plants Word Searches

Archie Word Search 2025-11-08

66 Items: elfjoylilpiedaveezrafinnlakelovemaiamayamimimosenikotallboonebuddydavidducksfokinfrankhelenjerryludiemandypeacearchiebarleybustercassiechancecheepachiefscooperfamilyhelenaninersoliviaplantsrylandsaintsturkeywalnutbartschfirepitfishinggeorgiaholidaymichaelnesbittnikolaipumpkinwalmartzvarichfootballlozowskicelebratecharlottegratitudehappiness...

Speak Review Wordsearch 2025-01-09

64 Items: IvyMegIceHanaLipsEvansEmilyTreesSeedsBirdsBloodWatermotherfatherNicoleMrNeckMsKeenPlantsWarmthFamilyMemoryTraumaSordinoHeatherFreemanSiobhanJessicaForestsMirrorsMeltingSilenceRealitySunlightHairwomanMsConnorsLibrarianToddRyderIsolationTheMarthasappearanceFriendshipLonelinessDepressionRachelBruinGretaIngridKyleRodgersMayaAngelouComingOfAge...

Natural Selection 2026-04-17

21 Items: fitnesssurvivespeciesvarietydescentdominantecosystemrecessiveevolutionbeneficialpopulationcompetitionmodificationnature will simply _______!differences in genetic traitsinherited like fur color, eye colorfather of natural selection/evolutionproducing more offspring can be supportedvariations that help an individual survive...

Types of out door Leaf plants 2026-05-21

7 Items: HostasRodgersiaLigulariaShieldLeafBearsBreechesGunneraManicataRodgersiaPodophylla

may 2025-05-01

5 Items: the season after winter and before summera hobby involving plants, crops, and flowersthe start of new beginnings, the process of changea word representing what you've learned and done, and what its changed for yougreek goddess of nature and growing plants that influenced the month of may was named after

Word Search puzzle grade 6 2024-12-06

20 Items: A new idea or creationPowers your home and devicesA story about someone’s lifeA home for animals or plantsA giant reptile from the pastThe study of stars and planetsA mountain that erupts with lavaTurning waste into something newThe force that keeps us on EarthAn exciting journey or experienceA group of people living together...

Disasters and Global Issues 2025-12-15

10 Items: The condition of being very poor.Being very overweight and unhealthy.Animals or plants that no longer exist.A long time with very little or no rain.A big fire that burns trees and forests.When oil leaks into the sea and pollutes the water.Animals or plants that may disappear in the future.The natural world around us, like air, land, and water....

Beluga science 2025-07-29

65 Items: mapdikemeltfishlandfloodgasessolidearthbirdslakespondsrocksfreezeliquidmapkeymatterpollenplantsforestriversoceansplainshabitatvolcanoanimalsbeachescareerschangescookingfarminginsectsseasonsengineererodionimaptitlenutrientpropertysolutionstrengthweaknessclimatesevidencehabitatsproblemshurricanelandslidewindbreakecologistmountainsearthquakereversible...

Recombinant-Dna-Technology Word Search 2024-12-16

30 Items: ProjectTherapyBt-CropsBio-FuelsTechnologyELISA-TestGolden-RiceGene-CloningGene-TherapyBio-ReactorsCry-ProteinsBio-PesticidesBio-RemediationCloning-VectorsBio-FertilizersEthical-ConcernsTransgenic-PlantsDNA-FingerprintingTransgenic-AnimalsRestriction-EnzymesTherapeutic-ProteinsBioinformatics-ToolsHybridoma-TechnologyMonoclonal-Antibodies...

MODULE 1D: WORD SEARCH 2025-03-15

15 Items: The sense of smell.A germ that causes disease.When plants grow towards light.A protein that helps fight infections.When plants move in response to touch.A quick automatic response to a stimulus.Neurons Nerve cells that control movement.cells White blood cells that make antibodies.System The body's defense against harmful germs....

CFA Review 2026-05-07

10 Items: an organism made of many cells is ____________an animal that only eats plants is a ____________a wolf hunting a rabbit is an example of a ____________plants are ____________ because they make their own fooda trait that helps an organism survive is an ____________animals are ____________ because they must eat food for energy...

UNIT 4 VOCAB 2023-10-06

26 Items: A period of time.A long span of time.A specific area in time.A place for storage of fluids.Earliest era in earths history.Remains of a prehistoric animal.A break in the continuous rock record.Numeric age of a layer of rocks or fossilsRecord of rock layers over a period of time.Living organism that shapes its environment....

Food Web 2025-11-06

13 Items: only eats plantseats plants and animalsonly eats others animalspretend version of somethingan animal that hunts and eats other animalsa living thing that eats other living thingsmany different food chains found in one placethe movement of material through an ecosysteman animal that is hunted and eaten by other animals...

