atoms and molecules Word Searches

Elements Word Search 2025-12-16

9 Items: IonsMassAtomsProtonsElementsIsotopesNeutronsparticlesElectrons

Phase Change Word Search 2025-12-17

13 Items: definite shape and volumethe relative size of thingsa measure of how hot or cold something isto provide evidence that goes against a claimliquid changes into a gas (vapor) at the surfacea group of atoms joined together in a particular wayhas no definite shape or volume, filling its containerhas definite volume but takes the shape of its container...

Valence Word Search 2025-10-31

9 Items: bondsoxygencarbonprotonsneutronselectronsmoleculesmoleculeselectrons

Matter Vocabulary 2023-02-03

24 Items: massgasesatomssolidsmatterweightvolumerunoffliquidsmixturesolutiondissolvedparticlescollectionevaporationgroundwatercondensationflammabilityprecipitationtranspirationphysicalchangechemicalchangephysicalpropertychemicalproperty

All about Atoms 2015-12-22

10 Items: GainIonsLoseCellsNobleNucleusPeriodsProtonsElementsSmallest

Chemistry Search 2021-03-03

26 Items: baseacidlavaoozemassmagmaatomscarbonvolumevinegarvolcanodioxideexplodeprotonsreactionperoxideeruptionelectronneutronschemistrybakingsodacombustionmagmaventsexperimenttemperatureneutralization

Name: ___________________________ Date: _____ Biology Chapter 5 2025-10-01

27 Items: massfoodwaterlungsenergymatterstoredoxygenaerobicreleasedsunlightsurvivalorganismsbreathingmoleculesmembranesbiologistsbyproductschlorophyllrespirationmitochondriachloroplastscarbohydratessemipermeablephotosynthesissimplecarbohydratescomplexcarbohydrates

Cycle 1 Vocabulary Week 7 2024-10-16

12 Items: A layer of gases surrounding Earththe action or fact of forming a united wholethe basic chemical building blocks of matterA comparison of two numbers, shown as a ratioa flat, 2-dimensional, surface which extends infinitely farA meeting of people face to face, especially for consultationbring (goods or services) into a country from abroad for sale....

CH3 - Rocks and Minerals 2022-12-18

16 Items: The layer of rock that forms Earth's outer surface.________________________Process in which sediment is laid down in new locations.________________________A dense sphere of solid iron and nickel at the center of Earth.________________________The layer of hot, solid material between Earth's crust and core.________________________...

Lungs Word Search 2025-11-12

27 Items: DNAUnitLungsOrganheartmucusslidegenesOxygenairwaytraitsBronchismokingmagnifynucleusirritantlysosomemoleculesorganelleeukaryaticEquilibriumprokaryoticmitochondriacarbohydrateCarbonDioxidemacromoleculeplasmamembrane

Chemistry 2025-09-19

25 Items: massatomsionicdoublesinglematterchargeprotonselementbondingchemicalreactionneutronsmoleculecompoundcovalentcatalystelectronssynthesisbalancingsubscriptcombustionreplacementcoefficientconservation

Comprehensive Review 5th Honors Science 2025-10-02

26 Items: ioncoldmasscometforceatomsstormmeteorenergyinertiagravityJupiterkineticinertiacurrenttornadoupdraftsconstantmomentumreactionelectronsconductorsunbalancedaccelerationprecipitationelectromagnetic

Acid Word Search 2025-10-20

22 Items: Neutral particle found in the atom’s nucleusSubstance that changes color to show pH levelRate Speed at which a chemical reaction occursNegatively charged particle orbiting the nucleusPositively charged particle in the atom’s nucleusAmount of substance in a given volume of solutionScale that measures how acidic or basic a solution is...

