plants Word Searches

The process of photosynthesis 2024-10-14

9 Items: It is released into the air during photosynthesisThe process that plants use to make their own food.The roots of a plant absorb water and nutrients from the soilthe parts of the plant where photosynthesis mainly takes placePlants use this energy to make sugars from water and carbon dioxide....

Vocab Word Search 5/14 2026-05-14

15 Items: direction opposite of north.first in order of importance.direction where the sun sets.direction where the sun rises.coming after primary; second in order.a series of words spoken as a magic spell.to think of many ideas quickly, often in a group.when prices of goods and services increase over time....

Environment and Ecosystems 2021-12-16

55 Items: drytenwebwetbearbeesstemchaincyclefungigrassrootsseedssleeptreesbushesdesertenergyjaguarleavesmonkeypetalsplantssealedanimalsbiodomeflowersinsectsorchidspercentprimarypyramidrespirespiderssurvivevolcanoanacondabacteriaconsumerproduceraltiplanocarnivoreherbivorereproducesecondaryearthwormsrainforestcloudforestdecomposershummingbirdpollinators...

Operation of Wastewater Treatment Plants - Vol II, 7th Edition 2016-08-10

20 Items: GRITSCADATOXICWATERFILTERMICRONREFLUXVOLUTEELEMENTBACKFLOWDIFFUSERINFLUENTNUTRIENTZOOGLEALOXIDATIONPARASITICALKALINITYCARCINOGENHYDROSTATICCHLORINATION

Joyceechristian Word Search 2022-08-31

55 Items: 1942plantsfamilypurplestcroixflowerschildrencaribbeanquayasewernancyoroserickiiroseessiahroselakeyasewerkahsiesewerpamelasewerstaceymrosestaceylrosejohnnycakesanthonysewersolomansewerkymanitsewerernestjrosesrjordannesmithjustinmkimbleolajawoniroseernestjrosejrshaquillasewergregorynesmithshaniqueqsewerzhanedthorntonernestdroseillkourtneythenry...

Dromedary Camel 2024-10-16

55 Items: DryFatEastAridPackMilkMeatWoolHumpfeetBodySandDustcoatfeetCamelNorthHerdsMoansRoarsWaterUrineThickBroadMammalMiddleAfricaLeavesDesertplantsEnergyDesertPaddedSoundsGruntsCamelusArabiananimalsgrassesKidneysDominantSweatingNostrilsSunlightDromedaryRehydratereservoirEyelashesOne-humpedInsulationDromedariustemperatureenvironmentsDomesticatedconservation

Lesson 33: What Makes Australia Unique 2025-05-28

5 Items: species-Animals or plants that occur naturally in an area.species-Animals or plants that are brought into an area from somewhere else.species-Animals or plants that are likely to become endangered if not protected.species-Animals or plants that are in danger of dying out in the immediate future....

Vocabulary Words 2025-09-13

8 Items: cheapexisting in large numberssomeone who is a beekeeperchemicals that kill certain plantsland that has indigenous wild grasses growing on itthe process of raising aquatic animals and plants for fooda type of farm that raises animals on large tracts of landdown the soft, warm under feathers of a goose-used to stuff bedding and jackets or vests

products at lowes :) 2024-01-10

54 Items: nutgasboltbagstilekeyssoildrillblockscrewpaintdoorswatermulchsinksjackstotesimpactwrenchrentalmowersplantsvanitygrillswiringkniveschainsblindsplywoodpropaneshelvestoolbosshopvacfiltersheatersdrywallcamerasgiftcardtrashcancabinetsflooringcounterscleaninglightbulbgeneratorpesticidesharkbitebatteriesweedeatersappliancesfireplacesinsulationthermostats...

SUMMER WELLNESS 2025 2025-06-30

43 Items: PETSRIDESGAMESNIGHTFOODSCREAMNIGHTPARKSDATESDRIVEGAMESPRIDEBAKINGDONATENIGHTSMARKETGARDENHIKINGHEALTHPLANTSSPORTSFIELDSCAMPINGCONCERTBREATHSFISHINGHOBBIESJOURNALRECIPESPODCASTPUZZLESTHERAPYCRAFTINGEXERCISEFESTIVALMEMORIESPLAYLISTPOSITIVESWIMMINGGRILLINGAUDIOBOOKVOLUNTEERTRAVELING

5TH GRADE TERMS 2026-05-13

55 Items: GASFISHBIRDDELTAFLOODSOLIDHUMANFUNGIPLANTVIRUSMATTERLIQUIDSWITCHSTATICMAMMALPLANTSANIMALEROSIONGLACIERCIRCUITCURRENTBATTERYREPTILENUCLEUSHARMFULCELLWALLBACTERIASANDDUNESMOUNTAINSVOLCANOESLANDSLIDENATURALLYINSULATORCONDUCTORAMPHIBIANCYTOPLASMWEATHERINGDEPOSITIONVERTEBRATEMICROSCOPEBENEFICIALCONSRUCTIVEDESTRUCTIVETEMPERATUREELECTRICITYCHLOROPLAST...