The Natural Environment 2026-05-11

8 Items: the protection of natureillegally catch or kill animalsthe natural environment of an animal/planta situation in which a type of animal no longer existsbe likely to cause harm that share similar characteristicsa group of plants/animals that share similar characteristicsa situation in which an animal is kept in a zoo rather than being free...

Word saerch page 11 TYPES OF PLANTS 2015-07-21

8 Items: PINOÁRBOLPALMAHIERBACACTUSBAMBOOARBUSTOHELECHOS

Happy Earth Day! 2026-04-22

70 Items: SKYLAKEPONDSAFESOILAPRILCLEANEARTHMARCHOCEANOZONEPEACEPOLARPOWERPLANTREUSERIVERTREESWASTEWATERWORLDCHANGEDESERTENERGYFUTUREGLOBALGROWTHLITTERPLANETPLANTSREGIONREDUCEVALLEYANIMALSCLIMATEECOLOGYEROSIONEXTINCTFACTORYGARBAGEHARMONYNATURALNUCLEARPROTECTRAINBOWRECYCLESTEWARDVOLCANOWEATHERCREATIONINDUSTRYMOUNTAINPRESERVEWETLANDSWILDLIFEAWARENESSCONTINENT...

YLC5 - Unit 6 2025-10-30

10 Items: WaterThe SunCan be trustedStarting and StoppingHeat from planet EarthCreate or produce energyWhere electricity is madeMaterial from plants or animalsTo stop something from continuingMaking the Earth dirty or unhealthy

Bunny Word Search 2026-03-24

8 Items: A baby birdA sweet foodA small rabbitA colorful plantFeeling good and gladA round object from a birdA container to hold thingsThe season when plants grow

RICE PLANTING WORD SEARCH 2025-06-01

8 Items: Rice farmers work in P_ _ _ _ field.We eat the S_ _ _ _ of the rice plant.Rice plants need a lot of W_ _ _ _ to grow well.It takes a few M_ _ _ _ _ for rice plants to fully grow.When rice is ready to be picked, farmers H_ _ _ _ _ _ it.Farmers need T_ _ _ ,money and effort to grow their crops....

Plants and Their Parents 2025-12-05

4 Items: parentinheritseedlingoffspring

my random thoughts 2023-04-24

60 Items: gayredtheyoudaywolfropeeasebluefrogsongdragswagbatshavagooddanioamecadeathhappykoreatrollklekishardschoolsayoritypingplantshyphaepoisonshrimppacmanelgatocomedymissesiphonescabinetmonsterillegalaaaaaaacorycattestingamonguscoloradoautodeskwhiptailevacuatefloortileseamonkeyskulletonomegamartflusteredtwentyfivemicrophonediscordantblacksheepturiipipip...

Archie Word Search 2025-11-16

68 Items: ElfJoyLilPieDaveEzraFinnLakeLoveMaiaMayaMimiMoseNikoTallWalkBooneBuddyDavidDucksFokinFrankHelenJerryLudieMandyPeaceArchieBarleyBusterCassieChanceCheepaChiefsCooperFamilyHelenaNinersOliviaPlantsRylandSaintsTurkeyWalnutBartschFirePitFishingGeorgiaGrandpaHolidayMichaelNesbittNikolaiPumpkinWalmartZvarichFootballLozowskiCelebrateCharlotteGratitude...

Summer Camp 2025-07-21

70 Items: recbowtugwardyebagcampmesshalllakedockfistbumphighfivesnapclapjoinshowplayflagropelovecuteleaftreesalttotecabinrangearrowshakehandsswingloyalwaterbandssummercamperhikingtalentwisdomcleverplantsforestbucketglovesrubberarcheryfirepitcampingcaptureanimalsvinegarplasticcrackercampfireswimmingcanoeingkayakinghandsomestrengthcounselorhappinessbeautiful...

April 2026 Word Search 2026-03-23

70 Items: MudPalmRainThawBudsWarmGrowMeltEggsWormKiteAprilMonthBloomFoolsJokesGreenTreesGrassTaxesMuddyBunnyNestsWalksRainyRisenLambsSheepFreshEarthReuseCleanWorldFourthEasterSundaySpringPranksGardenPlantsSproutTulipsRabbitRobinsChicksHikingBreezeBonnetJoyfulPastelPlanetReduceOceansShowersBlossomRainbowPuddlesThawingRejoiceRecycleRainfallPassoverSunshine...

