plants Word Searches

Fruit Word Search 2025-12-11

2 Items: hot, tall, different, placeplants, rainy, type, trees, growth

trs 5b w17 pt1 2022-06-06

10 Items: adj.dark placen.what people knowv.put things in a bagv.put something on a hookn.a person who is not freen.for example rice,wheat,oatsn.food made from cooking oats in waterv.get away from something dangerous, get outn.trees, plants, oceans, wild animals, mountainsn.a kind of small vegetable, e.g. red, black, yellow, green

Capítulo 5, segunda sección (No spaces; Include "the") 2025-01-29

33 Items: doordeskcitychairpatiotablestreetplantsgaragewindowto liveneitherto cookkitchencountryaddressbuildingbathroomto cleanoutskirtsbig/largeapartmentsofa/couchdining roomliving roomyard/gardentown/villagesmall/littleto do choresto make the bedto cut the grassto take out the trashnobody/not anybody/no one

6th grade Social Studies 2026-05-27

90 Items: WarMapSeaGDPUSAWW1WW2OilWorkAsiaFoodLakeIncaMayaOmecSerfTsarMoneyGlobeLaborPlainOceanRiverSpainWaterIslamLotusSocialPeopleAfricaEuropeLegendDemandSupplyProfitFranceCanadaMexicoPlantsTibuteNoobleFeudalTundraPlagueFamineHungerLeadersCultureHistoryShelterIsthmusEnglandDiseaseAnimalsDroughtEconomicLocationLatitudeLanguageMountainPoliticalElections...

ITS ALL ABOUT MICROSCOPIC LIFE 2024-03-01

22 Items: The powerhouse of the cellSingle Celled microorganismsone-celled aquatic organismsGreen pigment in plants and algaea substance capable of causing cancersmallest unit that can live on its ownMaterial within a living cell-jelly-likeSmall common fly found near rotted fruitViruses that infect and replicate in cells...

YLC7 U1 2026-04-08

10 Items: – Riding a bicycle.– Helping others without pay.– Moving rhythmically to music.– Growing and caring for plants.– Making bread, cakes, and desserts.– Writing computer programs or software.– Completing games like crosswords or Sudoku.– Gathering items like stamps, coins, or figures.– Moving through water for exercise or recreation....

Spelling 5 2024-03-27

10 Items: opposite of badopposite of lastopposite of emptya running contestpast tense of takeround shape with no cornerssmall animal with wings and a beaksubstance on the ground where plants growan enclosure that usually contains pets like birdsto want something to happen or be true (root word with ing)

Unit 1 Weeks 1 & 2 Wonders Vocabulary 2024-09-17

8 Items: to show a signan unexpected meetingsteep, like the face of a cliffvery impressive; exciting to seethe scattered remains of somethingspecial force used when saying a particular wordfamily in the same era who have a common ancestora person studies things in nature (plants & animals)

parkers manwuel amaral 2024-04-26

12 Items: a commandfront of buildinga line of soldiersdecent from ancestorsattach a boat to a ropeplants with shiny leavesa nose or jaw on any animalstand upright from the skina intense feeling of longing someonea word used when something is fallingsimple laws for any type of governmentsomething being stretched or mental pain

May 2026 Word Search 3 2026-02-18

19 Items: degree of heatto turn over soilpredicted weathersoil water removallimited direct sunrelating to springrelating to a seasoncomplete sun exposurea small garden sectionto allow air into soilamount of sun receiveddistance between plantsa line of planted seedsa prepared planting areato prepare and grow soilsmall local climate zone...

Our Environment 2023-10-10

15 Items: Bodies of flowing water.Channeling waste into open sea.An overflowing of water onto land.The land near a shore where water and land meet.The method of providing water to dry land for farming.The action of making an environment impure or unclean.Forest with tall trees that are found in places near equator....

Water Cycle 2026-01-15

11 Items: energy from the sunrain snow sleet hailliquid changes to gaswater moving downhillwater evaporating from plantslayer of gas surrounding a planetan underground reservoir of watergas loses energy to become a liquidpowers the water cycle toward the earthpowers the water cycle toward the atmospherea collection of condensed water in the atmosphere

Gases 2026-05-26

5 Items: Greenhouse gas used in fertilisers.A gas that maintains atmospheric humidity.A form of stored energy produced by plants.An inert gas with many industrial applications.A gas used by all human beings for respiration.