4-H Cook County 2020-10-22

59 Items: 4HartfunheadclubfairSTEMpetsteenwoodcamphearthandsgreenworldstatefoodspaperchalkmetalhealthclovercountypublicsewingjuntosribbonnaturegrowthskillseventscareerplantsmentorcarbonloyaltyservicecountrykickoffcookingprojectmasteryhelpingcourageinspireanimalsthinkingroboticslearningcommunitycloverbudbelongingadventurechallengeleadershipgenerosity...

review 1 2025-03-11

59 Items: byongocatdogmopsetfanonetwosixtenfeedwalktoysbacknextyoyooverlampfourfiveninecomehometrashwaterfloortablefronttablerobotclockthreeseveneightlunchgetupmotherfathersisterplantsdishesdinnercrayontoyboxcloseteleventwelvebrotherbubblesballoontoycarsgotobedbookcasedollhouseteddybearbreakfastcoloringbook

household chores 2024-08-26

13 Items: the dogyour bedthe tablethe tableyour roomthe plantsyour T-shirtthe dishwasherthe dishwasherout the washingout the rubbishaway your clothesthe washing machine

WORD SEARCH (GRADE III)-SCIENCE 2024-05-04

15 Items: Answer to a problemFinding something newCreating something newTool to see tiny thingsWho conducts experiments?animals that gnaw their foodAn animal that eats only meatTo ingest food without chewingAn animal that eats only plantsAn animal kept for companionshipExcitement about learning new thingsWhat happens as a result of an action?...

Unit 4 Key Terms (Question/Answer Style) 2025-11-04

20 Items: Strain or straining force.Changing from a liquid to a vapor or gas.An interacting group of living individuals.The shortage or absence of something essential.An organism that is capable of making its own food by photosynthesis.The act, art, or manner of managing or handling; controlling or directing....

Agriculture Revolution & Development of Civilization 2025-08-18

14 Items: Growing or making somethingThe growing of plants or crops.A person who manages and works on a farm.The act of gathering food from wild plants.Rich in nutrients and good for growing plants.The practice of taming wild animals for human benefit.The large-scale planting and growing of a single crop.Husbandry The organized raising and caring of animals....

Goldilock's Zone 2024-05-17

10 Items: Only earth has this3rd Planet from the SunThe fluid responsible for lifeAnother word meaning life is possible hereThe protective layer that surrounds the earthAutotrophic organisms that we consume for energyThe element required for all life (for breathing)The state of matter required for us to consume water...

Trust Word Search 2023-12-25

58 Items: ofbesunteagodslifekingliferaingrowfoodsalthelptrustwatercyclelakesdrinkpowertoolsbeyondliquidplanetoceanscloudsfruitsplantsbeautyriverscoffeewisdompromiseperfectsustainsurfaceflowersproducecookingbathingsustainteachesmedicalreliableeternitydistanceseawaterlemonadecleaningpreparedenjoymentevaporatesatmospherevegetableswaterfallssituationsJehovahvah...

7 TH SCIENCE 2025-11-20

27 Items: CONETREELIGHTWATERSPORESUGARROOTSGARDENLILIESSIMPLEOXYGENCOMPLEXMINERALSFLEXIBLESTRUCTUREFLOWERINGCONDUCTINGSTRAWNERRYTO SOAK UPEVAPORATIONREPRODUCTIONCHARACTERISTICSONE WHO PLANTS SEEDSTHE MAIN STEM OF A PLANTTHE PORES WHERE A PLANT BREATHESTHE PROCESS A PLANT USES TO MAKE FOODPLACE WHERE PHOTOSYNTHESIS TAKES PLACE

Cell Organelles and Cell Transport 2025-09-22

22 Items: basic unit of all organismscell rupture in a hypotonic solutioncell collapse in a hypertonic solutionthe movement of water across a membraneclear fluid that supports cell organellesorganelle that contains digestive enzymesthe movement of solutes across a membraneorganelle that converts energy in the cellsolution with more solutes outside the cell...

Review Word Search for Ch. 2: Classifying Organisms 2025-10-21

24 Items: what fish use to breathwhat dinosaur translates toan animal without a backbonethe phylum that worms belong toto put living things into groupsa mushroom is an example of thisthe gas plants need to make foodthe largest group of invertebrateswhere an amphibian starts its lifethese cover most fish and reptilesthe process plants use to make food...

Village walk 2024-10-11

56 Items: cowfunpubcativyDuckpondhomeparkseatroadfishbandbellpathbikebarngatebakerwoodssheepswinghouseshopscreekstarsbookstreescandyhorseschurchsquareschoolgardenbridgepicnicmarketstreamplantsfabricpasturevillagefriendsribbonsbuttonslibraryflowerschimneysparrowpushbiketwilightChildrensunlighthorseshoesunflowerhaberdashery

Thestahls Word Search 2026-08-02

60 Items: PigAUFVansPinkBlueMeganKohanDorsiAprilGreenBlackWhiteChosenDoodleMrMikeSoccerTulipsPlantsOrangeYellowPurpleKensleyRainbowNoBullsSawmillBubblesMartiniTequilaForeverFitnessFlowersFitnessDietCokeSneakersMonsteraMarriageColorfulLoudMindPABakeryMonsteraTogetherCloverDrTreasureTheStahlsLoveNotesDachshundLiftHeavySixteenthAmsterdamBeachboysWienerdog...