Grade 5 - Word Search 2026-05-15

70 Items: birdfishheadveinhostfungivirusalgaefernscoccibrainlungsheartliverchestbloodmolarvillimossesplantsmammallitteroxygenarteryatriumcanineureterstrokevectorjointsprotistanimalsfincheshabitatbacillispiralsreptileextinctextinctkidneysabdomenincisorurethrabladderneuronsobesitybacteriaconifersprotozoadiarrheadialysisdiabetesfloweringgalapagosamphibian...

Pests of Foliage & Flowering Plants 2025-12-01

5 Items: AphidMealyBugWhiteflySpiderMiteFungusGnat

Things We Learn about in Agriculture 2023-09-26

70 Items: ffasaesoillandpigsplowcorncostfeedmilkwoolboerbeefmeatrootscreedacresducksmulchdairysheepgoatstreesbreedcropspestswheatlaborseedslambspigmydairywaterdicotplantscattlenaturecottonsupplydemandchicksgrowthgrowingtiffanyanimalscombineerosionfarmersdroughtgroceryproducemonocotchickensnotchingproductssunlightlivestocknutrientsmachinerymarketingleadership...

Things Found in a Library 2026-02-05

67 Items: meCDsToysMazeNookDVDsSinkBooksMangaTablesChairsPlantsNoExitLaptopCoffeeHeavenCouchesWeepingPigeonsHistoryLostKidBeanbagBindersBlu-rayCamerasWormholeStudyingarchivesDatabaseBathroomLibrarianComputersPaintingsBookShelfCorkBoard3DprinteraudiobookmagazinesmicrofilmCassettesDictionaryCrimeSceneSpecticalsManuscriptNewspapersBoardGamesFiveBodies...

Vocabulary Lesson 8 2022-11-08

10 Items: The _____ of the word "bright" is "brightest."Building a bridge requires _____ calculations.The word _____ is similar to the term "exonerate."Some conflicts can be _____d by proper communication.After _____ing the data, the scientist concluded a trend.You can use a pesticide to kill plants and an _____to kill plants....

biology 2026-04-27

23 Items: single cellnumerous cellsremoval of wastemany food chainswhere animals livebuilding blocks of lifestudies how nature wordsbiology is a _ of sciencefeeding habit only for meatthe ability to have offspringfeeding habit only for plantsstudies how things are made ofsomething that eats its own foodsomething that makes its own food...

What Do Plants Need To Grow? 2025-03-24

6 Items: SunAirSoilSpaceWaterNutrition

Vocabulary 2024-10-30

48 Items: tentwillyummysweetjuicycamperchooseboringfutureleavescollecttonightprivatecrunchycampfirebranchestomorrowperuvianapartmentvacationswonderfulexpensivedangerousfind-foodnext-weekwhat-timenext-yearon-fridayimportantdifferentvocabularyevaluationcatch-fishpick-fruitread-a-mapdestinationin-two-daysgo-to-sleepintelligentaccomodationbeach-resort...

ROGELIO'S Word Search 2026-02-02

76 Items: FoxCupPackDeskLampJessNikeCityHeroCaseGangTallBagsCrazyFlagsBooksShoesBuggyAppleBloodGreenCurlyNightSuperBoardWaterPaperTimerBrentBrutalBrazilSchoolPlacesPlantsColorsPhonesSoccerSportsFlowerStatesGhettoFamilyArtistScreenExpandSnacksAmazingWarningJordansSweaterStreetsWindowsMorningHennesyStreetsUnknownRogelioBuildingAirMaxesMarylandComputerFootball...

Science Vocabulary 2026-05-27

20 Items: Moving energyStored energyA weather predictionWhat all cells are made ofA scientist who studies weatherThe longest bone in the human bodyA shovel is this type of simple machineThe simple machine used to raise a flagThe large teeth in the back of the mouthThe scientific name for a flowering plantThe layer of the atmosphere we breathe in...

Vocabulary Word Search #3 2023-04-14

12 Items: shakingstrangeannoyingreliablevery pleasinga quiet crying sounda musical instrumentused logical thinkingability to make plants growdoing things in a particular ordermoving very fast in a dangerous waya place where people serve a sentence from the courts

Records Word Search 2023-03-23

73 Items: cvasisteadeskmailtapeswinsaidpchbcartmaskkeysfilesboxesclockchairmouseemaillunchskypeteamsmicaselinkinwindowplantsreginacoffeerecordscubiclestaplermonitorprinterscannerwiteoutoutcardgarbagesortingletterselasticbasketsmarkersstoragechequesministrycomputerkeyboardenvelopescissorselevatorinternetvacationcalendarholepunchdatestamprecyclingtelephone...