Matter Word Search 2025-09-05

25 Items: MassAtomsMatterVolumeWeightProtonAtomosElementMixturemixturemixtureDensityMeltingNucleuspropertyCompoundFreezingElectronSocrateselementsDepositionDemocritusexperimentEvaporationSublimation

Ashleigh´s Word Search - T3W6 2023-08-23

27 Items: solidsitespropeldioxidesocietyhistorycurrentparticleheritagemoleculesdiversitypredictedprocessedproficientprecariouspredictingprotectiveproclaimedprocessingproclaimedpredicamentprosaicallydissipatingpreservationinteractionscelebrationspredominantly

Chemistry 2024-07-25

26 Items: ionironionicbondsprotonmetalsgroupslinearcarbonnickelcopperneutronisotopeperiodscrystaluraniumelectroncovalentelementshydrogennitrogenmoleculespyramidalnon-metalstransitiontriangular

science 2025-10-31

27 Items: DNAUnitslidegenesadapttraitsfossilmagnifynucleusproteinextinctprimatediseaselysosomemutationmoleculesorganelleevolutioneukaryaticEquilibriumprokaryoticneanderthalhomosapiansmitochondriacarbohydratemacromoleculeplasmamembrane

Incarnation Colossians 1:15-22 2025-12-11

25 Items: figwargolfworksizewordatomsyearsphotonnormalgardenhumansjustifytragedynothingimagineanythingcovenantuniversesupposedvirtuallybeginningscientistshopelesslysupernatural

Electrons in Atoms Word Search 2016-09-29

19 Items: spinhertzphotonquantumhundsruleamplitudefrequencywavelengthenergylevelgroundstateatomicorbitalaufbauprincipleplanck'sconstantquantummechnicalmodelelectronconfigurationatomicemissionspectrumpauliexclusionprincipleelectromagneticradiationheisenberguncertaintyprinciple

Supply Word Search 2026-02-19

28 Items: opencoilwirewireflowtexasshortmodelfieldatomscausescalesupplydemandenergysystemmagnetbackupcircuitbatteryinequitytradeoffdisparityelectronsgeneratorfluctuatereliabilitycorrelation

Elements & Compounds 2026-02-20

22 Items: charges.The number of protons in an atom.Describes a pattern that repeats.The smallest particle of a compound.Horizontal rows on the periodic table.Anything that has mass and takes up spaceElements that look dull and break instead of bend.The total number of protons and neutrons in an atom.A particle with no charge found in the nucleus of an atom....

Unit 1 Word Search 2025-09-17

25 Items: HeatMassWaterAtomsEnergySystemWeightVolumeKelvinBoilingMixtureKineticCelsiusFreezingElementsUniverseCompoundsOpenSystemFahrenheitHomogeneousTemperatureClosedSystemSurroundingsPureSubstanceHeterogeneous

States of Matter 2024-10-23

28 Items: gasheatflowmasssolidshapeliquidchangeplasmavolumeenergyspreadstatesmattermeltingboilingfreezingvibrationmoleculesdepositionionizationexothermicevaporationsublimationendothermiccondensationvaporizationrecombination

M'Kenna Mystery 2025-03-25

30 Items: ColonVilliSoresCeliacGlutenUlcersMKennaAnemiaChronsImmuneDiseasePainfulProteinFatigueColitisChronicProteinGeneticsIntestineAbdominalFattyacidAminoacidmoleculesDigestionAbsorptionIntoleranceDehydrationDiverticularInflammationCarbohydrate

Everything you need to know about matter 2025-11-13

7 Items: gassolidatomsliquidmatterparticlesevaporation

Physics S2 #1 2026-01-26

27 Items: openwindcoalcoilwirewireflowtexasshortmodelsolarfieldatomssteamsupplydemandenergysystemmagnetturbincircuitnucleartradeoffdisparityIinequityelectronsgenerator

LABORATOIRE DE CHIMIE 2024-09-02

30 Items: GazZincAcideAzoteFiltresArsenicEnzymesAlcalinSolvantsReactifsArticlesBouillirAtomiqueNeutronsChlorurePipettesMoleculesViscositeMicroscopeCatalyseurSulfuriqueRadioactifSublimationThermometreElectrolytesExothermiqueDistillationVolumetriqueCentrifugationNeutralisation

Quarter 3 Benchmark Review 2025-02-25

21 Items: law of inertialength traveledchange of positionany kind of stored energylaw of action and reactionan object slowing over timethe force that opposes motionthe tendency to float in a fluidany kind of energy due to motionforce equal mass times accelerationrate of the change of distance over timerate of the change in velocity over time...