Mixed 2026-03-04

20 Items: coffeea cavea fishmy bed,dinner,animalsa picnica museumin a lakethe table,the floor,the plantsa mountainmy bedroom,the dishes,my clothes,photographsthe bathroom,the trash out,on a boat trip

Biotic and Abiotic Factors Word Search 2026-03-18

23 Items: A single living thingNonliving parts of an ecosystemHow hot or cold an environment isAnything organisms need to surviveAn animal that hunts other animalsWhen organisms rely on factors to liveAn animal that is hunted by a predatorA factor that restricts population sizeIncrease in size or number of organismsAn abiotic factor essential for survival...

Soil Word Search 2025-05-23

11 Items: optionsto have funslightly wetkings, queenelbows & kneesdogs are very __to bother someonewater to make teaopposite of createplants are placed in _lines, segments, rays __

Biodiversity Vocabulary 2023-10-06

20 Items: eats plantseats animalsword for Earthbreaks down dead mattereats plants and animalsgroup of the same organismweather patterns over timecollection of organ systemshunts and eats other animalscannot produce its own energyassociated with living thingsorganism that feeds off a hostgroup of different populationsis hunted and eaten by predators...

Plants and animals of the Salish Sea 2025-03-28

10 Items: ṕəltaqʷəʔəptənɬoɬmomƛaləqənχɛχyɛq́ƛəqstənkʷumaqɛnχawχɛḱʷumkʷumkʷumay

give two indications that plants need watering 2025-09-24

10 Items: leafcrispcolourwiltingdrysoilcurlingbrittlebrowningshrinkagedrycompost

Ecosystems vocabulary 2026-02-27

19 Items: Organisms that eat producers.autotrophs make their own foodOrganisms that eat other organisms.carnivores are meat eating organisms.Organisms that eat primary consumers.Organisms that eat secondary consumers.consumers hunt / gather food for others.chlorophyll can also absorb light energy.Animals that eat both plants and animals....

ecosystem vocabulay 2026-02-27

19 Items: Organisms that eat producers.Organisms that eat other animals.Organisms that feed on dead matterOrganisms that eat other organisms.Organisms that eat primary consumers.Part inside a plant that absorbs lightOrganisms that eat secondary consumers.Animals that eat both plants and animals.Organisms that hunt & gather food from other organisms...

Racing to MAP- read the definitions, find the correct keyword from the bank 2026-04-30

14 Items: – A push or a pullenergy – Energy we can see– Small pieces of rock or soil– A plant that makes its own food– An animal that eats only plants– An animal that eats other animalsdune – A hill of sand shaped by windweb – A group of connected food chains– The ability to do work or cause change– An animal that eats plants and animals...

Common Nicknames for Plants (In English) 2026-03-05

8 Items: QuickMilfoilKnitboneBig-herbButtercupWhitethornEaster-lilyCommoner-of-wood

Alternativetherapeutics Word Search 2025-04-01

61 Items: RDFRNAGenesCancerPlantsSparqlDiseaseEpitopeGenomesGlycansSyntenyVirusesBacteriaCurationGenomicsMetadataPathwaysProteinsscRNASeqDatabasesOmicsDataOntologiesPhenotypesProteomicsSequencingAnnotationsDataSharingDataStorageDataAnalysisDataModelingDeepLearningRepositoriesDataStandardsDrugDiscoveryGeneExpressionGraphDatabasesInfrastructureComparativeData...

The Microscope and Cells 2023-10-09

14 Items: Holds the side in placeNeeded to see the imageHelps give a sharp imageBuilding blocks of animalsControls what the cell doescell Building blocks of plantsWhere you put your slide to look at itPart of the microscope you look throughControls what enters and leaves the cellcan rotate to give different magnification...

Food Waste 2023-02-01

9 Items: to have an effectusing up a resourcefood that's thrown awaythe making of food or productsanimals and plants that make up an ecosystemnot knowing where the next meal will come fromland that naturally animals and plants can no longer growfood and other bio materials that can be broken down into dirt...

