atoms and molecules Word Searches

The Chemistry of Life 2024-10-02

29 Items: AtomAcidsBasesSoluteCarbonLipidsIsotopeSolventPHscaleBuffersElementsCompoundSolutionMonomersPolymersProteinsIonicbondMoleculesFattyacidsAminoacidsSuspensionsLifescienceNucleotidesCovalentbondNucleicacidsCarbohydratesMacromoleculesPhysicalscienceMonosaccharides

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substanceenergy in the form of heatenergy associated with motionable to dissolve other substances.the basic unit of a chemical element.the degree of compactness of a substancethe speed of something in a given direction.the rate of change of velocity per unit of time.the ability to be dissolved, especially in water....

Linear Equations Word Search 2024-11-13

20 Items: slope: y=3x-5the "rate of change"y-intercept: y=12x+4slope: (5,1) and (8,3)slope: (6,3) and (1,8)slope: (16,14) and (2,7)slope: (-1,7) and (-1,5)slope:(7,12) and (-9,-8)slope: (-4,-3) and (1,-3)slope: (4,-10) and (2,-7)slope: (-15,6) and (1,-74)y-intercept: (7,2) and (2,7)y-intercept: (3,7) and (9,-3)y-intercept: (13,5) and (2,60)...

Chemistry 1 2019-03-18

27 Items: ionanionatomscationalkalisammoniaelementemulsionglycerinchemistryelectronscombustionemulsifierimmiscibleionizationlipophilicglycolicacidalkanolaminesacidicsolutionchemicalchangealkalinesolutionalphahydroxyacidcompoundmoleculeselementalmoleculechemicalpropertiesinorganicchemistryexothermicreactions

Physical Properties of Matter 2023-11-05

17 Items: How shiny things can beAll matter is made of theseTwo or more atoms put togetherMixture that is uniform throughoutMixture that is not uniform throughtoutWhen something is easy to break or chipSomething that allows energy to move throughWhen a substance changes from a liquid to a gasWhen a substance changes from a gas to a liquid...

Science 2025-07-21

20 Items: poisonousbiological catalystpH <7; turns litmus reddisease causing microbepolymer made up of amino acidsone of the 5 Kingdoms, think mushroomoccurs in chlorophyll, plants do thisa place where there is no matter at allhaploid cell used for sexual reproductionsolution that has passed through a filterforce of attraction between atoms or ions...

Periodic table 2024-11-20

31 Items: tablelevelinertdecaymetalsenergygroupsalkalitracerprotonsperiodsisotopehalogenductilethermalelementsneutronsperiodicdiatomicnonmetalselectronsmoleculescompoundsmalleablesemimetalsmetalloidsatomicmasstransitionelectricalradioactivesemiconductor

science review wordsearch 2023-06-01

22 Items: Unit for workThe transfer of heat in the form of wavesHighly reactive nonmetal elements in group 17Solution that has more solute than the solventHow tightly packed the atoms are in a substanceDescribes both the speed and direction of an objectReactions that release thermal energy when they react...

Advanced Science and Future Technologies 2025-05-30

10 Items: A planet that orbits a star outside our solar system.The study of materials at extremely low temperatures.Designing technology inspired by nature’s models and systems.The science of using light (photons) to transmit information.An unmanned flying device controlled remotely or autonomously....

CHEMICAL LABORATORY 2024-09-02

30 Items: AcidZincGasesAtomicBoilingFiltersArsenicEnzymesSolventsReagentsNitrogenElementsCatalystAlkalineSulfuricNeutronsChloridePipettesMoleculesViscosityMicroscopeExothermicVolumetricSublimationThermometerRadioactiveElectrolytesDistillationCentrifugationNeutralization

Hero's of Millennials 2023-01-31

19 Items: Actress and humanitarian.Comedian, actress, and writer.Actress, UN Women Goodwill AmbassadorMusician, actress, and philanthropist.Musician, actress, and philanthropist.COO of Facebook and best-selling author.Co-founder, chairman and CEO of Facebook.Musician, songwriter, and philanthropist.Media mogul, philanthropist, and producer....