5th Grade Vocab Unit 3 Week 2 2025-12-05

5 Items: moved by twistingallow, accept, put up withliving spaces; a place to stayfelt excitement; felt a prickling sensationhaving a certain mixture of clay, sand, and organic material; having a texture good for growing plants

jobs 2025-11-27

3 Items: DESERT MANGO PLANTSCITY SCHOOL BOOK SMILE MUSIC OCEAN RIVER FOREST SPACESPORT PEOPLE HILL BLUE CLOUD APPLE STARS WATER ANIMAL, HOUSE

Adult Word Search 2026-05-04

100 Items: MapSetTLCCampKindNapaokieRainTallUggsAdultBagelBeachBraveDramaDriveDutchMusicNiecePizzaQueenSlideSleepSmartUrbanAlbumsCataanCousinElevenEloiseFrenchFriendGreaseHippieHitterLyricsMiddlePlantsPunkerSubwayTuxedoBambiniBlockerCharlieCuriousHistorySiemsenSublimeSwiftieVintageBlanketsBohemianBuildingCityGirlConcertsCrushersDaughterGryphonsInandout...

Sunshine Word Search 2025-04-28

9 Items: A holiday in early JulyBright light from the SunWhat people drive in waterWhat you do with a sailboatWhat people use to cool downThere are 4 _______ in a yearWhat season has Aug, June, and JulyWhere food, flowers, and plants growWhat people have when they eat outside with friends

UNIT 8: THE ENVIRONMENT 2026-05-25

30 Items: to absorbdangers or problemsenergy from the sunto have no more leftto increase somethingto reduce or chop down→ to help in a situationto finish all of something→ to try to solve a problemnot harmful to the environment→ to stop something completelyto tolerate something unpleasant→ to throw rubbish on the groundcoal, oil, and gas used for energy...

100 Days of Learning 2026-01-21

100 Items: PEbusArtTagTryMathGlueDeskTimeStarMusicLunchKruerBooksChairpaperTestsnamesMoneySmileSmartProudFocusLearnCountSchoolRecessShapesGraphsPlantsTigersReadingWritingLibraryFriendsTeacherPencilsCrayonsMarkersFoldersQuizzesPhonicsGrammarStoriesWeatherAnimalsHistoryIndianaRespectHonestySharingHelpingclassesfundays100DaysNumbersSciencePrinterJournalLearning...

100 words: Word Search 2026-04-28

100 Items: haysuitbeamexitboldtalkburnhearhugeprayricehalfcarepassshopslowfirenameshareadoptnoiseawfulgreenpricespinebrowncourtspoilshakefreshcatchcarvedancesteellevelpennyfieldsouthtrunklovedknockharboroffenddenialrewardscreengivingresignpledgeshadowremarkrotatevioletcousincameraneedlegoldenplantswealthfollowofficepockethiddenschoolspeakerproducetexture...

Origination Places of Plants that are Commonly Found in Ireland 2026-03-05

8 Items: RomeAsiaFranceGreeceEuropeGermanyMoroccoUnited-States

Memorialday Word Search 2023-04-07

100 Items: sunskyhathoesoilrainkitelawnirislilyhoserakecartmulchseedsgrasssteakshadepatioedgertreesfruitpansydaisypeonyroseslilacspadeplantspaversedgingcloudstableschairsbreezedryrubhotdoggazebogardenorchidazaleafescueshovelglovestrowelshearstraegerpelletsnurseryflowersvioletspetuniatrimmermulcherannualsbarbequemarinadeswimmingbackyardlavendercamelliadaffodil...

101 Words of Us 2025-07-05

101 Items: TeaADHDBeanBusyCatsDiceDogsKindLoveMattRepoSoftSoupWifeWineYarnBeardBreadChaosChessFunnyGonksGoofyHairyLoyalMangaRingsRobynScifiShipsSillyTanksActionBakingCheeseClumsyComedyFamilyGamingGollumHorrorLovingNaturePlantsSpookyWeirdoXFilesBexhillBristolCookingCrochetDevotedDwarvesFantasyFlowersFriendsGenshinGremlinHistoryHusbandMarriedOctoberPatient...

MARCH 2026 2026-02-09

99 Items: BUDDEWSUNJIGMUDPOTREDAIRYBEERBLUEDAWNDUSKFOURGOLDGROWHARPHOPEJADEKISSLAMBLEAFLIMEMINTPALMRAINSAGESNOWTHAWTIMEWARMBIRDSBLOOMSUNNYCHEVYCOLORDAIRYGREENIRISHLUCKYMAGICMARCHMONTHOLIVERESETROBINSHAKETHIRDWINDYBREEZECHEERSCLOCKSCLOVERDRINKSSUNDAYGARDENGROWTHINDIGOSPROUTORANGEPARADEPASTELPLANTSSPRINGRETURNVIOLETYELLOWBAGPIPEBLOSSOMCABBAGEEMERALDEQUINOX...