Aquarium 2025-07-27

60 Items: NetRocksCycleSnailBettaTetraGuppyMollyPlatyPlecoHeaterFilterGravelPlantsFeederFlakesShrimpDiscusAirPumpTestKitpHLevelAmmoniaNitriteNitratePelletsCichlidFishTankLightingLEDLightLiveFoodGoldfishTankMateSaltwaterSubstrateAquascapeDriftwoodTankStandAngelfishSwordtailCorydorasFreshwaterLivePlantsBubbleWallSuctionCupFrozenFoodZebraDanioClownLoach...

farm life 2024-07-17

10 Items: carry a boxplant a treemilk the cowclimb a treefeed the sheephave a barbecuewater the plantssweep the leavescollect the eggssmell the flowers

Slow living samw 2025-09-07

60 Items: HyggeMatchaPlantsBlanketIncenseNoAlarmOffGridRestDayFreshAirLongBathStayHomeChamomileCozySocksDeclutterFaceSteamGratitudeHerbalTeaLoFiMusicTeaKettleWarmLightBreathworkCleanSpaceEarthTonesJournalingMorningSunOpenWindowSandalwoodSlowCoffeeStretchingCandlelightComfortMealEveningWalkKnitSweaterLavenderOilLowLightingOilDiffuserRusticDecorSimpleMeals...

The Green Fern Zoo 2026-04-15

66 Items: zooredfernVernswimreefnutsantspalsfigsbarkbilleggscornwoodeggsswimfishspotnestgreentroutsharkchimpmunchseedsswingsharpteethgrassfinchclawsholessnakefangsmoundqueenriverfrogscrabsspoonplantssplashbobcatgarterdesertotterssplashcraneschickspuffinshunterspantherrattlergroomingcrittersreptilesharmlessvenomoustermiteswetlandssandhillmandrillswoodlands...

Wildlife Word Search 2026-01-19

10 Items: - to keep something safe from harm- the natural home of an animal or plant- a living thing like a dog, bird, or lion- to help and look after animals and nature- a place with many trees where animals live- the world of plants, animals, land, and water- animals that live in nature, not in homes or zoos...

The Pollinator Garden 2026-05-25

60 Items: batsbeesdilleggspupapondfoodsunnyherbsmothshostswaterrockstreeswingswaspsfruitgardennativeyarrowcosmosnectarfennelasterspollenbushesplantslarvaeparsleysheltermonarchzinniasorganicpuddlesinsectsverbenahabitatviceroydaisiesattractwillowsmilkweedwildlifemineralsironweedlavenderantennaecoreopsisgoldenrodmigrationecosystemconeflowerbutterflies...

My favorite things (neighbor edition) 2026-06-08

63 Items: DOGARTGODWINECARSMOONCALMBEEFJAZZASTROPEAСESPACEVIEJOSTEAKPILOTSTARSROSESPLANTSTAURUSMALBECDRIVESFLIGHTHIKINGFAMILYMANGOSCOFFEETRAILSGALAXYNATUREARTEMISSCIENCESUNSETSBROTHERHOSTINGJUNIATAPASSIONFLOWERSCOOKINGAVIATIONMONSTERAPATIENCEENGINEERZINFANDELASTRONOMYSAXOPHONEFRANCISCODOMINICANJOHNMAYERNESHAMINYGARDENINGWANDERINGDOCTORCITOPHILOSOPHY...

Revision,Living and non-living things to fungi and bacteria(Jackey) 2025-03-27

22 Items: Fish are_____-blooded.There are_____ in yogurts.The process of classifyingFish breathe through_____.The process of pollinating.Fungi: Mushroom,_____ and yeastThe classify things by their_____._____ are the only mammal that can fly.WOW stands for: _____,oxygen and warmth.There are only 4 groups of living things....

Shrub/plants you would find along the trails in PoCo 2024-06-04

41 Items: salallupinebambooladyfernfireweedknotweedswordfernvinemaplehorsetailsnowberrynootkaroseindianplumoceanspraybunchberryenglishivysalmonberryoregongrapescotchbroomthimbleberryskunkcabbagecherrylaurelspurgelaurelmorningglorygianthogweedenglishhollyredelderberrylicoricefernsbleedingheartbutterflybushgarlicmustardredhuckleberryredoiserdogwood...

The First Inventors 2026-06-05

9 Items: The Gunditjmara word for eelsAlso known as 'fire stick farming'The name of the volcano that eruptedThe Aboriginal people who used aquacultureThe types of lasers used to reveal canals and hutsFire Stick Farming helped reduce the number of theseThese types of plants were used to help reduce sickness...

MODULE 1D: WORD SEARCH 2025-03-15

15 Items: The sense of smell.A germ that causes disease.When plants grow towards light.Nerve cells that control movement.A protein that helps fight infections.When plants move in response to touch.White blood cells that make antibodies.A quick automatic response to a stimulus.White blood cells that help fight infections....

Vocabulary Vines 74-76 (Enright) 2026-09-11

15 Items: eats alleats meatgo betweeneats plantscut betweenin the fleshbrings watercome betweencarries waterbreak in amongamong the middlewanting to devourcontainer of waterflesh-colored flowerseize in between (sender and receiver)

food and appliances 2026-03-22

67 Items: egghamfoodcakemilkovenmayopearricesaltsteakbreadtoastwheatflourwaterfruitapplejuicemangoplantsflowercheesebananaorangecitrusshrimpbamboograpesprunessmorespeppergarlicburritoburgerscupcaketoastermustardketchupraisinsbrocollieggplantsandwichchowmeinchocolatemicrowaveplaydoughlemonzestburnttoastvegetablesgrapefruitdriedfruitdriedmangolemonicing...