Mercury WorkSheet 2024-02-21

19 Items: hotwindrayseightfieldatomswatersodiumheliumclosesttornadoneutralchargedshadowssmallestringlessmoonlessexospheregrayish-brown

Atom Word Search 2024-07-18

12 Items: Genetic materialBasic unit of matterBuilding block of lifeNerve cell in the bodyForce attracting objectsTest to prove a hypothesisStudy of matter and energyChange in species over timeCommunity of living organismsGroup of atoms bonded togetherProcess plants use to make foodStudy of substances and reactions

Chemistry MI project 2023-02-16

20 Items: H2ONaClOrganizes elementSymbol H, number 1symbol K, number 19symbol S, number 16Symbol Fe, Number 26symbol Ca, number 20Symbol Ti, number 22symbol Co, number 27symbol Ag, number 47symbol Zn, number 30symbol Kr, number 36What atoms want to beLiquid, atomic symbol Br,Bond between metal and nonmetalAmount of protons in an element...

Density and Matter (Try to define all the words) 2017-03-09

30 Items: gassinksizemasswaterfloatsolidcolorshapematterliquidvolumedensitymeltingboilingtexturemixturefreezingpropertydissolvesolutionchemicalphysicalparticlemoleculesevaporatemagnetismcondensatesolubilitycharacteristic

spelling T3 WK6 2023-08-23

30 Items: solidpropelprotectamateurpreviousparticalidentitycalenderofficialschedulemoleculessubstancepreciselyprecisionprocedingproficientprecariousaustralianpreviouslypredicamentprosaicallydemonstratepredictablepredicttionproficiencyprogressionprohibitionpredominatlyproficientlynaturalisation

Chemical Reactions and Enzymes 2026-03-04

14 Items: when an enzyme changes shapethe elements or compounds that enter into a chemical reactionthe elements or compounds that are made by a chemical reactionthe region of an enzyme to which the substrate binds. (the pocket)when an enzyme is changed in shape due to a change in temperature or pH...

Weather 2023-01-09

32 Items: masssnowhailrainwindforcesleetoxygencloudsupdraftgravityinflatedeflatemovementnitrogenhumidityaltitudedowndrafthygristorbarometerelevationmoleculesdepositionradiosondewatervaporwatercycleevaporationthermometertemperaturecumulonimbuscondensationprecipitation

Review 2023-11-14

32 Items: gassolidgroupanionmetalmatterliquidplasmaperiodcationelementneutrondensitycompoundelectronnonmetalnoblegasmoleculesionicbondmetalloidhomogenousmassnumberdepositionsublimationheterogenousatomicnumbervaporizationcondensationcovalentbondphysicalchangeschemicalchangesvalenceelectron

CHEMISTRY EXTRA CREDIT 2026-02-12

28 Items: ACIDIONSPOLARATOMSDIPOLEFORMULACHARGESNONPOLARMOLECULEELEMENTSCHEMISTRYIONICBONDSUBSTANCENONMETALSNOBLEGASESMETALLOIDSVSEPRTHEORYMETALLICBONDCOVALENTBONDHYDROGENBONDGEOMOLECULARINTERMOLECULARINTRAMOLECULARLEWISSTRUCTUREVALENCEELECTRONLONDONDISPERSIONTRANSITIONMETALSELECTRONEGATIVITY

Types of Bonds 2025-10-04

10 Items: An ion made of more than one atom.A chemical bond formed when two atoms share electrons.Describes a covalent bond where atoms share two pairs of electrons.Bonding that involves the attraction between ions of opposite charge.Describes a covalent bond where atoms share three pairs of electrons....

Spelling list 2024-05-23

20 Items: nation wideattracts metalan act of movingand area of groundany basic substancenonmechanical deviceright now or presenta process in the bodyto represent somethinga way to measure energyphysical force on somethingspeaking between each othersomething that happens anuallyconnect with someone or somethingused in ordinary or basic conversation...

Engineers Word Search 2023-01-17

26 Items: maintains and repairs x-ray equipmentengineering involved in all aspects of healthcareDevelop and design nuclear products and processesCoaster designs, builds and maintains amusement park rides.processes and analyzes LiDAR point clouds for anomalies and artifacts.improving the manufacturing process to increase the yield of products....

science 2024-05-17

15 Items: a solid collection of mineralsdistance from one crest to anotherbasic particles of the chemical elementsthe amount of three-dimensional space that matter occupies.temperature at which a liquid turns into a solid when cooled.point temperature at which a liquid turns into a solid when cooled....