Slime Time  2019-06-18

29 Items: goomukgunkglueoozegunkslimegrossboraxwaterdittogloopgrimerrubbersludgefluffyflubberscienceglitterstretchviscousslipperystretchycreaturemoleculesamorphoustransformlaboratoryexperiment

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substanceenergy in the form of heatenergy associated with motionable to dissolve other substances.the basic unit of a chemical element.the degree of compactness of a substancethe speed of something in a given direction.the rate of change of velocity per unit of time.the ability to be dissolved, especially in water....

Atoms Revision Grades 8 & 9 2025-04-06

24 Items: NPHFCKOBSHeAlClLiCaBeNaMgSiNeArcontains the protons and neutronssub-atomic particle with no chargenegatively charged sub-atomic particlepositively charged sub-atomic particle

Unit 3: Electrons in Atoms 2023-09-26

20 Items: 3.00 x 10^8 m/sHeight of a waveparticles of lightthe arrangement of electrons in an atomElectrons on the outermost energy level of an atomthe clockwise or counterclockwise motion of an electronthe possible energies that electrons in an atom can havenumber of complete wavelengths that pass a point in a given time...

Physics S2 #1 2026-01-26

27 Items: openwindcoalcoilwirewireflowtexasshortmodelsolarfieldatomssteamsupplydemandenergysystemmagnetturbincircuitnucleartradeoffdisparityIinequityelectronsgenerator

Linear Equations Word Search 2024-11-13

20 Items: slope: y=3x-5the "rate of change"y-intercept: y=12x+4slope: (5,1) and (8,3)slope: (6,3) and (1,8)slope: (16,14) and (2,7)slope: (-1,7) and (-1,5)slope:(7,12) and (-9,-8)slope: (-4,-3) and (1,-3)slope: (4,-10) and (2,-7)slope: (-15,6) and (1,-74)y-intercept: (7,2) and (2,7)y-intercept: (3,7) and (9,-3)y-intercept: (13,5) and (2,60)...

Sound Waves 2026-01-19

30 Items: gasforcepitchhertzsoliddeformmediummattervolumeliquidvacuumreflectdensityloudnesstransmitvibrationcollisionamplitudefrequencyparticlesmoleculeswavelengthemptyspacephenomenonsoundsourcecompressionrarefactionsoundreceiverkineticenergyenergytransfer

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substanceenergy in the form of heatenergy associated with motionable to dissolve other substances.the basic unit of a chemical element.the degree of compactness of a substancethe speed of something in a given direction.the rate of change of velocity per unit of time.the ability to be dissolved, especially in water....

chemistry 1 2019-03-18

27 Items: ionanionatomscationalkalisammoniaelementemulsionglycerinchemistryelectronscombustionemulsifierimmiscibleionizationlipophilicglycolicacidalkanolaminesacidicsolutionchemicalchangealkalinesolutionalphahydroxyacidscompoundmoleculeselementalmoleculeinorganicchemistrychemiacalpropertiesexothermicreactions

SCIENCE WORDS 2 2024-04-18

30 Items: naturevolumeweightanalyzebeakersbiologygeologygravityhabitatkineticplanetsprotonssystemsweathercatalystclassifyevaluatefrictionneutronsorganismresearchvariableastrologydetermineelectronsmoleculeslaboratorymicroscopetechnologydistinguish

The Chemistry of Life 2024-10-02

29 Items: AtomAcidsBasesSoluteCarbonLipidsIsotopeSolventPHscaleBuffersElementsCompoundSolutionMonomersPolymersProteinsIonicbondMoleculesFattyacidsAminoacidsSuspensionsLifescienceNucleotidesCovalentbondNucleicacidsCarbohydratesMacromoleculesPhysicalscienceMonosaccharides

Chemistry 1 2019-03-18

27 Items: ionanionatomscationalkalisammoniaelementemulsionglycerinchemistryelectronscombustionemulsifierimmiscibleionizationlipophilicglycolicacidalkanolaminesacidicsolutionchemicalchangealkalinesolutionalphahydroxyacidcompoundmoleculeselementalmoleculechemicalpropertiesinorganicchemistryexothermicreactions

Science 2025-07-21

20 Items: poisonousbiological catalystpH <7; turns litmus reddisease causing microbepolymer made up of amino acidsone of the 5 Kingdoms, think mushroomoccurs in chlorophyll, plants do thisa place where there is no matter at allhaploid cell used for sexual reproductionsolution that has passed through a filterforce of attraction between atoms or ions...

