the West Indies, the American colonies, and West Africa...

Choice Word Search 2024-11-11

19 Items: an apartment buildinghow heavy something isstories, poems and playsdepartment that sells productspersuade someone to by somethingunit of measuring liquid in Europeopportunity to decide between optionsowned/ used by someone else before meworried that something bad will happenunit of measuring liquid in the UK and US...

ss 2026-02-24

20 Items: taking away the right to votean entrepreneur that created the Atlanta Mutual Insurance Companyraised the morale of the Georgia Patriots gave them needed suppliescreated to keep the races separate in the South after Reconstructionleader of the Populist Party in GA, known for the Rural Free Delivery Bill...

ORIGINAL 2023-02-21

1 Item: genuine, true, innovative, unique, creative, unconventional, fresh, new, inventive

Cajon Valley Transportation 2025-03-27

11 Items: How many times can you take your BTW test?How long is your medical exam good for? (Years)You must be ____ years old to drive a school bus.______ are very slippery after the first rainfall.On your renewal year what training must you receive?How many first aid units would you need for 17-42 passengers?...

V5 1-16 2025-10-30

17 Items: – not afraid; brave.– easy to reach, enter, or use.– taken away by force; kidnapped.– not able to bend or change easily.– told or taught how to do something.– taking away an amount; subtraction.– a person who gathers and shares news.– rude or unkind behavior toward someone.– not being accepted or being turned down....

Space II 2023-03-09

23 Items: a moonless planetthe solstice on june 21another moonless planetthe name of pluto's moonmain gas in Mars' atmospherethe brightest star in TaurusFirst american woman in spaceWord meaning "around the sun"a moon feature named CopernicusThe liquid in the ocean of TritonWhat is the star nearest to the sunthe constellation for the star Vega...

Megan and Chris 2024-11-17

24 Items: What is Chris' hobby?Where was Megan's first job?What is Chris' favorite food?What was their college mascot?What town did Megan grow up in?What instrument does Chris play?What color are the groom's eyes?What month did they get engaged?Where did David and Eileen meet?What is Megan's favorite tv show?Where is the couple honeymooning?...

Golf 2025-09-14

20 Items: Left-handed golfer nicknamed “Lefty”Charismatic golfer nicknamed “The King”German golfer who won the 2014 U.S. OpenSouth African who won the Masters in 2008Golfer who won a record 82 PGA Tour eventsScottish course known as the “Home of Golf”Won the 1997 Masters by 12 strokes at age 21South African golfer Gary who won nine majors...

ROCKS! 2026-01-07

7 Items: this type of melted rock is found inside the Earth.a type of rock formed by compacted and cemented sedimenta type of rock formed directly from cooled magma or lava.this type of melted rock is found on the outside of the Earth.this type of crust, or tectonic plate,is found beneath the ocean!...

The Word Search 2025-04-19

6 Items: the introduction of harmful substances or products into the environment.the presence of harmful substances in the environment, making it unsafe or unclean.the protection and careful management of natural resources to prevent their depletion.the process of converting waste materials into new materials and objects to reduce waste....

CCR Word Search for Extra Credit 2025-05-01

11 Items: Central bank of the United States:Current secretary of the treasury:Current chair (leader) of the Federal Reserve:A government-issued bond that lasts for 30 years:A government-issued bond that lasts for 1 year max:A government-issued bond that lasts for 2-10 years max:If a bond you buy is rated AAA, then this is that bond's:...

Minnesota 2023-01-24

30 Items: hockey teambiggest lakebaseball teamnot saint paulthe state birdthe metro areaa northern citythe state flowerthe capitol citythe biggest rivera delicious burgerthe real state birdwe get a lot of thiswe got a lot of thesesport you play on icewhere the mayo clinic isour men's basketball teama saying to express dismayour women's basketball team...

Online Activities 2025-10-30

8 Items: email To open your email and read or send messages.music To listen to music online without downloading it.games To use your phone, computer, or console for fun games.online To buy things on websites or apps instead of in a store.videos To see short or long clips online, like on YouTube or TikTok....