Adult Word Search 2026-05-04

100 Items: MapSetTLCCampKindNapaokieRainTallUggsAdultBagelBeachBraveDramaDriveDutchMusicNiecePizzaQueenSlideSleepSmartUrbanAlbumsCataanCousinElevenEloiseFrenchFriendGreaseHippieHitterLyricsMiddlePlantsPunkerSubwayTuxedoBambiniBlockerCharlieCuriousHistorySiemsenSublimeSwiftieVintageBlanketsBohemianBuildingCityGirlConcertsCrushersDaughterGryphonsInandout...

Abiotic Word Search 2024-07-31

100 Items: dnagpsboabdatadensfirefoodpupsalgaeclamscoralcrabsdingodunesfangsfungijoeyskoalanestsoceanriversharktoxictrapstreeswateralpinebioticdesertdronesdugongforestmagpiemarinenumbatplantspossumpythonspiderspinestaipanwattlewhaleswombatabioticanimalsbanksiaburrowsestuaryflowershabitatoctopuspugglessensorsshelterviruseswallabychemistseucalyptkangaroo...

Module 1C Processes in Plants and Animals (Regulation of Fluids, Chemical and Nervous Control) 2025-03-17

15 Items: axonponsurineAuxinskidneyneuronureterestrogenendocrinecytokininsepinephrineGibberellinschemotropismtestosteronephytohormones

Plate Tectonics 2025-12-05

10 Items: Ring of Fireplate landplate OceanSan Andreas fault earthquakeLocation where two plates move apartarea where magma is close to the crustLocation where two plates hit each otherimprints of ancient plants or animals in rocksWegener who thought that the continents fitspreading when a new rock forms, mid ocean ridge

Sum Word Search 2024-03-13

16 Items: dew on grassrain,snow,hail,sleettotal amount or wholehow you quantify dataan object's mass on earthwhen energy causes changedata obtained by observationevaporation of water by plantswater changing into water vaporneeded to cause motion or changeno matter added or lost (system)precipitation not absorbed in soilphysical "feel" of matter (property)...

Morphology Week 3 2025-02-02

7 Items: near or close to.under + to stretcha community of plants and animals.not + free from + care + quality of beinglife + apart/different + turn + quality of beingan atom or group of atoms with an electrical charge.a statement about what the possible result of an experiment might be.

Classification Word Search 2026-01-09

8 Items: Organisms w/o a nucleus.The name of “our” domain.Science of naming or classification.The “Father” of the science of naming.Kingdom known as containing decomposers.Another way to refer to a scientific name.Kingdom where cells have walls made of cellulose.Scientist who first separated organisms into 2 groups (plants & animals).

Test Word Search 2022-11-22

100 Items: jambaginklipicetoepettestcarsroadlacelinefowlbonelookarmyantsyokesoupplothoseweekraincartwallsailwashdustwordfactviewsensemetalplantsparkcabledrinkrangebadgeduckswastecoastriverrouteslaveskirtclasswatchbirthwavesfrogschalkfieldsheepgroundregretmotionhammertheoryflowerislandflightcreditchangecannonriddleplantsminutecactusharborcheesebucketcherry...

ET 5 VOCABULARY 2025-02-03

100 Items: ofeathittaskplanbusyviewsavesafeverywalkrudetripeasyfarmshowliveparkcitynursecoachtraintrashshoutcheatqueuetruthupsetallowbringwritetradewatchvisitsincemusictowerdriverlistenontimeadvicehonestbehavefarmermarketplantsmosquetemplechurchmuseumstatueteacherbereadyprepareprotecthappilyrubbishchewgumcuriousrespectproblemsuggestconfuseopinionfactory...

Ethans Word Search 2025-10-09

100 Items: sunseaecoiceairlifetreebirdwildlandpondrainfishfirelavaparksoilfoodkindfloraoceanrivercloudgreengrasswoodsbeachhumanfrostcometworldalgaespacelemurwaterparksgardenplantsspringflowerplanetnatureanimalcosmosfungusbeautyfloraljungletrailsearthyliquiduniquewinterspirithikingfaunasmammalstreamnaturalanimalsnurtureglacierweathertornadoseasonshabitat...

April 2026 Word Search 2 2026-02-18

21 Items: a sweet smellbecoming greenpleasantly warma pleasant smellsoft pale colorsproducing bloomsa ray of sunlighta distinctive odorrichness of colorsrepeated rainfallsoutside in open airbeginning to developa paved outdoor areaa seasonal celebrationnatural light during dayincreased daylight hoursa sudden heavy spring raingentle or moderate weather...

Term One HASS 2026-03-24

100 Items: ACTMapPastLandLakeSandReefCaveEastWestMungoYearsDiaryToolsRocksUluruCoralOceanCoastStoneWavesEarthWaterLearnStudyBeachRiverNorthSouthStatesFossilSourceLetterPlantsSacredDesertMarineLegendCliffsIslandNatureLocateForestTravelRegionIslandCapitalCultureHistoryPresentCountryRespectAncientPrimaryObjectsNaturalStreamsErosionExploreShelterHabitatCompass...