Physical Properties of Matter 2023-11-05

17 Items: How shiny things can beAll matter is made of theseTwo or more atoms put togetherMixture that is uniform throughoutMixture that is not uniform throughtoutWhen something is easy to break or chipSomething that allows energy to move throughWhen a substance changes from a liquid to a gasWhen a substance changes from a gas to a liquid...

Advanced Science and Future Technologies 2025-05-30

10 Items: A planet that orbits a star outside our solar system.The study of materials at extremely low temperatures.Designing technology inspired by nature’s models and systems.The science of using light (photons) to transmit information.An unmanned flying device controlled remotely or autonomously....

science review wordsearch 2023-06-01

22 Items: Unit for workThe transfer of heat in the form of wavesHighly reactive nonmetal elements in group 17Solution that has more solute than the solventHow tightly packed the atoms are in a substanceDescribes both the speed and direction of an objectReactions that release thermal energy when they react...

Hero's of Millennials 2023-01-31

19 Items: Actress and humanitarian.Comedian, actress, and writer.Actress, UN Women Goodwill AmbassadorMusician, actress, and philanthropist.Musician, actress, and philanthropist.COO of Facebook and best-selling author.Co-founder, chairman and CEO of Facebook.Musician, songwriter, and philanthropist.Media mogul, philanthropist, and producer....

Chemistry MI project 2023-02-16

20 Items: H2ONaClOrganizes elementSymbol H, number 1symbol K, number 19symbol S, number 16Symbol Fe, Number 26symbol Ca, number 20Symbol Ti, number 22symbol Co, number 27symbol Ag, number 47symbol Zn, number 30symbol Kr, number 36What atoms want to beLiquid, atomic symbol Br,Bond between metal and nonmetalAmount of protons in an element...

Types of Bonds 2025-10-04

10 Items: An ion made of more than one atom.A chemical bond formed when two atoms share electrons.Describes a covalent bond where atoms share two pairs of electrons.Bonding that involves the attraction between ions of opposite charge.Describes a covalent bond where atoms share three pairs of electrons....

Periodic table 2024-11-20

31 Items: tablelevelinertdecaymetalsenergygroupsalkalitracerprotonsperiodsisotopehalogenductilethermalelementsneutronsperiodicdiatomicnonmetalselectronsmoleculescompoundsmalleablesemimetalsmetalloidsatomicmasstransitionelectricalradioactivesemiconductor

CHEMICAL LABORATORY 2024-09-02

30 Items: AcidZincGasesAtomicBoilingFiltersArsenicEnzymesSolventsReagentsNitrogenElementsCatalystAlkalineSulfuricNeutronsChloridePipettesMoleculesViscosityMicroscopeExothermicVolumetricSublimationThermometerRadioactiveElectrolytesDistillationCentrifugationNeutralization

Atom Word Search 2024-07-18

12 Items: Genetic materialBasic unit of matterBuilding block of lifeNerve cell in the bodyForce attracting objectsTest to prove a hypothesisStudy of matter and energyChange in species over timeCommunity of living organismsGroup of atoms bonded togetherProcess plants use to make foodStudy of substances and reactions

Mercury WorkSheet 2024-02-21

19 Items: hotwindrayseightfieldatomswatersodiumheliumclosesttornadoneutralchargedshadowssmallestringlessmoonlessexospheregrayish-brown

VĀRDU KOSMOSS 2024-08-29

30 Items: RSUBALLEATOMSIZPĒTEMISIJAZINĀTNEKOSMOSSTEORIJALIDOJUMSSTUDIJASSTUDENTIATBILDESIZGLĪTĪBAGALAKTIKATELESKOPSVIEDOKLISINOVĀCIJASASNIEGUMIABSOLVENTIZINĀTNIEKSDIPLOMDARBSDISERTĀCIJAGRAVITĀCIJABIOMEDICĪNAASTRONOMIJAAPBALVOJUMSKOMUNIKĀCIJAASTRONAUTIKAUNIVERSITĀTESTARPTAUTISKS