Entrepreneurship 2025-08-19

14 Items: A bad workerA company carBusiness loanAuntie AnniesNike paying their taxesWalmart and Target make a dealMcdonalds selling burgers to a customerA bakery has a budget of $5,000 to run a businessStarbucks advertises a buy one, get one free couponA clothing store tracks monthly sales growth to track success...

year 6 2025-10-17

1 Item: existence, language, parliament, suspicious, ceiling, foreign, legibly, preferred, symbol, criticise, ghastly, neighbour, programme, temperature,especially, hesitation, official, soldier, thoughtful

95 Word Search 2024-10-09

15 Items: vll had 6 wivesguess about someone or somethinghunt took place from about 1450 to 1750parallel lines covering to a single pointdistinctive among 16th-century reform movementswas a period in history between 14th and 16th centuryitalian renaissance sculptor paunter architect and poetan Italian painter and architect of the high renaissance....

John Cabot 2023-02-15

16 Items: John's last nameThe name of his first shipCabot's first name at birthThe name of John Cabot's sonThe country John Cabot was born inCabot was an expert sailor and _____The country he had actually landed onHe was given the name the great _____Sebastian sailed down the ________ to CanadaThe country John Cabot moved to when he was 40...

Science 10B T3.1 SPACE 2025-09-04

16 Items: A push or pull (5)A negatively charged particle (8)A positively charged particle (6)Two or more atoms joined together (8)A rocky object that orbits the Sun (8)The smallest particle of an element (4)A large body that moves around a star (6)How fast a chemical reaction happens (12)The ability to do work or cause change (6)...

Recap Unit 9 2024-11-11

19 Items: an apartment buildinghow heavy something isstories, poems and playsdepartment that sells productspersuade someone to by somethingunit of measuring liquid in Europeopportunity to decide between optionsowned/ used by someone else before meworried that something bad will happenunit of measuring liquid in the UK and US...

Unit 2.3 - Recruitment, selection and training of employees 2024-11-14

19 Items: employess will usually work 35 hours or more a week.to the point where applications arrive to the business.Occurs by watching a more experienced worker doing the jobis the process from identifying that the business needs to employemployments is often considerd to be between 1 and 30-35 hours a week...

Dialogue: Word Search 2023-10-04

6 Items: ‘Chef’ and ‘Cook’ both words mean someone who prepares food.clause what do you mean when you wrote: “You got home and.”When a teacher and student are talking about his or her homework.A country with no laws and people can do what they want to do whenever they want to....

Dialogue Word Search 2023-10-05

6 Items: What do you mean when you wrote: “You got home and.”‘Chef’ and ‘Cook’ both words mean someone who prepares food.When a teacher and student are talking about his or her homework.A new classmate is very positive and seems to want to help people.A country with no laws and people can do what they want to do whenever they want to....

POSTIES 0127 BIG READ 2024-12-27

6 Items: Oyster shells are mostly made of _____.to make new objects out of waste materialused to describe someone who is slow to act because they feel uncertainBefore the oysters can be sent to Green Island Cement, the hotel staff must _____ and store them.a grey powder used in building which is mixed with water and sand or stones to make a hard substance...

Vocab 7 2023-11-16

12 Items: I got a ___ to search this house.I felt _____ about running the mile.The amount of money they owe is too ________.After she was sick she was ____ from everythingThe little was able to be _____ by the evil witch.After i dropped my phone it was ___ and not workingThe kind begged for his life or he _____ for his life....

EARTH'S RESOURCES 2025-10-09

12 Items: -the careful use of resources.fuel -any hydrocarbon used as a source of energy.warming -the unnatural warming of the lower atmosphere.resources -something that takes millions of years to form.-partly decomposed organic material that is used as fertilizer.power power that falling water generates to produce electricity....