HLTAAP001 Healthy body systems 1 2024-04-02

30 Items: dnacellatomsnerveheartlungsbrainrenalorgansimmunemuscleuteruskidneyanatomytissuesnucleuscytoplasmendocrinedigestivelysosomesintestineorganellesphysiologyconnectiveepithelialreproductivemitochondriaintegumentaryintegumentarymusculoskeletal

Chemistry MI project 2023-02-16

20 Items: H2ONaClOrganizes elementSymbol H, number 1symbol K, number 19symbol S, number 16Symbol Fe, Number 26symbol Ca, number 20Symbol Ti, number 22symbol Co, number 27symbol Ag, number 47symbol Zn, number 30symbol Kr, number 36What atoms want to beLiquid, atomic symbol Br,Bond between metal and nonmetalAmount of protons in an element...

VĀRDU KOSMOSS 2024-08-29

30 Items: RSUBALLEATOMSIZPĒTEMISIJAZINĀTNEKOSMOSSTEORIJALIDOJUMSSTUDIJASSTUDENTIATBILDESIZGLĪTĪBAGALAKTIKATELESKOPSVIEDOKLISINOVĀCIJASASNIEGUMIABSOLVENTIZINĀTNIEKSDIPLOMDARBSDISERTĀCIJAGRAVITĀCIJABIOMEDICĪNAASTRONOMIJAAPBALVOJUMSKOMUNIKĀCIJAASTRONAUTIKAUNIVERSITĀTESTARPTAUTISKS

Curie and Einstein 2025-02-05

30 Items: LabMathCurieNobelAtomsPrizeMarieRadiumEnergyFamousTheoryX-raysGeniusPhysicsScienceUraniumQuantumEinsteinPoloniumParticleResearchDiscoveryRadiationProfessorInventionChemistryRelativityExperimentInnovationRadioactivity

first 3 topics 2025-02-05

30 Items: DenseAtomsGroupcellsStainMatterLiquidEnergyBrittleMagnifyInfraredElementsHalogensParticlesNonmetalsStrontiumconductionInsulatorsTransitionMicroscopeEvaporationElectricitySpecialisedCellmembraneRedbloodcellEyepiecelensLivingthingsDoubleglazingPeriodictablephotosynthesis

Matter and Energy in Ecosystems Word Search 2026-05-15

28 Items: fatinputatomssystemstarchoutputenergycarbonmattermatterproductglucoseconnectdioxidebiodomereactantproducermoleculeglycogenconsumerorganismsecosystemdecomposerchloroplastrespirationmitochondrionphotosynthesisstorage molecule

Bio Study Word Search 2025-09-22

30 Items: A living thingAbility to do work.Smallest unit of life.energy Energy in motion.energy Energy of positionprotein A protein that spans the lipid bilayer.The ability to conduct metabolism and reproduce.backbone Spine of DNA where nucleic acid connects.Large molecule made up of strings of covalently bonded monomers....

Matter and Energy in Ecosystems 2026-03-09

29 Items: FatAtomsInputBioticMatterCarbonEnergyOutputStarchSystemAbioticBiodomeDioxideConnectStorageGlucoseCellularConsumerMoleculeGlycogenProducerReactantEcosystemOrganismsDecomposerRespirationChloroplastMitochondrionPhotosynthesis

ch.8 science 2024-12-02

8 Items: sort and package proteinsstructures that make proteinswhere energy is produced from food- store water, food, and waste productsa gelatin-like substance inside the cellwall membrain a protective layer that covers the celllargest organelle; It controls all activities of the cellbreak down food molecules, cell wastes, and worn out cell parts

Kitchen Scientist 2025-01-13

9 Items: Heat from the sunBacteria converts sugars to acidTogetherness due to movement and energyMeasure of a fluid's resistance to flowWheat protein that gives a chewy texturesubstance found in the cell walls of algaeFluids that break Newton's law of viscosityMixture of two liquids that normally do not mix...