Los Quehaceres 2024-01-31

14 Items: vacuumto cookto cleanmake the bedmop the floorcut the grassclear the tablesweep the floorto set the tablewater the plantstidy up, organizedust the furnitureto clear the tableto take out the trash

Build Up 3.3 Welcome to the Animal Kingdom (2) 2024-06-11

14 Items: Rivers and Lakes.The top of mountains.This habitat covers 70% of Korea.Cutting down trees in the forest.A big cat that lives in rainforests.The only continent without grasslands.To use less of something like electricity.The largest habitat (it is filled with water).The plants that give the grassland habitats name....

Fotosintese Word Search 2026-06-08

66 Items: AIRFATOILFOODDIETROCKSOILFIBERSEEDSSOLIDGASESSOLVESTARCHPLANTSOXYGENDESERTMATTERLIQUIDMIXINGGLUCOSESTORAGEVITAMINMINERALOBESITYHABITATGEMSBOKFOODWEBVIBRATEMIXTUREVISIBLESOLUBLEMELTINGSOLVENTDEADSEAShakingFASTFOODDIABETESECOSYTEMPRODUCERCONSUMERSETTLINGSOLUTIONStirringNUTRIENTSCOASTLINEPARTICLESSCREENINGDECANTINGFILTERINGInsolubleSALTWATERSATURATED...

PA III - Unit 4 2026-07-02

24 Items: AddCutMixBakeBoilChopForkSaltKnifeSpoonPepperTidy UpChopsticksEmpty The BinClear The TableCook The DinnerSweep The FloorWater The PlantsDo The Washing-upVacuum The CarpetDust The FurnitureLoad The DishwasherPut Away The ClothesTake the Dog for a Walk

Types of out door Leaf plants 2026-05-21

7 Items: HostasRodgersiaLigulariaShieldLeafBearsBreechesGunneraManicataRodgersiaPodophylla

Archie Word Search 2025-11-08

66 Items: elfjoylilpiedaveezrafinnlakelovemaiamayamimimosenikotallboonebuddydavidducksfokinfrankhelenjerryludiemandypeacearchiebarleybustercassiechancecheepachiefscooperfamilyhelenaninersoliviaplantsrylandsaintsturkeywalnutbartschfirepitfishinggeorgiaholidaymichaelnesbittnikolaipumpkinwalmartzvarichfootballlozowskicelebratecharlottegratitudehappiness...

DAY 3 2026-02-02

2 Items: LANDPLANTS

Speak Review Wordsearch 2025-01-09

64 Items: IvyMegIceHanaLipsEvansEmilyTreesSeedsBirdsBloodWatermotherfatherNicoleMrNeckMsKeenPlantsWarmthFamilyMemoryTraumaSordinoHeatherFreemanSiobhanJessicaForestsMirrorsMeltingSilenceRealitySunlightHairwomanMsConnorsLibrarianToddRyderIsolationTheMarthasappearanceFriendshipLonelinessDepressionRachelBruinGretaIngridKyleRodgersMayaAngelouComingOfAge...

Natural Selection 2026-04-17

21 Items: fitnesssurvivespeciesvarietydescentdominantecosystemrecessiveevolutionbeneficialpopulationcompetitionmodificationnature will simply _______!differences in genetic traitsinherited like fur color, eye colorfather of natural selection/evolutionproducing more offspring can be supportedvariations that help an individual survive...

may 2025-05-01

5 Items: the season after winter and before summera hobby involving plants, crops, and flowersthe start of new beginnings, the process of changea word representing what you've learned and done, and what its changed for yougreek goddess of nature and growing plants that influenced the month of may was named after

Word Search puzzle grade 6 2024-12-06

20 Items: A new idea or creationPowers your home and devicesA story about someone’s lifeA home for animals or plantsA giant reptile from the pastThe study of stars and planetsA mountain that erupts with lavaTurning waste into something newThe force that keeps us on EarthAn exciting journey or experienceA group of people living together...

Growing Food 2026-08-12

24 Items: a very young planta fully grown plantall the gases around uswhen a seed starts to growa meal that you eat in the morninga meal that you eat in the eveninga small meal you eat between mealswhen a plant starts to grow flowersa sweet food that you eat after a mealthe ground in which plants grow and staya baby plant that breaks through the soil...

Disasters and Global Issues 2025-12-15

10 Items: The condition of being very poor.Being very overweight and unhealthy.Animals or plants that no longer exist.A long time with very little or no rain.A big fire that burns trees and forests.When oil leaks into the sea and pollutes the water.Animals or plants that may disappear in the future.The natural world around us, like air, land, and water....