Module 1C Processes in Plants and Animals (Regulation of Fluids, Chemical and Nervous Control) 2025-03-17

15 Items: axonponsurineAuxinskidneyneuronureterestrogenendocrinecytokininsepinephrineGibberellinschemotropismtestosteronephytohormones

Heart Word Search 2024-05-21

15 Items: the "blue blood"the gas we exhalehow you feel thingsblood the red bloodthe lightest elementthe gas we breath withmain organ in your bodythe thing you breath withcarry blood to your hearthow you see with your eyesthe things that produce airthe largest organ in your bodythe smallest organ in your bodyThe main liquid that you have to drink...

Dipthongs "ou" and "oi" sound 2023-12-07

10 Items: You go _____ the slide.Soil is the color _____ .I don't know _____ the book.It is rude to _____ at others.My mom _____ my missing homework.Ms. Stapleton plants flowers in the _____ .Ms. Firman has such a pretty singing _____ !I have two eyes, a nose and a _____ on my face.I hope the students do not _____ the classroom....

Vocabulary Activity 2025-08-24

10 Items: Full of grassIn the same way, fairlyWent in different directionsA person who goes on a journeyWas not sure or felt uncertainShows the way or takes to a placeSmall plants and bushes under treesThe way two things are not the sameNot straight; moved the body or head forwardA long breath showing feeling (tired, sad, or relieved)

hydro/hydr 2026-04-21

10 Items: to remove waterto supply with waterlike or containing waterliving or growing in watera tank of water animals or plantsthe study of water and its movementa channel or pipe built to carry waterrelating to electricity made by water poweran undergrownd layer of rock that holds wateran upright opipe with a nozzle for drawing water

South America Vocabulary 2022-11-13

15 Items: synonym soaklow-lying areascomplete controlsynonym for plantssynonym for modifycarefully uncoveringWorlds largest waterfallDriest desert in South Americapeople who move from place to placeobjects left behind by past culturesthe variety of species in an ecosystemwide open areas used for grazing and cropssmall rivers that drain into a larger river...

Water Vocabulary (Part 1) 2026-03-23

15 Items: water > iceice > watersteam > waterwater > steamfar from the seawater without saltclose to the ocean/seaa wall that blocks a riverplants that we grow to eatpower/energy made from waterbig pieces of ice on a mountaina place that keeps/stores watera type of water that we find in the seathe process of putting water onto fields...

Noa's hydro/aqua word search English period 3 2026-05-06

10 Items: to lose waterlike or containing waterliving or growing in waterto supply with or absorb waterthe study of water and its movementchannel or pibuiltult to carry wateran underground layer of rock holding waterrelating to electricity made by water powera upright pipe with a nozzle for drawing watera large tank for holding aquatic plants and animals

TUNDRA 2025-02-18

3 Items: OXEN, CARIBOU, LEMMING, SNOWY OWL, ARCTIC HARE, BIOMEADAPTATION, PERMAFROST, ARCTIC FOX, TUNDRA, LOW-LYING PLANTS,REINDEER, WOLF, MOSSES, GRASSES, MIGRATORY BIRDS, SEAL, POLAR BEAR,

Nitrogen Cycle 2025-10-07

8 Items: NO3NO2Nitrogen takes up 78% of the _____Plants get nitrogen via this processProcess of turning ammonia to nitrates and nitritesWhen lightning turns nitrogen and oxygen to nitrates and ammoniaProcess where bacteria put extra nitrogen in the soil into the airDead organisms & wastes get broken down by bacteria & fungi and gets turned back into _____

Characteristics of the Antarctic Ecosystem 2026-06-05

19 Items: The continent located around the South Pole.Web - A network of interconnected food chains.- An organism that makes its own food using sunlight.Sheet A very large mass of ice covering a large area of land.Ice - Frozen ocean water that forms on the surface of the sea.The distance north or south of the Equator measured in degrees....

Saguaros in the Desert 2025-04-07

11 Items: made of rockto stay alivea type of cactuscompletely or entirelythe main stem of a treenot hot or harsh, or strong in tasteto stretch out or extend toward somethingan area of land that does not get much rainan animal that hunts and eats other animalshard, pointed parts on some plants, animalsdarkness created by shelter from the Sun's light

Ava's Word Search 2024-05-17

14 Items: We grew themStraighten your armplace of living thingsWho spilled the _____?Spongy part of the bonepart of the ocean floorWhat plants need to liveMuscle that bends you armHelp you jump, walk, and runSomething red that flows in your bodyMove your arms in different directionsProtects your organs and help you balance...