Earth Science CH 2 2016-01-18

30 Items: IonGasBohrMassBondAtomsForceIonicStateSolidMatterLiquidPlasmaProtonsmixtureDensityElementsNeutronsisotopesCompoundMoleculeCovalentMetallicHydrogenSolutionElectronsMassnumberhomogeneousAtomicnumberHeterogeneous

Foundational Body Systems (Part 1) 2025-10-21

30 Items: AtomsWaterCarbonCytosoMatrixProtonsNeutronsElementsIsotopesVacuolesElectronsCompoundsFormationAutophagyCelluloseSolutionsChromatinIonicBondsLeukoplastsChromosomesNucleoplasmChromoplastsChloroplastsCovalentBondsHydrogenBondsCarbonDioxideCarbohydratesPhotosynthesisGolgiApparatusMolecularOxygen

gravity, magnetic, and electricity word seach 2026-05-07

27 Items: polepolepushpullrepelatomsforcesmagnetmagnetweightgravityattractprotonsmagneticpositivenegativeneutronsparticleselectronselectricitynonmagneticelectricityaccelerationelectricfieldselectromagneticelectriccurrentelectriccharges

chapter 2 basic chemistry vocab 2023-09-25

14 Items: the outermost shell of any atomAnything that takes up space and has massnumber of protons within the nucleus of an atomScientific study of the properties and behavior of matterA substance that can't be broken down by non-nuclear reactionsthe mass of an atom of a chemical element expressed in atomic mass units...

Elements Word Search 2024-01-17

19 Items: one cycle per minuteouter ring of electronssmallest units of an elementthe steps necessary in a processpositively charged elementary particleselementary particles with no electrical chargethe flow of electrons from atom to atom in a conductorthe movement of electrons being directed through materials...

chapter 2 basic chemistry vocab 2023-09-25

14 Items: the outermost shell of any atomAnything that takes up space and has massnumber of protons within the nucleus of an atomScientific study of the properties and behavior of matterA substance that can't be broken down by non-nuclear reactionsthe mass of an atom of a chemical element expressed in atomic mass units...

chapter 2 basic chemistry vocab 2023-09-25

14 Items: the outermost shell of any atomAnything that takes up space and has massnumber of protons within the nucleus of an atomScientific study of the properties and behavior of matterA substance that can't be broken down by non-nuclear reactionsthe mass of an atom of a chemical element expressed in atomic mass units...

word search 2026-05-08

15 Items: a push or pullthe unit for forcewhen you push a tablewhen you pull a chairtiny partials in atomswhen two magnets pull togetherthings that can connect to metalkeeping two objects close togetherthe arrow pointing up on a compassthe arrow facing down on a compassa magnet that tells you directionstiny things that are in everything...

Science Vocabulary Wordsearch 2016-10-17

23 Items: atomgroupprotonmetalsperiodneutronnucleuselectronelementshalogenscompoundsmoleculesbohr-modelnet-chargenon-metalsmetalloidsatomic-massenergy-levelatomic-numberelectron-cloudperiodic-tablevalence-electronphysical-properties

Extra Extra Credit 2023-05-19

30 Items: preyrocksatomschangescienceelementnaturalecologyspeciesclimateerosionchemicalreactionmoleculebalancedpredatorabrasionresourcesrenewablesymbiosismutualismearthquakeparasitismendangeredweatheringengineeringrespirationconservationcommensalismphotosynthesis

Extra Extra Credit 2023-05-23

30 Items: preyrocksatomschangescienceelementnaturalecologyspeciesclimateerosionchemicalreactionmoleculebalancedpredatorabrasionresourcesrenewablesymbioticmutualismearthquakeparasitismendangeredweatheringengineeringrespirationconservationcommensalismphotosynthesis

Word Search 2026-05-11

30 Items: erasilkriskyboundhurryhobbyrhymeatomsnovelcruisecatchyoptionentirepostedmillionpensionleadersuncleanfictionaudienceconsiderestimateoppositewatchingexpensiveinvestmentfriendshiptemporarilydevelopmentpolynomials

Chapter 4 Vocab 2025-10-02

15 Items: a row of chemical elementsthe basic building block of mattera subatomic particle that is found in all atomsthe total number of protons and neutrons in an atoma subatomic particle with a positive electric chargea column in the periodic table of the chemical elementsthe quantity of matter contained in an atom of an element...

DNA Isolation Methods 2024-12-15

30 Items: A buffer designed to lyse cells and release DNA.Biological macromolecules that include DNA and RNA.Using alcohol to make DNA insoluble for easy recovery.A chemical used in phenol extraction to reduce foaming.The amount of DNA recovered from an extraction process.A membrane material in spin columns used to capture DNA....