Beluga science 2025-07-29

65 Items: mapdikemeltfishlandfloodgasessolidearthbirdslakespondsrocksfreezeliquidmapkeymatterpollenplantsforestriversoceansplainshabitatvolcanoanimalsbeachescareerschangescookingfarminginsectsseasonsengineererodionimaptitlenutrientpropertysolutionstrengthweaknessclimatesevidencehabitatsproblemshurricanelandslidewindbreakecologistmountainsearthquakereversible...

Recombinant-Dna-Technology Word Search 2024-12-16

30 Items: ProjectTherapyBt-CropsBio-FuelsTechnologyELISA-TestGolden-RiceGene-CloningGene-TherapyBio-ReactorsCry-ProteinsBio-PesticidesBio-RemediationCloning-VectorsBio-FertilizersEthical-ConcernsTransgenic-PlantsDNA-FingerprintingTransgenic-AnimalsRestriction-EnzymesTherapeutic-ProteinsBioinformatics-ToolsHybridoma-TechnologyMonoclonal-Antibodies...

MODULE 1D: WORD SEARCH 2025-03-15

15 Items: The sense of smell.A germ that causes disease.When plants grow towards light.A protein that helps fight infections.When plants move in response to touch.A quick automatic response to a stimulus.Neurons Nerve cells that control movement.cells White blood cells that make antibodies.System The body's defense against harmful germs....

CFA Review 2026-05-07

10 Items: an organism made of many cells is ____________an animal that only eats plants is a ____________a wolf hunting a rabbit is an example of a ____________plants are ____________ because they make their own fooda trait that helps an organism survive is an ____________animals are ____________ because they must eat food for energy...

UNIT 4 VOCAB 2023-10-06

26 Items: A period of time.A long span of time.A specific area in time.A place for storage of fluids.Earliest era in earths history.Remains of a prehistoric animal.A break in the continuous rock record.Numeric age of a layer of rocks or fossilsRecord of rock layers over a period of time.Living organism that shapes its environment....

Food Web 2025-11-06

13 Items: only eats plantseats plants and animalsonly eats others animalspretend version of somethingan animal that hunts and eats other animalsa living thing that eats other living thingsmany different food chains found in one placethe movement of material through an ecosysteman animal that is hunted and eaten by other animals...

The Natural Environment 2026-05-11

8 Items: the protection of natureillegally catch or kill animalsthe natural environment of an animal/planta situation in which a type of animal no longer existsbe likely to cause harm that share similar characteristicsa group of plants/animals that share similar characteristicsa situation in which an animal is kept in a zoo rather than being free...

Word saerch page 11 TYPES OF PLANTS 2015-07-21

8 Items: PINOÁRBOLPALMAHIERBACACTUSBAMBOOARBUSTOHELECHOS

Happy Earth Day! 2026-04-22

70 Items: SKYLAKEPONDSAFESOILAPRILCLEANEARTHMARCHOCEANOZONEPEACEPOLARPOWERPLANTREUSERIVERTREESWASTEWATERWORLDCHANGEDESERTENERGYFUTUREGLOBALGROWTHLITTERPLANETPLANTSREGIONREDUCEVALLEYANIMALSCLIMATEECOLOGYEROSIONEXTINCTFACTORYGARBAGEHARMONYNATURALNUCLEARPROTECTRAINBOWRECYCLESTEWARDVOLCANOWEATHERCREATIONINDUSTRYMOUNTAINPRESERVEWETLANDSWILDLIFEAWARENESSCONTINENT...

Bunny Word Search 2026-03-24

8 Items: A baby birdA sweet foodA small rabbitA colorful plantFeeling good and gladA round object from a birdA container to hold thingsThe season when plants grow

YLC5 - Unit 6 2025-10-30

10 Items: WaterThe SunCan be trustedStarting and StoppingHeat from planet EarthCreate or produce energyWhere electricity is madeMaterial from plants or animalsTo stop something from continuingMaking the Earth dirty or unhealthy

RICE PLANTING WORD SEARCH 2025-06-01

8 Items: Rice farmers work in P_ _ _ _ field.We eat the S_ _ _ _ of the rice plant.Rice plants need a lot of W_ _ _ _ to grow well.It takes a few M_ _ _ _ _ for rice plants to fully grow.When rice is ready to be picked, farmers H_ _ _ _ _ _ it.Farmers need T_ _ _ ,money and effort to grow their crops....

Plants and Their Parents 2025-12-05

4 Items: parentinheritseedlingoffspring

my random thoughts 2023-04-24

60 Items: gayredtheyoudaywolfropeeasebluefrogsongdragswagbatshavagooddanioamecadeathhappykoreatrollklekishardschoolsayoritypingplantshyphaepoisonshrimppacmanelgatocomedymissesiphonescabinetmonsterillegalaaaaaaacorycattestingamonguscoloradoautodeskwhiptailevacuatefloortileseamonkeyskulletonomegamartflusteredtwentyfivemicrophonediscordantblacksheepturiipipip...