Planty Word Search 2024-08-28

67 Items: IVYPOTMIXHOYAFERNLEAFSOILMOSSGREGLEAFBARKCOIRFICUSPILEALIGHTWATERSEEDSPLANTPESTSROOTSPILEAHERBSPOTHOSCACTUSGARDENPLANTSGROWTHAROIDSPOWDERFLUVALGARDENBEGONIAPERLITEFOILAGEORGANICMARANTAMONSTERADRACAENAALOCASIACALATHEAAERATIONDRAINAGEALOCASIASUNLIGHTHUMIDITYTROPICALANTHURIUMAGLAONEMAKALANCHOEPEPEROMIASUCCULENTSYNGONIUMBOTANICALSUBSTRATEZAMIIFOLIA...

SM F 2025-03-27

73 Items: verybeginexcelferryofferpurserefersoundadvisechordschorusdifferechoesforbidforgotgrowthoriginplantssafetysuffervisualallowedcurtailforgiveforsakehealthymodestyomittedunhappyallottedanchoredapproachbackachebeginnerchemicaldisasterdiscipleexcelledforsakenmarriagemilitaryoriginaltransferallotmentbeginningchemistrycommitteeexcellentforbiddenforgotten...

G6_V2 2025-10-03

72 Items: fatsachespotsgenesrelaxcluesdeityspeartauntruinssandylongergrainsratheractivesecretplantsbelongoraclespranghurledwreathsceniccasualsupportcompanytridentunfazedstunnedweaponstiniestbattlesworshipstadiumbroughtshieldscanyonsreservesmoothlyprophecyinfinitepregnantoriginaloutlawedvisitorsultimatesuitablesplendorstunningevidencemedievalvillagesnutrients...

April Fools Word Search Two 2025-03-31

75 Items: isfuneggthehoaxzanybeeswarmfawnpeephuntwildjokehaharusethisfaceamuseAprilfunnysillyprankmonthhumorsunnyhoneybunnybreaktreesgrasslaughkookysmilecheerspoofshockquirkyspringschemeseasonpollenplantsbreezejoyfulgigglechickscloudswonderpuzzlewisestchoicesmileycomicalfoolishmisleadshowersflowerscomedicplayfulanimalsrainbowmisleadjokestergulliblesurprise...

Capibara Ch 5-6 2025-04-09

21 Items: butthenverywantsthe lakecan swimdestroysthey walkcan't swimis not biga lot, muchwater vaporthey producewants to attacka big hamburgerthey walk throughdestroys the treesthey swim very fastdestroys the plantsenters (in) the waterdoesn't have a lot of water

5. Cells & Energy 2022-11-02

22 Items: without oxygenSugar (C6H12O6)requires oxygenBasic unit of lifethe outer covering of a cell or organelleget their energy from the sun, example plantsplace in a eukaryotic cell where the DNA is locatedtiny structure that performs a specific job in a celladenosine triphosphate, a molecule that stores energy...

Renewable energy Snjeza Word Search 2026-04-20

18 Items: Moving air.Dirty air from fire.A machine that spins in the wind.A small thing that stores energy.Water that flows across the land.A vehicle we drive on the road.A mountain with hot lava inside.Energy that gives us light and power.A wheel that turns in water.A place where water makes electricity....

Vocabulary 2024-10-30

48 Items: tentwillyummysweetjuicycamperchooseboringfutureleavescollecttonightprivatecrunchycampfirebranchestomorrowperuvianapartmentvacationswonderfulexpensivedangerousfind-foodnext-weekwhat-timenext-yearon-fridayimportantdifferentvocabularyevaluationcatch-fishpick-fruitread-a-mapdestinationin-two-daysgo-to-sleepintelligentaccomodationbeach-resort...

Nature101 2025-10-09

75 Items: AirSunFireFishLakeLandLavaLifePondRainSoilWildAlgaeBirdsCometEarthGrassOceanParksRiverSpaceTrailTreesWaterWeedsWoodsWorldAutumnBeautyCosmosForestGardenHikingHumansJungleNaturePlanetPlantsSpringSummerWinterAnimalsBeachesBiologyEssenceFlowershabitatInsectsLiquidsNurtureScienceSeasonsVolcanoWeatherAventureCreationSurvivalTornadosTropicalUniverse...

Connect Word Search 2025-09-09

10 Items: to endno fatTo be withTo not careto over exaggerateHigh blood pressureeats plants and animalswords with different pronunciationto discuss cultural and societal diversityparts which are similar or are all of the same

Trustworthy 2025-10-15

5 Items: thing we growa thing we need in lifea thing we need in lifething we do with brainrotswe associate this thing with brainrots

Balsam Word Search 2024-07-08

5 Items: Colour of the flowers.Revathi’s favourite raga.The contest Revathi participated.The plants that were not looking normal.The instrument that was played by Revathi.