Science vocabulary search -Ms. Rakam's Class 2024-08-07

31 Items: cellForceAtomsEnergyMotionMatterBiologyPhysicsPlanetsProductElementsChemistryAstronomyEcosystemRadiationPollutionFoodchainAtmosphereSoundwavesLightwavesSolarenergyRespirationChloroplastMitochondriaKineticenergyPeriodictableGlobalwarmingPhotosynthesisPotentialenergyElectromagneticGreenhouseeffect

Environmental Science 2025-05-15

20 Items: ALBEDOTRAGEDYCONVECTIONCORALREEFSBIODIVERSITYWater that is safe to drinkCost-benefit analysis involves ___ assessmentDeepwater ___ spill made front page news in 2010Storing rainwater is one method to ___ freshwaterthe transfer of energy as heat through a materialLakes that create an abundance of nutrients are __...

Chapter 3 2026-03-26

18 Items: A reaction that absorbs energy from the surroundings.The substances formed as a result of a chemical reaction.A bond formed by the sharing of electron pairs between atoms.The starting substances on the left side of a chemical equation.The written representation of a chemical reaction using symbols....

Sustainable Development Goals 2026-03-10

17 Items: no-povertyzero-hungerlife-on-landclimate-actiongender-equalitylife-below-waterquality-educationreduced-inequalitygood-health-and-well-beingclean-water-and-sanitationpartnerships-for-the-goalsaffordable-and-clean-energydecent-work-and-economic-growthsustainable-cities-and-communitiespeace-justice-and-strong-institutions...

Hollow Knight Word Search 2025-11-10

20 Items: Main character of Hollow KnightShopkeeper and wife of --------Everyday bugs turned into -----ASCEND, ASCEND ASCEND WITH ----Slow buzzing bugs without a mindLittle bugs simply enjoying lifeA dreamer of knowledge and master ofA lonely explorer and servant of ------Mapmaker, explorer, and husband of -----A dreamer of beasts and mother of ------...

CHEMICAL BONDING 2023-03-08

30 Items: ionsatomsionicanioncationsolidsmoltenforcesvalencebrittleorganicsolventcovalentmoleculenonmetalmetallicfreezingcrystalsmoisturestructuredissolvedinsolublecompoundsradiationexplosionattractivecrystallineelectrolytehybridizationelectroneutrality

Unit 3: Matter and Energy in an Ecosystem (Amplify Science 6th Grade) 2026-04-24

30 Items: fatatomsinputmatterbioticcarbonenergyoutputstarchsystemabioticbiodomedioxideconnectstorageglucoseproductcellularconsumerglycogenmoleculeproducerreactantecosystemorganismsdecomposerrespirationchloroplastmitochondrionphotosynthesis

Active & Passive Transport 2025-09-25

13 Items: What does ATP do?How does the cell make ADP?What are phospholipids made of?What is a phospholipids function?What are the two types of transport protein?What way does the concentration gradient go?How much sodium is put into a sodium-potassium pump?How much potassium is put into a sodium-potassium pump?...

Energy Word Search 2025-11-17

24 Items: Heat energyLight energyTop of a waveHow energy movesHeight of a waveBottom of a waveHow energy movesEnergy due to motionBaseline for the wavesBall rolling down a hillEnergy in food and batteriesEnergy in moving machine partsHow often a wave passes a pointDistance between repeating pointsEnergy stored in the nucleus of atoms...

Kornelia's Wordsearch 2023-11-02

21 Items: a happy boyPolish and is good at mathsa quiet girl who can kick youcan be anoying but is alrighta football and a sporty playerlike Richard but is from Lybiabrunette and is good at scienceBlonde and is good at gymnasticsa cricket fan and is good at P.Ea cool and totally vibing person.is funny and is friends with Eesais funny and does not like school...

Experimenting In The Unknown 2025-04-06

11 Items: First antibioticDeveloped the atomic bombItalian physicist discovered atomic fissionScottish scientist that discovered penicillinPolish-born French scientist that worked in radioactivityFreud’s method of studying the unconscious and its effect on behavior.Splitting of the nuclei of atoms in two to create a huge burst of energy...

Earth and space 2025-07-29

31 Items: GasWaterAtomsStarsOrbitOxygenPetrolDieselMotionCosmosCometsNewtonsPlanetsRocketsGravityFrictionTornadosHydrogenElectronsVolcanoesSatelliteAsteroidsWhiteholeDarkmatterBlackholesSolarsystemWindturbinesDwarfPlanetsKineticenergyRadiofrequencyChemicalcompounds

Energy 2025-03-19

13 Items: stored energyenergy from the sunheat transfer through wavesenergy of motion and movementpotential energy stored in atomsheat transfer from direct contactrenewable resource of kinetic energythe ability to cause motion or changeheat transfer through liquids and gasescombination of potential and kinetic energy...