100 days of school 2025-02-19

100 Items: ArtDeskMathPlayQuizSongTestAwardBoardBooksBreakCraftDanceMusicPaperRulesStoryCaringFrenchGermanPencilPlantsSafetyShapesSocialTabletAnimalsCanteenColoursConcertCrayonsFriendsInquiryNumbersProjectReadingRespectSeasonsSharingStudentTeacherThinkerWritingAlphabetBackpackBalancedCeremonyComputerEqualityFairnessHomeworkInquirerInternetKindnessLunchbox...

Vocabulary Word Search 2026-05-14

15 Items: lakes, rivers, and wetlandsocean, coral reefs, and estuaries.distance from the equator affects temperaturefour distant seasons. trees lose leaves in autumntemperature and precipitation are the main factors.organisms evolve traits to survive in their specific biome.organisms evolve traits to survive in their specific biomes....

Wildrice Word Search 2025-11-20

4 Items: Beansone food plants that make up the Three Sistersany of four species of grasses of the Genus Zizania that have grainCorn cultivated 10,00 years ago in the region known today as Mexico

Bo 5.0 2025-01-26

17 Items: מִצְווֹתPlague #8Plague #9“come”, Hebrew“good” in Hebrew“Mitzvah” Hebrew“Hello” in HebrewThe king of Egypt.“Let My people ____”The Holy One’s calendar.Nothing new here…. Ecc.1:9The letter ‘mem’ pictures??The ‘sign’ on the doorposts.“We’ll done, good and faithful _______”These had light during the plague of darkness....

Ecology Word Search 2024-05-10

14 Items: Land biomeWater biomeIndividual living beingDescent with modificationPopulation growth with limitsVariety of species and organismsPopulation growth without limitsOne organism hunts and eats anotherRemoval of trees/ forests for human useDone by plants to create their own energyAll living and nonliving things of an area...

Human Interaction 2025-02-27

18 Items: the cutting down of foreststhe gases that surround the earth (close to earth)hazy air that contains smoke or particles or other pollutants.all the waters on the earth's surface (e.g., rivers, lakes, oceans)Gases in the Earth's atmosphere trap infra-red heat near the Earth.the hard, solid part of the earth (e.g., the soil and rock near the surface)...

100 Days of School 2025-02-19

100 Items: ArtDeskMathPlayQuizSongTestAwardBoardBooksBreakCraftDanceMusicPaperRulesStoryCaringFrenchGermanPencilPlantsSafetyShapesSocialTabletAnimalsCanteenColoursConcertCrayonsFriendsInquiryNumbersProjectReadingRespectSeasonsSharingStudentTeacherThinkerWritingAlphabetBackpackBalancedCeremonyComputerEqualityFairnessHomeworkInquirerInternetKindnessLunchbox...

LIVING AND NON LIVING THINGS 2026-04-14

10 Items: Plants need this to make foodSomething that grows into planthot things you should not touchliving things that swims in waterSomething that is alive and growsSound that makes ypu cover your earsWhat we call the change after a stimulusNon- living machine that does not need foodA change in surrounding that cause a reaction...

Spanish Vocab 2022-10-07

30 Items: to dryto washto ironto peelthe mopthe poolthe messthe wallthe lampto sweepthe oventhe housethe couchthe broomthe stovethe hangerthe windowto hang upto preparethe bedroomthe armchairbathroom sinkthe furnitureto plant flowersto set the tablethe refrigeratorto water the plantsto clean up the tableto take out the trashto tidy up/to clean up

early childhood 2024-04-12

111 Items: artgluedesktoyssnacknannytablechairpaperbooksnursepaintmusicstaffwipespencilfidgetrecessschoolshapesblocksdiaperinfantcraftsplantsweeklycareertabletteachercrayonsnumberslettersmarkerspuzzlestoddlerdaycarenewbornsupportanimalsweathersciencedancingnurseryprogramculturecubbiestissuesmagnetssandboxchildrenbackpacklunchboxsandwichemotionslearning...

Tent Word Search 2026-02-05

10 Items: - a path for walking in nature- resting in a tent or sleeping bag- a bag used to carry camping things- bright lights seen in the night sky- meals cooked or eaten while camping- plants, animals, and places outside- a tall plant with a trunk and leaves- a large body of water near campsites- a small fabric house used when camping...

Debris, Word Search 2026-04-08

16 Items: We met a bear.It is amazing.I was very afraid.We picked up trash.Let's get together.To show or point out.We finished the project.We re-followed our steps.I was __________ by a bear.It is hard to read the text.There are many food choices.My grandfather, father, and me.The large size of this mountain.Someone who likes animals and plants....