Curie and Einstein 2025-02-05

30 Items: LabMathCurieNobelAtomsPrizeMarieRadiumEnergyFamousTheoryX-raysGeniusPhysicsScienceUraniumQuantumEinsteinPoloniumParticleResearchDiscoveryRadiationProfessorInventionChemistryRelativityExperimentInnovationRadioactivity

first 3 topics 2025-02-05

30 Items: DenseAtomsGroupcellsStainMatterLiquidEnergyBrittleMagnifyInfraredElementsHalogensParticlesNonmetalsStrontiumconductionInsulatorsTransitionMicroscopeEvaporationElectricitySpecialisedCellmembraneRedbloodcellEyepiecelensLivingthingsDoubleglazingPeriodictablephotosynthesis

Engineers Word Search 2023-01-17

26 Items: maintains and repairs x-ray equipmentengineering involved in all aspects of healthcareDevelop and design nuclear products and processesCoaster designs, builds and maintains amusement park rides.processes and analyzes LiDAR point clouds for anomalies and artifacts.improving the manufacturing process to increase the yield of products....

Chemical Reactions and Enzymes 2026-03-04

14 Items: when an enzyme changes shapethe elements or compounds that enter into a chemical reactionthe elements or compounds that are made by a chemical reactionthe region of an enzyme to which the substrate binds. (the pocket)when an enzyme is changed in shape due to a change in temperature or pH...

Density and Matter (Try to define all the words) 2017-03-09

30 Items: gassinksizemasswaterfloatsolidcolorshapematterliquidvolumedensitymeltingboilingtexturemixturefreezingpropertydissolvesolutionchemicalphysicalparticlemoleculesevaporatemagnetismcondensatesolubilitycharacteristic

spelling T3 WK6 2023-08-23

30 Items: solidpropelprotectamateurpreviousparticalidentitycalenderofficialschedulemoleculessubstancepreciselyprecisionprocedingproficientprecariousaustralianpreviouslypredicamentprosaicallydemonstratepredictablepredicttionproficiencyprogressionprohibitionpredominatlyproficientlynaturalisation

CHEMISTRY EXTRA CREDIT 2026-02-12

28 Items: ACIDIONSPOLARATOMSDIPOLEFORMULACHARGESNONPOLARMOLECULEELEMENTSCHEMISTRYIONICBONDSUBSTANCENONMETALSNOBLEGASESMETALLOIDSVSEPRTHEORYMETALLICBONDCOVALENTBONDHYDROGENBONDGEOMOLECULARINTERMOLECULARINTRAMOLECULARLEWISSTRUCTUREVALENCEELECTRONLONDONDISPERSIONTRANSITIONMETALSELECTRONEGATIVITY

Spelling list 2024-05-23

20 Items: nation wideattracts metalan act of movingand area of groundany basic substancenonmechanical deviceright now or presenta process in the bodyto represent somethinga way to measure energyphysical force on somethingspeaking between each othersomething that happens anuallyconnect with someone or somethingused in ordinary or basic conversation...

Earth Science CH 2 2016-01-18

30 Items: IonGasBohrMassBondAtomsForceIonicStateSolidMatterLiquidPlasmaProtonsmixtureDensityElementsNeutronsisotopesCompoundMoleculeCovalentMetallicHydrogenSolutionElectronsMassnumberhomogeneousAtomicnumberHeterogeneous

Foundational Body Systems (Part 1) 2025-10-21

30 Items: AtomsWaterCarbonCytosoMatrixProtonsNeutronsElementsIsotopesVacuolesElectronsCompoundsFormationAutophagyCelluloseSolutionsChromatinIonicBondsLeukoplastsChromosomesNucleoplasmChromoplastsChloroplastsCovalentBondsHydrogenBondsCarbonDioxideCarbohydratesPhotosynthesisGolgiApparatusMolecularOxygen

science 2024-05-17

15 Items: a solid collection of mineralsdistance from one crest to anotherbasic particles of the chemical elementsthe amount of three-dimensional space that matter occupies.temperature at which a liquid turns into a solid when cooled.point temperature at which a liquid turns into a solid when cooled....