Suspensions Word Search 2025-03-26

35 Items: ion with (-) chargealso known as basesgas with pungent ordereasily absorbs moisturesubatomic with (+) chargecontraction of surface agentsion with (+) electrical chargeparticles with negative chargemixture of 2 or more substancessimplest form of chemical matterrapid oxidation of heat and lightsubatomic particles with no charge...

NUR155 Miss Brown Exam 2 Vocabulary 2024-11-05

41 Items: Low SodiumIrrigationFiltering UnitLoss of appetiteInflammation of a veinCan cause renal calculiWound Ostomy Care NurseDifficulty in swallowingCauses cellular swellingAny fat found in the bodyPulls water from the cellShould look red and beefyMalignant growth in colonNarrowing of blood vesselsSurgically created openingInability to control urine...

Lesson 2 2025-03-05

32 Items: dotgasbondballnoblepolarstickatomsspacewatersingletriplecarbondoubleprotonoxygendiagramformuladioxideneutronsharingspherescovalentelementshydrogenmoleculenonmetalchemicalelectronsubscriptstructuralarrangement

Cells 2025-08-01

23 Items: Makes ribosomesThe powerhouse of the cellThe control center of the cellOrganism that makes its own foodGuides proteins to the Golgi BodyUsing the sun's energy to make foodOrganism that cannot make its own foodControls what goes in and out of nucleusDiffusion of water across cell membranesWhere photosynthesis takes place, is green...

stem word search 2023-01-03

30 Items: aibotsungastopgmathstarlavabangholechessatomslightspacemagmasystemgalaxysciencebuggatibiologyanatomyjupitergeologyvolcanohydrogencomputercalandareruptiontechnologyengineering

Relativeatomicmass Word Search 2025-09-21

38 Items: two or more atoms bonded togetheratoms with the same number of protonscolumns going down the periodic tablerows that go across on the periodic tableA spherical orbital found in all energy levels.Outer most shell that is occupied by electrons.Electrons occupy orbitals singly before pairing up.A substance formed as a result of a chemical reaction....

Chapter 11 Word Search 2024-05-03

37 Items: the outermost layer of our atmospherethe lowest layer of Earth's atmospherean instrument that measures temperaturemeasures the distance north or south of the equatorwinds that occur in belts that go all around the planetan instrument that measures wind speed and wind pressure.heat-driven cycles that occur in the air, ocean, and mantle...

Advanced Science and Future Technologies 2025-04-14

10 Items: Exoplanet : A planet that orbits a star outside our solar system.Cryogenics : The study of materials at extremely low temperatures.Drone : An unmanned flying device controlled remotely or autonomously.Photonics : The science of using light (photons) to transmit information.Biomimicry : Designing technology inspired by nature’s models and systems....

Words - 4/07/2024 2024-07-03

8 Items: - This is something sharp and will be used on some deers _______- Military officers will do this alot when walking with their party. ________- We will be this when it is a fun and joyful moment this is called _________- This will be used on buildings sometimes and it is very strong and shiny. _____...

Search the Universe 2024-06-21

34 Items: gassunmoondustcereslightcomettitanheliumplanetgalaxynebulajupiterbigbangclusterneptunemeteorsasteroidredgianthydrogenmagnetarmilkywayganymedesatellitesupernovatelescopeblackholemoleculesalienlifedarkmatterwhitedwarfneutronstarconstellationslivingorganism

Tema 6 Disoluciones - Ingles 2026-03-16

34 Items: GasMassSaltIonsSolidGramsPolarSoluteLiquidLitersVolumeOxygenChargeSolventMixtureDilutedCrystalSolutionPolarityMoleculeNitrogenParticlesMoleculesSaturatedHydrationProportionSolubilityHomogeneousTemperatureQualitativeTransparentConcentratedQuantitativeConcentration

Early Autumn 2023-01-19

20 Items: strugglesPaul's dadPaul's mommain characterPatty's and Mel's Sonfeels alone and worriedfeels powerful and toughhas no idea and cluelessPaul's partner in this caseto be brave and not back downhave's kids and marries a husbandto get ahead and work really hardto help others and be nice to people.to lift up your shoulders to your ears...