èèà 2023-08-09

102 Items: èèeameeeabeeskyvantigvanfoxcubwetyoueerkholamoonvansmisssopanovaladycribrumizynnfallrosewinehugsfishdaisytacosstarsseventatertorchsnugsrocksuraqthoneydrivehiiiifloatyummygoosebonitalizardplantssnoopybirdeasmilesreavenawakencoffeespringtumaloaddictgoslowalwayspiscesflowerscuddlescuddlesvermontredbullworkoutgoosiesallwaysthemoonscorpiomissyoubeeahive...

Tumble leaf 1 2026-03-23

107 Items: FIGFOXBOGYAKSUBTOPICEFOGSHIPCRABSHIPHOLEBEARPINEWOODLILYFROGSNOWTWIGLONGOKRABULBPARKBEESCLAMKITEBALLTUBEMASKPUMPSANDSLEDSTICKPEACHMAPLEHEDGEGOURDPIANOAROOHGEODESNAKEPAINTGRUBSBLOOMBUNNYTRAINHONEYCOINSSTRAWKAZOOLOGBUGLEGBUGTWITCHTINKERAUNTIEBAMBOOTURTLEBEAVERDRAGONTIMBERPLANTSSPIDERPEBBLEMUFFINSPRINGBUCKETSPONGEFIGLOOSHOVELMAGNETTREEBUGCOOKING...

Biology Word search 2024-04-30

20 Items: the basic SI unit of energyorganisms that make their own foodthe primary component of macromolecules,relating to or resulting from living thingsan animal which feeds on dead organic materialthe animal component of the planktonic communitymatter that has come from a recently living organismkill, repel, or control forms of animal and plant life...

Stem Word Search 2026-05-06

13 Items: A science test we do to find out how things work or grow.The "energy" from the sky that plants need to grow big and strong.The liquid we give our seeds to "wake them up" and help them grow.Old leaves and food scraps that turn into "super-food" for the soil.These are usually green and grow out from the stem to catch sunlight....

Roots Word Search 2026-05-06

13 Items: A science test we do to find out how things work or grow.The liquid we give our seeds to "wake them up" and help them grow.The "energy" from the sky that plants need to grow big and strong.Old leaves and food scraps that turn into "super-food" for the soil.These grow underground to hold the plant in place and drink up water....

Everything Rocks! (Definition) 2026-04-27

19 Items: Melted rock beneath Earth’s surface.Melted rock that reaches Earth’s surface.A dark igneous rock formed from cooled lava.The process of a liquid cooling and becoming solid.A metamorphic rock with light and dark bands or layers.A type of rock formed when melted rock cools and hardens.A type of rock changed by heat and pressure inside Earth....

Local Word Search 2026-01-04

15 Items: a ball of airmore than twoto ride a bikemade from plantsallowed by the lawnear where you livea desert animal with a humpto risk money to try to wina container used to boil watera long passage under the groundto go from one place to anothera woodland animal that eats nutsawake at night, asleep in the dayyou travel in it like a car or bus...

Jobs 2024-03-14

12 Items: Someone who catches fishSomeone who helps a doctorSomeone who cuts down treesSomeone who works in factorySomeone who works in a schoolSomeone who constructs buildingsSomeone who sells things in a storeSomeone who grows plants for us to eatSomeone who cleans and fixes our teethSomeone who gives us medicine in the hospital...

Bay Model 2024-07-06

11 Items: A problem solverThe creation of new ideasA mixture of salt and fresh waterThe proper use of natures resourcesThe protection of nature from damageThe system of rivers, lakes, and baysThe ocean that the SF bay drains intoThe body of water where rivers meet the seaThe wetlands where rivers flow into the bayAnimals or plants that came from another area...

holocene 2025-06-09

10 Items: current geological agethe destruction of habitatthe variety of life on earthlong-term changes in temperatureage of humanity becoming a major forcethe natural rate at which species go extinctthe surge in human population in the 20th centurya time when most species go extinct in a short timeplants/animals in non-native environments which they harm...

Paleolithic Age 2026-03-12

12 Items: Large animals.A long time with no rain.How a group of people live.Land that connects two places.Water and plants in the desert.Tools people make to help them.Very old objects made by people.Very old bones or plant marks in rocks.Scientists who study people and culture.When people or animals move to a new place....

Nitrogen Word Search 2026-02-09

18 Items: Harmful substances that pollutes the air.Such activities are not advisable during a haze.haze can cause ________ to our eyes, nose and throat.A method to reduce the number of vehicles on the road.Burning of ______ fuels release pollutants into the air.What acid rain can do to statues and buildings over time...

Hydr/hydro aqua 2026-05-04

10 Items: like or containing waterliving or growing in waterTo remove water; to lose waterthe study of water and its movementTo supply with water; to absorb watera channel or pipe built to carry waterrelating electricity made by water poweran underground layer of rock that holds waterAn upright pipe with a nozzle for drawing water...