Archie Word Search 2025-11-16

68 Items: ElfJoyLilPieDaveEzraFinnLakeLoveMaiaMayaMimiMoseNikoTallWalkBooneBuddyDavidDucksFokinFrankHelenJerryLudieMandyPeaceArchieBarleyBusterCassieChanceCheepaChiefsCooperFamilyHelenaNinersOliviaPlantsRylandSaintsTurkeyWalnutBartschFirePitFishingGeorgiaGrandpaHolidayMichaelNesbittNikolaiPumpkinWalmartZvarichFootballLozowskiCelebrateCharlotteGratitude...

Pests of Foliage & Flowering Plants 2025-12-01

5 Items: AphidMealyBugWhiteflySpiderMiteFungusGnat

Summer Camp 2025-07-21

70 Items: recbowtugwardyebagcampmesshalllakedockfistbumphighfivesnapclapjoinshowplayflagropelovecuteleaftreesalttotecabinrangearrowshakehandsswingloyalwaterbandssummercamperhikingtalentwisdomcleverplantsforestbucketglovesrubberarcheryfirepitcampingcaptureanimalsvinegarplasticcrackercampfireswimmingcanoeingkayakinghandsomestrengthcounselorhappinessbeautiful...

April 2026 Word Search 2026-03-23

70 Items: MudPalmRainThawBudsWarmGrowMeltEggsWormKiteAprilMonthBloomFoolsJokesGreenTreesGrassTaxesMuddyBunnyNestsWalksRainyRisenLambsSheepFreshEarthReuseCleanWorldFourthEasterSundaySpringPranksGardenPlantsSproutTulipsRabbitRobinsChicksHikingBreezeBonnetJoyfulPastelPlanetReduceOceansShowersBlossomRainbowPuddlesThawingRejoiceRecycleRainfallPassoverSunshine...

Grade 5 - Word Search 2026-05-15

70 Items: birdfishheadveinhostfungivirusalgaefernscoccibrainlungsheartliverchestbloodmolarvillimossesplantsmammallitteroxygenarteryatriumcanineureterstrokevectorjointsprotistanimalsfincheshabitatbacillispiralsreptileextinctextinctkidneysabdomenincisorurethrabladderneuronsobesitybacteriaconifersprotozoadiarrheadialysisdiabetesfloweringgalapagosamphibian...

Things We Learn about in Agriculture 2023-09-26

70 Items: ffasaesoillandpigsplowcorncostfeedmilkwoolboerbeefmeatrootscreedacresducksmulchdairysheepgoatstreesbreedcropspestswheatlaborseedslambspigmydairywaterdicotplantscattlenaturecottonsupplydemandchicksgrowthgrowingtiffanyanimalscombineerosionfarmersdroughtgroceryproducemonocotchickensnotchingproductssunlightlivestocknutrientsmachinerymarketingleadership...

What Do Plants Need To Grow? 2025-03-24

6 Items: SunAirSoilSpaceWaterNutrition

Vocabulary Lesson 8 2022-11-08

10 Items: The _____ of the word "bright" is "brightest."Building a bridge requires _____ calculations.The word _____ is similar to the term "exonerate."Some conflicts can be _____d by proper communication.After _____ing the data, the scientist concluded a trend.You can use a pesticide to kill plants and an _____to kill plants....

Things Found in a Library 2026-02-05

67 Items: meCDsToysMazeNookDVDsSinkBooksMangaTablesChairsPlantsNoExitLaptopCoffeeHeavenCouchesWeepingPigeonsHistoryLostKidBeanbagBindersBlu-rayCamerasWormholeStudyingarchivesDatabaseBathroomLibrarianComputersPaintingsBookShelfCorkBoard3DprinteraudiobookmagazinesmicrofilmCassettesDictionaryCrimeSceneSpecticalsManuscriptNewspapersBoardGamesFiveBodies...

biology 2026-04-27

23 Items: single cellnumerous cellsremoval of wastemany food chainswhere animals livebuilding blocks of lifestudies how nature wordsbiology is a _ of sciencefeeding habit only for meatthe ability to have offspringfeeding habit only for plantsstudies how things are made ofsomething that eats its own foodsomething that makes its own food...

Vocabulary 2024-10-30

48 Items: tentwillyummysweetjuicycamperchooseboringfutureleavescollecttonightprivatecrunchycampfirebranchestomorrowperuvianapartmentvacationswonderfulexpensivedangerousfind-foodnext-weekwhat-timenext-yearon-fridayimportantdifferentvocabularyevaluationcatch-fishpick-fruitread-a-mapdestinationin-two-daysgo-to-sleepintelligentaccomodationbeach-resort...

ROGELIO'S Word Search 2026-02-02

76 Items: FoxCupPackDeskLampJessNikeCityHeroCaseGangTallBagsCrazyFlagsBooksShoesBuggyAppleBloodGreenCurlyNightSuperBoardWaterPaperTimerBrentBrutalBrazilSchoolPlacesPlantsColorsPhonesSoccerSportsFlowerStatesGhettoFamilyArtistScreenExpandSnacksAmazingWarningJordansSweaterStreetsWindowsMorningHennesyStreetsUnknownRogelioBuildingAirMaxesMarylandComputerFootball...