Fabing Wedding Celebration 2024-10-10

46 Items: Trevor's long time friend who lives in MontanaTom coaches football with Trevor for the BalersCasey's aunt and the best travel agent out thereCasey's oldest niece who just bought a motorcycleCasey's mom who officiated Trevor and Casey's weddingCasey's cousin who owns more DVDs and VHS than anyone!...

6TH 2025-04-23

33 Items: fatgolfAlackatomssharpinputcarbonoutputrecantstarchsystemsafetybiodomebulldogconnectglucoseproductrespecthonestyconsumerglycogenmoleculeproducerkindnessecosystemorganismsworkethicdecomposerbasketballchloroplasttrustworthyparticipatejordanisgoat

Bluedream Word Search 2023-08-23

20 Items: A sativa-dominant hybrid known for its uplifting and creative effects.A sativa strain known for its psychedelic effects and purple-tinged buds.A potent hybrid strain known for its sticky resin and heavy-handed effects.A sativa strain with a strong citrus aroma and uplifting, creative effects....

Body Positivity 2024-07-21

15 Items: - Physical power and endurance.- Energy and enthusiasm for life.- Ability to recover from setbacks.- Belief in one’s abilities and worth.- Embracing one’s body and imperfections.- Feeling of being in control and confident.- A feeling of great pleasure and happiness.- Elegance and poise in movement or behavior....

Extra Extra Credit 2023-05-17

33 Items: preyrocksatomsscienceelementnaturalecologyspeciesclimateerosionigneouschemicalreactionmoleculebalancedequationpredatorabrasionresourcesrenewablesymbiosismutualismearthquakeparasitismendangeredweatheringengineeringrespirationmetamorphicsedimentaryconservationcommensalismphotosynthesis

science 2023-05-12

6 Items: change in moisture contentthe weight of the molecules in a large mass of airinstrument that measures wind speed and wind pressureforms when a colder air mass moves towards a warmer air masslarge bodies of air that have uniform temperature, humidity, and pressure...

science 2023-05-12

6 Items: change in moisture contentthe weight of the molecules in a large mass of airinstrument that measures wind speed and wind pressureforms when a colder air mass moves towards a warmer air masslarge bodies of air that have uniform temperature, humidity, and pressure...

science 2023-05-12

6 Items: change in moisture contentthe weight of the molecules in a large mass of airinstrument that measures wind speed and wind pressureforms when a colder air mass moves towards a warmer air masslarge bodies of air that have uniform temperature, humidity, and pressure...

science 2023-05-12

6 Items: change in moisture contentthe weight of the molecules in a large mass of airinstrument that measures wind speed and wind pressureforms when a colder air mass moves towards a warmer air masslarge bodies of air that have uniform temperature, humidity, and pressure...

Body Positivity 2024-07-22

15 Items: Physical power and enduranceThe ability to bend and adaptEnergy and enthusiasm for lifeAbility to recover from setbacksBelief in one’s abilities and worthEmbracing one’s body and imperfectionsFeeling of being in control and confidentA feeling of great pleasure and happinessElegance and poise in movement or behavior...

Electricty Wordfind 2017-08-26

35 Items: AmpOhmVoltFuseWattWireCellAtomsDiodePowerMatterEnergyCurrentNeutralProtonsNucleusCircuitCurrentAmmeterBatteryNeutronsTerminalResistorRheostatElectronsVoltmeterPowerPackConductorsInsulatorsComponentsResistanceSeriesCircuitCircuitDiagramPotentialEnergyParallelCircuit

Physics word search 2025-06-14

28 Items: - When atoms decide to form a group chat- How often you check your phone per minute- How loud your neighbor's music is at 2 AM- What your body has to waking up on Monday mornings- What happens to your heart rate during a physics exam- The reason you're still on the couch watching Netflix- Why your room gets messy faster than you can clean it...

Music Careers 2026-05-11

25 Items: Writes original music.Writes the words for songs.Finalizes audio for release.Performs music using their voice.Records and adjusts sound quality.Controls sound during live events.Teaches music skills and knowledge.Gives one-on-one music instruction.Creates songs with music and lyrics.Mixes and plays recorded music live....

Cellular Respiration 2025-10-31

20 Items: Means with OxygenMeans without OxygenSite of the 3rd stageSite of the Krebs CycleProduct of Alcoholic FermentationFinal stage of cellular respirationProduct of Lactic Acid FermentationTaken in and used in the final stageThe 2nd stage of cellular respirationFormed in the final stage and releasedThe first stage of cellular respiration...