Sustainable cities 2026-04-28

29 Items: (Moving air)(Active play)(No pollution)(Where we move)(A way to walk)(The big picture)(A place to rest)(Natural cooling)(Green transport)(Green open space)(Best way to move)(Don't throw away)(Working together)(Top of a building)(Our green friends)(Where things grow)(Our energy source)(Building structure)(Part of the nature)(Natural brightness)...

Hydrate Word Search 2026-05-04

10 Items: like or containing waterliving or growing in waterTo remove water; to lose waterthe study of water and its movementTo supply with water; to absorb watera channel or pipe built to carry waterrelating electricity made by water poweran underground layer of rock that holds waterAn upright pipe with a nozzle for drawing water...

OUR SKIN 2023-04-06

17 Items: germsstretchto protectprotectionto rely onon the outsideusually, typicallybeing in the insideto make sth strongerto keep sth constantto be of certain weightthe outer layer of the skinto keep sth in order to use it latereach of the tubes that carry blood around the bodya thin flat area, usually lying above or below another...

APES Unit 11 2024-04-30

12 Items: Bottom of the ocean97% of water is ________Factor in water availabilityUnevenly distributed human needCover 71% of the Earths surfaceNot enough light for photosynthesisTransport water over long distancesamount of water used for all purposes per personOpen water, contains phytoplankton to photosynthesize....

Ecology: Word Search 2025-10-03

41 Items: Eat plants.Eat other animals.Consume dead animals.Single living entitiesBoth organisms benefit.Living parts of an ecosystemEat both plants and animals.The variety of life in an area.Nonliving aspects of an ecosystemThe number of species in an area.Neither organism affects the other.Consume dead organic matter (detritus)....

ww4 u 11 alternative 2024-06-28

20 Items: eyesighta mixturegreat; largeill-manneredto disappeara long, deep cutthe amount producedof or used in seeingdull and uninterestinga state of being boredto make or have a change ina plant that lives for one yeara dull and uninteresting personmade by humans and not by natureto feed; to support or make growa change in form, position or color...

Hydrogen Word Search 2025-11-16

20 Items: Noble gas in balloonsSoft metal in batteriesHighly reactive halogenSemiconducting metalloidDisinfecting halogen gasEssential for respirationNoble gas glowing in signsLightest element, fuels starsEssential for bones and teethBasis of life, found in diamondsMetalloid in borax and detergentsEssential for DNA and fertilizers...

Mall 2026-01-24

115 Items: mugrugteatoybeltbooklampringtotebootscandycoinsdressjeansmousephonescarfshirtshoessocksteddywatchankletbeaniebindercandlecoffeefoldergloveshoodiejacketlotionmakeuppillowplantsposterpuzzlesandalshortstablettshirtwalletwebcamairpodsballcapbatteryblanketbookbagchargercologneearbudsgiftbagjewelrylanyardlipbalmmascaraplannerspeakersweaterthermosbackpack...

Mall 2026-01-24

115 Items: mugrugteatoybeltbooklampringtotebootscandycoinsdressjeansmousephonescarfshirtshoessocksteddywatchankletbeaniebindercandlecoffeefoldergloveshoodiejacketlotionmakeuppillowplantsposterpuzzlesandalshortstablettshirtwalletwebcamairpodsballcapbatteryblanketbookbagchargercologneearbudsgiftbagjewelrylanyardlipbalmmascaraplannerspeakersweaterthermosbackpack...

trs22 3b t4 wk20 2022-06-22

14 Items: adj. Not long.n. A scary holiday.prep. Go ___ the tunnel.n. Get lots of one thing.prep. Plants grow ___ the sun.adj. can help us to do things.n. What you wear on your feet.n. What you wear on your legs.n. What you wear on your hands.n. Special clothes that are fun.n. Good at learning, not foolish.n. Clothing that you wear on your body....

ww5 u7 2024-04-16

14 Items: very coldto lay downstrong or solidto crowd togetherto be like or similar tofar away in time or spacehaving little strength, weakto make up for; be equivalent torough or unpleasant to the sensesto attract or firmly hold the attention ofbeing alone or lacking the company of othersto walk with short steps, swaying from side to side...

walker 2024-05-16

14 Items: it has some ringsa big fluffy cloudthe red spot is on itwe live on this planetwe live in this galexy8th planet from the sunclosest planet to the sunclosest star to the earthwhen a plants gives waterits name is often laughed atwhen water collects in cloudsit is the scientific name for rainwhen water goes up and turns into clouds...

POP QUIZ 7 2025-11-12

14 Items: TBADIYGOATMoMAYOLOFOMOTotally, completely, entirelypersonal identification numberof only average quality, not very good, MIDSELF CONTAINED UNDERWATER BREATHING APPARATUSa sudden, violent gust of wind, often with rain or snowthe scientific study of the Earth's atmosphere and how it causes weather changes...