ROGELIO'S Word Search 2026-02-02

79 Items: FoxCupPackDeskLampJessNikeCityHeroCaseGangTallBagsCrazyFlagsBooksShoesBuggyAppleBloodGreenCurlyNightBoardWaterPaperTimerBrentBrutalBrazilSchoolPlacesPlantsColorsPhonesSoccerSportsFlowerStatesGhettoFamilyArtistScreenSnacksAmazingWarningJordansSweaterStreetsWindowsMorningHennesyStreetsUnknownRogelioBuildingAirMaxesMarylandComputerFootballCalender...

Evaporation Word Search 2024-01-10

12 Items: saltwaterfrozen waterone the four spheresfast-moving freshwaterstill moving freshwaterliquid turning into gaswater that flows in steamswater falling out of cloudswater with plants evaporateswhen water pools in large bodieswhen water falls from the cloudswater held underground or in soil

Layers of Soil 2024-04-18

10 Items: Each layer of soil with its own distinct characteristics and features.material: The rock in the R horizon that gradually breaks down to form the soil.The top layer of soil that contains fallen leaves and dead plants, known as humus, which helps in plant growth....

Medicinal Uses of Plants that grow in Ireland 2026-03-05

8 Items: reliefhealthhealingDigestioncognitiveantioxidantdetoxificationanti-inflammation

Wordly Wise Weel 11 2025-12-16

15 Items: RawTo feedEyesightGet largerGreat, largeTo disappearTo have a changeA long, deep cutHappens every yearNot made by natureTo give up or surrenderTo mix together into oneTo make a round hole by drillingThe leaves of trees and other plantsA color; especially a shade of color

Los quehaceres 2024-11-25

26 Items: irondustparkmovesweepplantemptyvaccuumfix bikemake the bedfeed the dogfeed the catcut the grassset the tabledry the disheswash the disheshang up clothesclear the tableclear the tablewater the plantswater the flowersclean the bathroomcollect the garbagetake the garbage outclean the living roomclean the living room

Sugars 2025-09-02

16 Items: linkages found in glycogenthe unbranched type of starchcommon to all N-linked glycosidespolymeric form of glucose in plantsthe major structural polysaccharide in plantsisomers that are not mirror images of each otheramino acid responsible for N-glycoside formationclassification of any sugar that can be oxidized...

Alternative Word Search 2025-02-06

57 Items: rdfrnadatagenescancergraphsminingplantssparqlsharingstoragediseaseepitopegenomesglycanssyntenyvirusesbacteriacurationcurationanalysismodelinglearninggenomicslearningmetadatacurationproteinscommunitystandardsdatabasesdiscoverydatabasesexpressionontologiesphenotypesstructuresproteomicssequencingannotationscomparativerecognitiondata storestherapeutics...

give two indications that plants need watering 2025-09-24

6 Items: marksoiltestwiltingbrowningof leaf colour

Science Word Search 2026-05-15

20 Items: algae is a ________.bacteria is a __________.fish are _______ organisms.the __ of vinegar is acidic.ocean __________ can harm marine life.a sea turtle is an example of a ________.An ________ can be harmed by urbanization.overfishing in a lake can disrupt the _______.the water was dirty and the _________ was high....

Dishwasher 2025-01-06

10 Items: Thoughts or conceptsAn assistant or helperSanta’s speedy reindeertopmost part of the bodyCleans with water and soapUnwanted plants in a gardenChops or shapes with a bladePossessing knowledge or insightA comment meant for the audiencePlates, bowls, and other table items

Term One HASS 2026-03-24

80 Items: ACTMapPastLandLakeSandReefCaveEastWestMungoDiaryToolsRocksUluruCoralOceanCoastStoneEarthWaterBeachRiverNorthSouthStatesFossilSourceLetterPlantsDesertMarineIslandNatureLocateForestTravelRegionCapitalCultureHistoryPresentCountryAncientPrimaryObjectsNaturalStreamsExploreShelterHabitatCompassVictoriaTasmaniaPaintingEvidenceFeaturesApostlesMountain...

Nova Farms Word Search 2023-12-19

20 Items: Ground flowerSolventless edibleSleepy time edibleTHC, CBD, CBN, CBG3g Joint with a wooden tipBlunt infused on the insideJoint infused on the insidepre-packed glass one-hitterTHC oil used with a dropperTopical brand made in houseBlunt infused on the outsideVape with live cannabis derived terpenessolvent extract used in Sticky Fish products...

Climate Change and Sustainability Terms 2025-04-14

10 Items: CLIMATE : The long-term weather patterns of a region.CONSERVATION : The protection and preservation of natural resources.SUSTAIN : To maintain or support over time without depleting resources.POLLUTION : The introduction of harmful substances into the environment.CLEANENERGY : Energy that is produced with minimal harm to the environment....