Chemistry MI project 2023-02-16

20 Items: H2ONaClOrganizes elementSymbol H, number 1symbol K, number 19symbol S, number 16Symbol Fe, Number 26symbol Ca, number 20Symbol Ti, number 22symbol Co, number 27symbol Ag, number 47symbol Zn, number 30symbol Kr, number 36What atoms want to beLiquid, atomic symbol Br,Bond between metal and nonmetalAmount of protons in an element...

Weather 2023-01-09

32 Items: masssnowhailrainwindforcesleetoxygencloudsupdraftgravityinflatedeflatemovementnitrogenhumidityaltitudedowndrafthygristorbarometerelevationmoleculesdepositionradiosondewatervaporwatercycleevaporationthermometertemperaturecumulonimbuscondensationprecipitation

Review 2023-11-14

32 Items: gassolidgroupanionmetalmatterliquidplasmaperiodcationelementneutrondensitycompoundelectronnonmetalnoblegasmoleculesionicbondmetalloidhomogenousmassnumberdepositionsublimationheterogenousatomicnumbervaporizationcondensationcovalentbondphysicalchangeschemicalchangesvalenceelectron

HLTAAP001 Healthy body systems 1 2024-04-02

30 Items: dnacellatomsnerveheartlungsbrainrenalorgansimmunemuscleuteruskidneyanatomytissuesnucleuscytoplasmendocrinedigestivelysosomesintestineorganellesphysiologyconnectiveepithelialreproductivemitochondriaintegumentaryintegumentarymusculoskeletal

Bio Study Word Search 2025-09-22

30 Items: A living thingAbility to do work.Smallest unit of life.energy Energy in motion.energy Energy of positionprotein A protein that spans the lipid bilayer.The ability to conduct metabolism and reproduce.backbone Spine of DNA where nucleic acid connects.Large molecule made up of strings of covalently bonded monomers....

Elements Word Search 2024-01-17

19 Items: one cycle per minuteouter ring of electronssmallest units of an elementthe steps necessary in a processpositively charged elementary particleselementary particles with no electrical chargethe flow of electrons from atom to atom in a conductorthe movement of electrons being directed through materials...

Matter and Energy in Ecosystems 2026-03-09

29 Items: FatAtomsInputBioticMatterCarbonEnergyOutputStarchSystemAbioticBiodomeDioxideConnectStorageGlucoseCellularConsumerMoleculeGlycogenProducerReactantEcosystemOrganismsDecomposerRespirationChloroplastMitochondrionPhotosynthesis

Science vocabulary search -Ms. Rakam's Class 2024-08-07

31 Items: cellForceAtomsEnergyMotionMatterBiologyPhysicsPlanetsProductElementsChemistryAstronomyEcosystemRadiationPollutionFoodchainAtmosphereSoundwavesLightwavesSolarenergyRespirationChloroplastMitochondriaKineticenergyPeriodictableGlobalwarmingPhotosynthesisPotentialenergyElectromagneticGreenhouseeffect

ch.8 science 2024-12-02

8 Items: sort and package proteinsstructures that make proteinswhere energy is produced from food- store water, food, and waste productsa gelatin-like substance inside the cellwall membrain a protective layer that covers the celllargest organelle; It controls all activities of the cellbreak down food molecules, cell wastes, and worn out cell parts

Kitchen Scientist 2025-01-13

9 Items: Heat from the sunBacteria converts sugars to acidTogetherness due to movement and energyMeasure of a fluid's resistance to flowWheat protein that gives a chewy texturesubstance found in the cell walls of algaeFluids that break Newton's law of viscosityMixture of two liquids that normally do not mix...

chapter 2 basic chemistry vocab 2023-09-25

14 Items: the outermost shell of any atomAnything that takes up space and has massnumber of protons within the nucleus of an atomScientific study of the properties and behavior of matterA substance that can't be broken down by non-nuclear reactionsthe mass of an atom of a chemical element expressed in atomic mass units...

chapter 2 basic chemistry vocab 2023-09-25

14 Items: the outermost shell of any atomAnything that takes up space and has massnumber of protons within the nucleus of an atomScientific study of the properties and behavior of matterA substance that can't be broken down by non-nuclear reactionsthe mass of an atom of a chemical element expressed in atomic mass units...

chapter 2 basic chemistry vocab 2023-09-25

14 Items: the outermost shell of any atomAnything that takes up space and has massnumber of protons within the nucleus of an atomScientific study of the properties and behavior of matterA substance that can't be broken down by non-nuclear reactionsthe mass of an atom of a chemical element expressed in atomic mass units...