Biology 2026-06-02

29 Items: Variant of a geneHas no electrical chargeLiving things or componentsAll plants, animals, and fungiProduced in a chemical reactionDeveloped the theory of evolutionPhase during cell replication whereCarries a positive electrical chargeAn organism that makes it's own foodStructure made of tightly coiled DNAStarting materials in a chemical reaction...

Native Plants for Monarch Butterflies and Coastal California Gnatcatchers 2026-04-14

8 Items: ShrubflowersflowersMilkweedMilkweedMilkweedBuckwheatDesertMilkweed

Earth's Landscapes 2025-11-18

11 Items: moving to and froevidence of past lifecarved by the Colorado riverlayer in earth with lots of fossilsvisible features of earth's surfacemethod for determining age of objectstudy of fossils of animals and plants30 ft below surface used to be under waterlayers of mud + sand/over time become rocklayer of rock often formed on top of another...

Precipitation Word Search 2026-03-17

14 Items: Water soaking into the soilwater vapor released by plantsLiquid water turning into vaporWater moving in rivers/channelsIce changing directly into vaporWater falling from the atmosphereWater vapor changing directly into iceWater vapor cooling into liquid dropletsWater moving deeper thought soil or rockExcess water un rivers after heavy input....

Nov. Week 3-Mega Word Search 2023-11-20

118 Items: zenjoyresteaseiristacthopedawnroselotushavencannablisscheermirthfocuslilacpansygracepeonyphloxpoppylighttuliporchidmimosaplantsazaleaacaciarefugebaobabescapebanyanreliefreposecrocusdahliacenterlupineproteavioletyarrowzinniasequoiasilenceretreatfreedomreleaserespitecomfortdaylilynirvanadogwooddelightraptureecstasyheatherclarityjasminelobeliafinesse...

Unit 1 vocabulary Animals 2026-03-26

14 Items: TO HURTTO NEEDNOT KINDWHERE SOMETHING COMES FROMTO FEEL PAIN OR UNHAPPINESSVIOLENT OR UNFAIR TREATMENT OF SOMEONETO BECOME LIQUID AS A RESULT OF HEATINGSOMEONE'S OR SOMEHTING'S HEALTH AND HAPPINESSA POSSIBILITY OF TROUBLE, DANGER, OR DISASTERTHE SITUATIONS IN WHICH SOMEONE LIVES OR WORKSTHE NATURAL ENVIRONMENT OF AN ANIMAL OR OBJECT...

Biodiversity Conservation 2025-06-09

11 Items: Red list of ___ species.Where does dodo come from?Poland's oldest national parkBeavers are the __ of ecosystemsCoral reefs protect ___ from storms.Expand the shortcut - EXP, no spaces!Earth's most important pollinators are ____ Protection - allows limited harvesting or population control of species...

7.10 Spelling Words 2025-04-15

10 Items: Sudden and unexpected.Most important or first in order.Poisonous or harmful to living things.An animal that eats both plants and meat.A person or animal that eats or uses something.To satisfy thirst or stop something from burning.A community of living things and their environment.Treating someone unfairly based on their differences....

Australia Word Search 2025-12-15

10 Items: - being kind and caring to others.- to enjoy a special day together.- people you love and spend time with.- land, animals, and plants around us.- a colorful cloth that shows the country.- feeling happy about your country and culture.- a country where people celebrate Australia Day.- bright lights in the sky used for celebrations....

Find the Climate Heroes 2026-01-11

10 Items: Power that makes things workCutting down the amount we useEnergy that comes from the sunTurning old things into new thingsOur home planet that we must protectA clean way to travel without pollutionTo keep something safe or use less of itA natural resource we must protect and not wasteUsing something again instead of throwing it away...

Ag lesson 13.1 2024-02-08

15 Items: parts that provide supportlargest part of most plantspart that does reproductiondirection xylem brings stuffdirection phloem brings stuffpart that does photosynthesistype of root that is strait downpart of plant that provides supporttype of tissue that xylem and phloemtype of flower with all of the partsflower with only 3 of the main parts...

7.5 Word Search 2025-04-03

10 Items: Real or genuine; not fake.Extremely tiring and difficult.The process of becoming larger or wider.Lasting forever or for a very long time.To admit or accept that something is true.A symbol or sign that represents something.Shining brightly; full of happiness or energy.The process by which plants use sunlight to make food....

Hobbies 2025-10-10

10 Items: You need a camera for this.You need a bike for this hobby.You do it in a pool or the sea.You move to the rhythm of music.You prepare food in the kitchen.guitar A musical hobby using strings.You do this when you visit new countries.You grow flowers and plants in this hobby.You use brushes and colors for this activity....