Science Vocabulary 2026-05-27

20 Items: Moving energyStored energyA weather predictionWhat all cells are made ofA scientist who studies weatherThe longest bone in the human bodyA shovel is this type of simple machineThe simple machine used to raise a flagThe large teeth in the back of the mouthThe scientific name for a flowering plantThe layer of the atmosphere we breathe in...

Vocabulary Word Search #3 2023-04-14

12 Items: shakingstrangeannoyingreliablevery pleasinga quiet crying sounda musical instrumentused logical thinkingability to make plants growdoing things in a particular ordermoving very fast in a dangerous waya place where people serve a sentence from the courts

Records Word Search 2023-03-23

73 Items: cvasisteadeskmailtapeswinsaidpchbcartmaskkeysfilesboxesclockchairmouseemaillunchskypeteamsmicaselinkinwindowplantsreginacoffeerecordscubiclestaplermonitorprinterscannerwiteoutoutcardgarbagesortingletterselasticbasketsmarkersstoragechequesministrycomputerkeyboardenvelopescissorselevatorinternetvacationcalendarholepunchdatestamprecyclingtelephone...

Planty Word Search 2024-08-28

67 Items: IVYPOTMIXHOYAFERNLEAFSOILMOSSGREGLEAFBARKCOIRFICUSPILEALIGHTWATERSEEDSPLANTPESTSROOTSPILEAHERBSPOTHOSCACTUSGARDENPLANTSGROWTHAROIDSPOWDERFLUVALGARDENBEGONIAPERLITEFOILAGEORGANICMARANTAMONSTERADRACAENAALOCASIACALATHEAAERATIONDRAINAGEALOCASIASUNLIGHTHUMIDITYTROPICALANTHURIUMAGLAONEMAKALANCHOEPEPEROMIASUCCULENTSYNGONIUMBOTANICALSUBSTRATEZAMIIFOLIA...

SM F 2025-03-27

73 Items: verybeginexcelferryofferpurserefersoundadvisechordschorusdifferechoesforbidforgotgrowthoriginplantssafetysuffervisualallowedcurtailforgiveforsakehealthymodestyomittedunhappyallottedanchoredapproachbackachebeginnerchemicaldisasterdiscipleexcelledforsakenmarriagemilitaryoriginaltransferallotmentbeginningchemistrycommitteeexcellentforbiddenforgotten...

G6_V2 2025-10-03

72 Items: fatsachespotsgenesrelaxcluesdeityspeartauntruinssandylongergrainsratheractivesecretplantsbelongoraclespranghurledwreathsceniccasualsupportcompanytridentunfazedstunnedweaponstiniestbattlesworshipstadiumbroughtshieldscanyonsreservesmoothlyprophecyinfinitepregnantoriginaloutlawedvisitorsultimatesuitablesplendorstunningevidencemedievalvillagesnutrients...

April Fools Word Search Two 2025-03-31

75 Items: isfuneggthehoaxzanybeeswarmfawnpeephuntwildjokehaharusethisfaceamuseAprilfunnysillyprankmonthhumorsunnyhoneybunnybreaktreesgrasslaughkookysmilecheerspoofshockquirkyspringschemeseasonpollenplantsbreezejoyfulgigglechickscloudswonderpuzzlewisestchoicesmileycomicalfoolishmisleadshowersflowerscomedicplayfulanimalsrainbowmisleadjokestergulliblesurprise...

Capibara Ch 5-6 2025-04-09

21 Items: butthenverywantsthe lakecan swimdestroysthey walkcan't swimis not biga lot, muchwater vaporthey producewants to attacka big hamburgerthey walk throughdestroys the treesthey swim very fastdestroys the plantsenters (in) the waterdoesn't have a lot of water

Renewable energy Snjeza Word Search 2026-04-20

18 Items: Moving air.Dirty air from fire.A machine that spins in the wind.A small thing that stores energy.Water that flows across the land.A vehicle we drive on the road.A mountain with hot lava inside.Energy that gives us light and power.A wheel that turns in water.A place where water makes electricity....

5. Cells & Energy 2022-11-02

22 Items: without oxygenSugar (C6H12O6)requires oxygenBasic unit of lifethe outer covering of a cell or organelleget their energy from the sun, example plantsplace in a eukaryotic cell where the DNA is locatedtiny structure that performs a specific job in a celladenosine triphosphate, a molecule that stores energy...

Vocabulary 2024-10-30

48 Items: tentwillyummysweetjuicycamperchooseboringfutureleavescollecttonightprivatecrunchycampfirebranchestomorrowperuvianapartmentvacationswonderfulexpensivedangerousfind-foodnext-weekwhat-timenext-yearon-fridayimportantdifferentvocabularyevaluationcatch-fishpick-fruitread-a-mapdestinationin-two-daysgo-to-sleepintelligentaccomodationbeach-resort...