Science Vocabulary Wordsearch 2016-10-17

23 Items: atomgroupprotonmetalsperiodneutronnucleuselectronelementshalogenscompoundsmoleculesbohr-modelnet-chargenon-metalsmetalloidsatomic-massenergy-levelatomic-numberelectron-cloudperiodic-tablevalence-electronphysical-properties

DNA Isolation Methods 2024-12-15

30 Items: A buffer designed to lyse cells and release DNA.Biological macromolecules that include DNA and RNA.Using alcohol to make DNA insoluble for easy recovery.A chemical used in phenol extraction to reduce foaming.The amount of DNA recovered from an extraction process.A membrane material in spin columns used to capture DNA....

Sustainable Development Goals 2026-03-10

17 Items: no-povertyzero-hungerlife-on-landclimate-actiongender-equalitylife-below-waterquality-educationreduced-inequalitygood-health-and-well-beingclean-water-and-sanitationpartnerships-for-the-goalsaffordable-and-clean-energydecent-work-and-economic-growthsustainable-cities-and-communitiespeace-justice-and-strong-institutions...

Chapter 4 Vocab 2025-10-02

15 Items: a row of chemical elementsthe basic building block of mattera subatomic particle that is found in all atomsthe total number of protons and neutrons in an atoma subatomic particle with a positive electric chargea column in the periodic table of the chemical elementsthe quantity of matter contained in an atom of an element...

Extra Extra Credit 2023-05-19

30 Items: preyrocksatomschangescienceelementnaturalecologyspeciesclimateerosionchemicalreactionmoleculebalancedpredatorabrasionresourcesrenewablesymbiosismutualismearthquakeparasitismendangeredweatheringengineeringrespirationconservationcommensalismphotosynthesis

Extra Extra Credit 2023-05-23

30 Items: preyrocksatomschangescienceelementnaturalecologyspeciesclimateerosionchemicalreactionmoleculebalancedpredatorabrasionresourcesrenewablesymbioticmutualismearthquakeparasitismendangeredweatheringengineeringrespirationconservationcommensalismphotosynthesis

Environmental Science 2025-05-15

20 Items: ALBEDOTRAGEDYCONVECTIONCORALREEFSBIODIVERSITYWater that is safe to drinkCost-benefit analysis involves ___ assessmentDeepwater ___ spill made front page news in 2010Storing rainwater is one method to ___ freshwaterthe transfer of energy as heat through a materialLakes that create an abundance of nutrients are __...

Hollow Knight Word Search 2025-11-10

20 Items: Main character of Hollow KnightShopkeeper and wife of --------Everyday bugs turned into -----ASCEND, ASCEND ASCEND WITH ----Slow buzzing bugs without a mindLittle bugs simply enjoying lifeA dreamer of knowledge and master ofA lonely explorer and servant of ------Mapmaker, explorer, and husband of -----A dreamer of beasts and mother of ------...

Chapter 3 2026-03-26

18 Items: A reaction that absorbs energy from the surroundings.The substances formed as a result of a chemical reaction.A bond formed by the sharing of electron pairs between atoms.The starting substances on the left side of a chemical equation.The written representation of a chemical reaction using symbols....

Energy Word Search 2025-11-17

24 Items: Heat energyLight energyTop of a waveHow energy movesHeight of a waveBottom of a waveHow energy movesEnergy due to motionBaseline for the wavesBall rolling down a hillEnergy in food and batteriesEnergy in moving machine partsHow often a wave passes a pointDistance between repeating pointsEnergy stored in the nucleus of atoms...

CHEMICAL BONDING 2023-03-08

30 Items: ionsatomsionicanioncationsolidsmoltenforcesvalencebrittleorganicsolventcovalentmoleculenonmetalmetallicfreezingcrystalsmoisturestructuredissolvedinsolublecompoundsradiationexplosionattractivecrystallineelectrolytehybridizationelectroneutrality

Lesson 2 2025-03-05

32 Items: dotgasbondballnoblepolarstickatomsspacewatersingletriplecarbondoubleprotonoxygendiagramformuladioxideneutronsharingspherescovalentelementshydrogenmoleculenonmetalchemicalelectronsubscriptstructuralarrangement

Experimenting In The Unknown 2025-04-06

11 Items: First antibioticDeveloped the atomic bombItalian physicist discovered atomic fissionScottish scientist that discovered penicillinPolish-born French scientist that worked in radioactivityFreud’s method of studying the unconscious and its effect on behavior.Splitting of the nuclei of atoms in two to create a huge burst of energy...