WHAT DID THE ROMANS EVER DO FOR US? 2026-06-25

12 Items: ______ BathsStraight _______Animals that hopImproved ___________Plants that hurt you_______ were introduced_______ for the Roman GodsThey taught us how to speak ________Romans introduced a new way of paying, _______!A main thing the Romans introduced were _________The Romans cleaned up the streets by introducing _________...

Per 2026-02-19

10 Items: rudeto sweatimportant, relevantlasting for a very long timeto spread throughout somethinga way of interpreting informationplants that live two or more yearsto continue in spite of difficultiesa feeling of annoyance or anxiousnessa quick and careless action without interest

Occupations 2026-04-21

12 Items: A spy.A hair stylistOne who lends moneyAn unskilled worker.One who writes novelsOne who writes poetry.One who deals in cloth.A person who studies plants.One who carves works of art.One who buys and sells goods.One who loads & unloads ships.One who rides horses competitively.

Occupations 2026-04-21

12 Items: A spy.A hair stylistOne who lends moneyAn unskilled worker.One who writes novelsOne who writes poetry.One who deals in cloth.A person who studies plants.One who carves works of art.One who buys and sells goods.One who loads & unloads ships.One who rides horses competitively.

Photosynthesis Word Search 2024-11-27

41 Items: , What gas is taken into the lungs during inhalation?, What are substances that absorb light energy called?, What is the voice box that contains the vocal cords?, What gas is released as a by,product of photosynthesis?, What is the tube that connects the throat to the lungs?, What is the primary source of energy for photosynthesis?...

Native Plants for Monarch Butterflies and Coastal California Gnatcatchers 2026-04-20

9 Items: DesertMilkweedWoolyPodNarrowleafCaliforniaPinkFlowersWhiteFlowersCoastalSageBrushCaliforniaBuckwheat

Atom Word Search 2024-07-18

12 Items: Genetic materialBasic unit of matterBuilding block of lifeNerve cell in the bodyForce attracting objectsTest to prove a hypothesisStudy of matter and energyChange in species over timeCommunity of living organismsGroup of atoms bonded togetherProcess plants use to make foodStudy of substances and reactions

CR-Photosynthesis/Cellular Respiration Challenge 2024-08-02

11 Items: a living thingthe plant organelle where photosynthesis takes placethe organelle where cellular respiration takes placethe process that occurs in producers to make glucose or sugarorganisms that consume or eat their own food, such as animalsmicroscopic marine algae that uses the process of photosynthesis...

nursery 2025-03-07

5 Items: easy to move, less shock to plants, grown in sellable size containerno staking, cooler roots in the summer, well-insulated in winter, easy to moveconstructed of wood, no artificial heat source, covered in plastic during the summerconstructed of wood or steel, solar heated, electric cables steam or heated by natural material...

Biomass Energy 2026-03-31

15 Items: What is the most common traditional form of biomass?Organic matter used as a fuel source is called ______.AN alcohol fuel made from corn or sugar cane is ______.A fuel made from vegetable oils or animal fats is ______.Decomposition in the absence of oxygen is ______ digestion.Biomass gets its initial energy from the sun through ______....

Space Word Search 2025-11-26

86 Items: cornseedmossfernrootSoildicoturbanWeedspestscellsfruittrunkshootwaterlupingrowthplantsginkgoforestseasonflowerantherstamenbranchoxygenstatchchillicarrotobliskconifermonocotwetlandesturaytussockcontrolglucosevacuolestomataharakekefruitinghabitatsnitrogenvariablecellwallmarigoldmisshallLifecyclekauritreesproutingliverwortecosystempotassiumnutrients...

Eco turismo 2026-05-15

24 Items: homelandsplacenaturenaturalcountryto enrichecotourismto protectto respectenvironmentwood, forestcontaminationcultural heritagenatural treasuresto help, to assisthe/she/it has beento fight, to combatwild (native) plantsto provide, contributehe/she/it has done/madeclimatico climate changeto take care/look after/guard...

Spelling Bee 6th Grade 2026-05-19

86 Items: acheanewartscarpcavefatsfeedfindhelpideajumpleapmoonrealreefroarsomewaysadaptarmorawardbirthcanoeclearcoastcoraldingoferalgianthumidoceanorcaspestsspinysplitspotsactiveasthmabecomebelongchangechiselcolonycuddlydamagedepthsechoesfearedglancegrainskoalaslongerloudlymarinemodernnativeoraclepackedplantsratherscoressecretseniorseverestubbysunkensystem...