Element Facts 2024-12-18

24 Items: found in batteriesmetal found in saltadded to toothpasteneeded for strong bonesmain component of steelused in electric wiringfound in lights and signsfound in laundry detergentused for balloons and blimpsneeded for hormone regulationfound in disinfectant and bleachused in powerful permanent magnetsused in jewelry and in photographic toner...

After Test Wordfind 2017-09-19

34 Items: heatatomswavessoundnervelightsonarenergyvacuumanglessciencesilencedonohuechemicalcompoundcochlearossiclesdeafnessparticlesradiationvibrationinsulatorchocolatecombustionconductionconvectionreflectionrefractionexplosionsultrasoundcompressionrarefactiontransmissionelectromagnetic

easy science word search. 2024-03-20

35 Items: hardgoldhuskroughatomsmetalsteamalloymetalopaquemixinginventfiberselasticbrittlescienceprotonsplasticbendingflexiblemagneticsoulubleconcreteabsorbentmalleablecombiningprocessedchemicalsinventionmagnesiumwaterproofreflectivetransparenttranslucentcarborhydrates

Jalapeno homeroom students 2026-04-23

15 Items: No. 41Loves ClayMr. Avacadolove katseyeShe loves StitchLoves beyblades andThe Center of our classLoves makeup and perfumeLoves cheese and rubixcubeLoves basketball and fidgetsLoves math and skateboardingLoves Art and chicken nuggetsLoves Softball and going homeLoves dirtbiking and skateboardingLoves fidgets, Hello Kitty!, and Softball

Words in Chemistry, Physics, and Energy 2023-05-22

20 Items: Energy of lightGas to a liquidLiquid to solidEnergy of positionUnit to measure forceBonds between nonmetalsUnit for work and energyMakes reactions happen slowerGroup 17 on the periodic tableDefined as exerting a force over a distance_________ forces do not cause a change in motionChemical reactions that release energy to the environment...

What is a mineral? 2024-04-28

9 Items: A paste-like material made from minerals, used for coating walls and ceilings.makeup: The specific combination of elements and compounds that constitute a mineral.A powdery substance made from minerals, used in construction to bind materials together.A mineral used in ceramics, known for its distinct chemical composition and crystal structure....

Brianna Hart Ch.17 Vocab 2025-05-01

10 Items: Different molecular structures of the same element.Elements in groups 3 through 12 of the periodic table.Property of metals and alloys that allows them to be drawn into wires.Element that shares some properties with metals and some with nonmetals.Element, such as radium, whose nucleus breaks down and emits particles and energy....

Physical Science 2019-11-22

36 Items: DNAMapAcidBaseWaveBondCrestAtomsChangeClosedEnergySystemAlleleConceptDensityAsexualConceptSpeciesCurrentChemicalCompoundDissolveDistanceReactionAmplitudeConductorAttributesConductionConvectionAdaptationConclusionElectricalChromosomesReproductionConservationCompressional

C6 word search 2025-05-14

8 Items: wrensmithatomscellscooperWitheyplantsnucleus

Vocab 17 2025-05-06

10 Items: Can be drawn into wiresCan be hammered or rolled into sheetsDifferent molecular structures of the same elementElement in groups 3 through 12 in the periodic tableNucleus breaks down and gives off particles and energyElements that ae usually gases or solids at room temperaturePositively charged metallic ions are surrounded by a sea of electrons...

Engineers A to Z 2023-01-24

26 Items: Investigate force and motion by working in teams to complete design challenges and build ramps and pathways!Introduction. Genetic engineers alter, splice, eliminate, and rearrange genes in order to modify an organism or groups of organisms....

Stoichiometry 2025-05-05

12 Items: the mass in grams of one mole of a substancethe SI base unit used to measure the amount of a substancenumber of representative particles in a mole, 6.02 X 10^23expresses the mass ratio between different elements in a compoundthe reactant that is not completely used up in a chemical reaction...

Chp. 3 Review for final 2022-12-13

23 Items: one layercolumn shapedmultiple layersanchoring junctionscube shaped like a diceflattened and fish scalebinds cells together like a zippermoves materials across the surfacevoluntary and striations and multinucleatefunction is to protect and support the bodyinvoluntary and no striations and one nucleus...