Essenty Spring Launch 2025-09-03

1 Item: launching under essenty this spring the best thing to ever happen this year selling out quickly

Vocab 7 2023-11-16

12 Items: I got a ___ to search this house.I felt _____ about running the mile.The amount of money they owe is too ________.After she was sick she was ____ from everythingThe little was able to be _____ by the evil witch.After i dropped my phone it was ___ and not workingThe kind begged for his life or he _____ for his life....

REFUGEE MENTAL HEALTH 2024-10-08

6 Items: The global organization focused on protecting refugeesSupport that focuses on emotional, psychological, and social well-beingA term for people forced to flee their country due to conflict or persecutionA psychological coping mechanism where someone avoids thinking about traumatic events...

Unit 7 vocab practice 2024-05-03

14 Items: The ___ fireworks lit up the sky.The sudden change of plans ___ me.Cleaning up my neighborhood is ___.The old house had a ___ appearance.I took medicine to help ___ my headache.I put a lid on my water so nobody could ___ it.During war, the invading armies would ___ towns.When we moved into our new house, it was very___....

The American Revolution 2023-10-11

9 Items: freedom from being controlled by someone elsea disagreement or fight between two or more groupsa sudden and complete change in government or social orderagreements or partnerships between different groups or countriescomplaints or problems that are considered to be unjust or unfair...

Vietnam Word Search 2025-12-10

23 Items: Capital city in North Vietnam.The Vietnamese lunar New Year.People killed in a conflict or event.Freedom from disturbance; tranquility.Capital city in South Vietnam and was renamed in 1976.Old name for Vietnam when it was a French colonial territory.A person who has been captured and imprisoned by the enemy in war....

Forgotten, Word Search 2024-02-02

1 Item: committed, sobbing, quizzed, shipping, recreation, foundation, collection, tradition, ambition, New Jersey, New Mexico, admire, chaotic, museum, practical, prior, proceed, revised, visible, compliment, condemn, defective, deity, emblem, excel, improvise,

Matter unit 1 5th grade 2024-08-27

9 Items: how hot or cold something isbe able to be dissolved in a liquidanything that has mass takes up spacethe amount of space something takes upmatter in which a substance does not have a Divine shape or volumestate of matter in which a substance has a Divine shape and divine volume...

Pinchas 5.0 2025-07-13

16 Items: What tribe was Zimri from?Tzelofchad had how many daughters?What was poured with each offering?Which tribe had no land inheritance?Who did Moses appoint to succeed him?The central figure of this Torah portion.What stopped the plague among the Israelites?Which holiday includes fasting and atonement?What holiday includes the blowing of the Shofar?...

A+ Unit 7 2025-05-12

18 Items: – I feed my cat every morning.– Let’s sort the toys by color.– The books are on the top shelf.– She wants a career as a doctor.– The school play was a big event.– Water is a basic need for everyone.– Let’s set up the chairs for the party.– We used teamwork to finish the puzzle.– He helps care for the classroom plants....

Islamyat Word Search 2025-11-20

20 Items: Muttalib Restored the well of Zam ZamNumber of men who migrated to AbyssiniaNumber of women who migrated to Abyssinia“Paradise lies at the ____ of the mother.”Number of Muslims who migrated to AbyssiniaEmbraced Islam in the sixth year of prophethoodEmbraced Islam in the sixth year of prophethoodNaufal Khadijah was a rich widow from this clan...

Vocab 7 2023-11-16

12 Items: I got a ___ to search this house.I felt _____ about running the mile.The amount of money they owe is too ________.After she was sick she was ____ from everythingThe little was able to be _____ by the evil witch.After i dropped my phone it was ___ and not workingThe kind begged for his life or he _____ for his life....

7th Grade Extra Credit Word Search 2026-03-09

18 Items: EndlesslyNot active or in useA widespread diseaseTo move back or away fromTo include as a necessary stepFriendly, lively, and enjoyableHaving a good outcome; favorableDoubtful; of unlikely authenticityTo explode; to break out with forcePitifully sad and abandoned or lonelyExtremely important; vital in resolving something...