Science Y4-Y5 2025-07-04

19 Items: How high or low a sound isHow loud or soft a sound isA plant that makes its own foodWhen light bounces off a surfaceThe natural home of a plant or animalThe largest planet in our solar systemThe ability to do work or cause changeThe path a planet takes around the SunThe force that pulls things down to EarthThe star at the center of our solar system...

тропический лес Амазонки 2025-12-23

2 Items: to find:RAIN, FOREST, OXYGEN, ANIMALS, PLANTS

PROBLEME NO 29 MOT DE 8 LETTRES CULTURE 2022-12-03

86 Items: abcdefghlnoprstvacresarbreavrilbechebrevecarréchampcoloncotonfairefermefevesherbehommenavetpertepreteradissortetabacvasteventevertearpentavoinebeautécorvéecoteaufleursgrainegratteguéretlabournatureoignonpacagepatatepaysanplantsprofitracinesemoirserrerterrestomatetrefleverdirbientotdiversefermierharicotlargeurluzerneplanterpotagerprairieproduit...

Washer Word Search 2025-01-17

87 Items: PanPotBedMugBoxFanOvenForkSoapLampPensCoatSinkCupsBowlVentPoolDoorHatsListDryerStoveSpoonKnifeTableChairCouchPaperPlateClockPurseSprayBrushBootsShoesSocksPantsBooksPhoneWasherToiletShowerClosetPantryCoffeeMirrorOutletOfficeStairsPlantsBottleShortsShirtsJacketGarageLightsSwitchFaucetCarpetTabletOttomanSpatulaBedroomClothesOttomanPrinterPencils...

Garden 2024-05-03

85 Items: dighoesowbeesclayforkhoselawnpotsrakesoilstembladedaisyfencegrafthedgeherbsmulchpestsseedsshadespadevinesweedswormsaphidsgardenglovesleavesplantspollenshearsshoveltrowelannualscabbagecompostfoilageharvestinsectspepperspruningtrellisweedingcucumberdrainagegardenerlettucesmoistureplanterssunlighttomatoeswateringcultivarsflowerbedfrostdatenutrients...

routine 2026-01-15

23 Items: cookget upwatch TVgo joggingmake my bedwalk the doggo to schoolse the tabletidy my roomride a horsedo the dishesfeed the fishset the tablehave a showerhave breakfastdo my homeworkdo the shoppinglisten to musicwater the plantsplay in the gardentake out the rubbishcome home from schoolvisit my grandparents

OUR ENVIRONMENT 2025-06-16

10 Items: keeps us warmwe all live on thismost of these are greenonly comes out at nightanother word for personyour dog is one of theselook up, what do you see?twinkle twinkle little _____its all around us but we can't see itfills up rivers, lakes, seas and oceans

Vegetation and wildlife 2022-11-09

8 Items: uses of plants(1)life supporting systemreason animals are poached(1)Act to protect endangered speciesfactor that affects natural habitatstep to conserve our natural habitat(1)region with short stunted trees and grassnarrow zone of contact between lithosphere hydrosphere and atmosphere

PROBLEME NO 29 MOT DE 8 LETTRES CULTURE 2022-12-03

86 Items: abcdefghlnoprstvacresarbreavrilbechebrevecarréchampcoloncotonfairefermefevesherbehommenavetpertepreteradissortetabacvasteventevertearpentavoinebeautécorvéecoteaufleursgrainegratteguéretlabournatureoignonpacagepatatepaysanplantsprofitracinesemoirserrerterrestomatetrefleverdirbientotdiversefermierharicotlargeurluzerneplanterpotagerprairieproduit...

Healing Power of Wolves 2025-10-23

10 Items: All the plants and grasses in an area.A body part that helps fish take oxygen from water.The total number of a certain kind of animal or plant in an areaThe natural home or environment of an animal, plant, or organism.A living thing, like a worm or mushroom, that feeds on dead material....

animal 2024-07-19

10 Items: An animal that primarily eats meat.An animal that primarily eats plants.An animal that eats both plants and meat.A warm-blooded vertebrate animal with feathers, wings, and a beak.An animal lacking a backbone, such as insects, spiders, and mollusks.A group of mammals that includes humans, apes, monkeys, and prosimians....

Patterns of Interactions Challenge Word Search 2025-01-11

17 Items: consumer that eats meat onlyconsumer that eats only plantstype of feeding done by herbivoresspecies rely on each other for survivalconsumer that eats both plants and animalsnon-native species that disrupts an ecosystemorganism that consumes its food to obtain energysymbiotic relationship in which both species benefit...