Kornelia's Wordsearch 2023-11-02

21 Items: a happy boyPolish and is good at mathsa quiet girl who can kick youcan be anoying but is alrighta football and a sporty playerlike Richard but is from Lybiabrunette and is good at scienceBlonde and is good at gymnasticsa cricket fan and is good at P.Ea cool and totally vibing person.is funny and is friends with Eesais funny and does not like school...

Active & Passive Transport 2025-09-25

13 Items: What does ATP do?How does the cell make ADP?What are phospholipids made of?What is a phospholipids function?What are the two types of transport protein?What way does the concentration gradient go?How much sodium is put into a sodium-potassium pump?How much potassium is put into a sodium-potassium pump?...

stem word search 2023-01-03

30 Items: aibotsungastopgmathstarlavabangholechessatomslightspacemagmasystemgalaxysciencebuggatibiologyanatomyjupitergeologyvolcanohydrogencomputercalandareruptiontechnologyengineering

Energy 2025-03-19

13 Items: stored energyenergy from the sunheat transfer through wavesenergy of motion and movementpotential energy stored in atomsheat transfer from direct contactrenewable resource of kinetic energythe ability to cause motion or changeheat transfer through liquids and gasescombination of potential and kinetic energy...

Earth and space 2025-07-29

31 Items: GasWaterAtomsStarsOrbitOxygenPetrolDieselMotionCosmosCometsNewtonsPlanetsRocketsGravityFrictionTornadosHydrogenElectronsVolcanoesSatelliteAsteroidsWhiteholeDarkmatterBlackholesSolarsystemWindturbinesDwarfPlanetsKineticenergyRadiofrequencyChemicalcompounds

NUR155 Miss Brown Exam 2 Vocabulary 2024-11-05

41 Items: Low SodiumIrrigationFiltering UnitLoss of appetiteInflammation of a veinCan cause renal calculiWound Ostomy Care NurseDifficulty in swallowingCauses cellular swellingAny fat found in the bodyPulls water from the cellShould look red and beefyMalignant growth in colonNarrowing of blood vesselsSurgically created openingInability to control urine...

Suspensions Word Search 2025-03-26

35 Items: ion with (-) chargealso known as basesgas with pungent ordereasily absorbs moisturesubatomic with (+) chargecontraction of surface agentsion with (+) electrical chargeparticles with negative chargemixture of 2 or more substancessimplest form of chemical matterrapid oxidation of heat and lightsubatomic particles with no charge...

6TH 2025-04-23

33 Items: fatgolfAlackatomssharpinputcarbonoutputrecantstarchsystemsafetybiodomebulldogconnectglucoseproductrespecthonestyconsumerglycogenmoleculeproducerkindnessecosystemorganismsworkethicdecomposerbasketballchloroplasttrustworthyparticipatejordanisgoat

Cells 2025-08-01

23 Items: Makes ribosomesThe powerhouse of the cellThe control center of the cellOrganism that makes its own foodGuides proteins to the Golgi BodyUsing the sun's energy to make foodOrganism that cannot make its own foodControls what goes in and out of nucleusDiffusion of water across cell membranesWhere photosynthesis takes place, is green...

Words - 4/07/2024 2024-07-03

8 Items: - This is something sharp and will be used on some deers _______- Military officers will do this alot when walking with their party. ________- We will be this when it is a fun and joyful moment this is called _________- This will be used on buildings sometimes and it is very strong and shiny. _____...

Chapter 11 Word Search 2024-05-03

37 Items: the outermost layer of our atmospherethe lowest layer of Earth's atmospherean instrument that measures temperaturemeasures the distance north or south of the equatorwinds that occur in belts that go all around the planetan instrument that measures wind speed and wind pressure.heat-driven cycles that occur in the air, ocean, and mantle...