OUR ENVIRONMENT 2025-06-16

10 Items: ,keeps us warm,we all live on this,most of these are green,only comes out at night,another word for person,your dog is one of these,look up, what do you see?,twinkle twinkle little _____,its all around us but we can't see it,fills up rivers, lakes, seas and oceans

Find the 20 plants and flowers that grow in Pauline’s garden! (Horizontally, Diagonally & Down) 2025-12-16

20 Items: CROCUSDAHLIAANEMONEBEGONIAFUCHSIACLEMATISCYCLAMENGERANIUMHIBISCUSDIGITALISECHINACEAGLADIOLUSHELLEBOREHYACINTHSALCHEMILLADELPHINIUMANTIRRHINUMFRITILLARIAHELIANTHMUMCHRYSANTHEMUM

HUB Job Resources 2026-05-07

12 Items: To hold water inPlants grow in themUsed when laminatingWhere dirty aprons goUsed to wash the carsLoad dirty plates intoSomething to feed the birdsClean the windows with thisUsed when picking up litterUsed to give pencils a pointStaff write positive messagesProtects our bodies and clothes when working

Air and Water 2025-01-06

4 Items: plants grown in farma small natural pool of watera very large body of water salta large body of water flowing towards the sea

Communism Word Search 2025-09-16

92 Items: gpsseaskysunasiamapslandmoonfishfallcrustarticplacelightstarsbirdsminingmantalindianeuropeafricaglobesregionplantshumansfarmingfishingerosionpacificequatoranimalstreatiesforestrygoresmapatlanticlatitudelocationmovementcreationcommunismsocialismdiplomacyoligarchytheocracyautocracyoutercoreinnercorebiospherereligionsmentalmapaustralialongitude...

Capítulo 5, segunda sección (No spaces; Include "the") 2025-01-29

33 Items: doordeskcitychairpatiotablestreetplantsgaragewindowto liveneitherto cookkitchencountryaddressbuildingbathroomto cleanoutskirtsbig/largeapartmentsofa/couchdining roomliving roomyard/gardentown/villagesmall/littleto make the bedto cut the grasshacerlosquehaceresto take out the trashnobody/not anybody/no one

May 2026 Wordsearch 1 2026-02-18

20 Items: a young planta jumping insecta plant containerrelating to flowersthe study of plantsa glass plant housea small social insecta hard-shelled insectprepared planting soila garden watering toola small spotted beetlea container for flowersplant nutrient materiala water spraying devicean immature insect stagea circular flower display...

unit10-grade9 2026-03-30

20 Items: animal wastevery importantfood for plantsan animal's homevery interestingbalance in natureto damage or hurtspace beyond Earthto value somethingto watch carefullya shape of the landsomething dangerousextremely importantto go around a planetto influence somethinga protected natural arealand with a lot of grasschanges in weather over time...

food and appliances 2026-03-22

96 Items: egghamfoodcakemilkovenmayopearricesaltstewmeatlavasteakbreadtoastwheatflourwaterfruitapplejuicemangoicingbagelroastplantsflowercheesebananaorangecitrusshrimpbamboograpesprunessmorespeppergarlicburritoburgerscupcaketoastermustardketchupraisinssasaugenuggiesbrocollieggplantsandwichchowmeinmilkywayhersheysicecreamchocolatemicrowaveplaydoughlemonzest...

4th Grade 2026 2026-06-04

94 Items: EvaLeeObiDNAartbaoJoeyLukeAddyEmmaGigiBluemathmassdivaslaytechteamSantiDiegoQuinnEllielunchslimeholesconorchloemusicgreenapplemoanawallebravebingoReginaOliviaAndresArturomoviesschoolrecessfalconneedohlabubuplantseasterAdalinereadingwritingsciencefidgetscouragehonestyrespectfriendslibrarybowlingnewsiespokemonsquishytangledMadelinereligionhomeroom...

Cells and microscopes 2026-05-18

21 Items: The smallest unit of lifeType of cell with a nucleusScience which studies cellsType of cell with no nucleusOrganelle which makes proteinsType of microscope with two lensesCreates energy for the cell to useThe structure which encases the cellThe level of enlargement the image undergoesType of microscope with highest magnification...

Conifer Vocab II -- Forestry 2024-06-03

25 Items: The slender, pointed leaf of a coniferous tree.Small pores on plant surfaces, regulating gas exchange.The green pigment in plants responsible for photosynthesis.The inner, older wood of a tree, providing structural support.Trees that shed their leaves annually, in contrast to conifers.The protective outer covering of a tree, composed of dead cells....

Plate Tectonics 2025-12-05

8 Items: plate landplate Oceanspot San Andreas FaultWegener who Thought that the Continents fitspreading New rock forms, mid sea ridgeboundary Location where two plates move apartboundary Location where two plates hit each otherimprints of ancient plants or animals preserved in rock.