new years Word Searches

Unit 3 2025-10-22

16 Items: the right to votethe people eligible to voteredistribution of congressional districtsthe people whom an elected official representsThe official election committee for president.count of the nation's population every 10 yearsAn election where candidates are not associated with a political party....

SAUL’S CONVERSION 2023-04-04

1 Item: MEANS THAT ANYONE WHO BELONGS TO CHRIST HAS BECOME A NEW PERSON THE OLD LIFE IS GONE A NEW LIFE HAS BEGUN CORINTHIANS

Constructive & Destructive Forces 2024-01-23

14 Items: Wide, flat areaLiquid, molten rockMound or ridge of sandDeep crack in the Earth's crustSudden movement of Earth's crust.A deep valley with high, steep sidesA physical feature on Earth's surfaceLand that rises high above the groundMass of land that forms at the mouth of a riverOpening in Earth's crust where magma can rise up...

From the Garden to the Cross 2025-04-01

9 Items: JUDAS (The man who betrayed Jesus with a kiss.)LOVE (The reason Jesus willingly bore suffering.)HOPE (A quality that sustains believers in dark times.)WATCH (What the disciples were urged to do while Jesus prayed)SACRIFICE (The ultimate act of sacrifice given by Jesus on the cross.)...

unit 7 2024-05-01

14 Items: increase demand for waterused to extract substancesone strategy to deforestationused to remove natural gas and petroleumground sinking down into open spaces belowlow population density areas outside the citycities fall apart as people migrate to the suburbsthreats include soil erosion, soil compaction, etc....

Moses Word Search 2024-10-13

13 Items: Who was Moses' sister?What was Moses' job when he worked for Jethro?Where did God Give Moses the Ten Commandments?What burning object did God use to speak to Moses?Who did God use to lead the Israelites out of Egypt?Moses used his staff to get water out of what object?How many years did Moses lead the Israelites around the desert?...

Black History Month - Advocates and Activists 2026-02-13

10 Items: Viola Desmond was born in which Canadian city?Viola Desmond attended the _____ Beauty Culture School in MontrealThe last name of Canada’s first black man elected to the House of CommonsBromley Armstrong was the founder of the first Caribbean _______ Club in TorontoLincoln Alexander held the position of Lieutenant ________ for more than six years...

Vocab 11 2024-02-16

12 Items: After running 3 miles water is ____.It would be ____ to question her actions.I would love to stay but i don't want____.The new brand _____ all of its competitors.in Order to ______ form a more perfect Union.To ____ i got this answer right i looked it up.Sally's boyfriend didn't dare cross over Sally's ____....

Natural Selection Word Search 2025-07-18

10 Items: The ability of all owls to see at night is an ____.Only organisms that ____ pass on their genes to another generation.An animals ____ determines which adaptations are helpful and which are harmful.An example of ____ is that both zebras and antelopes eat the same grasses and plants....

Mother’s Day Word Search 2023-05-13

26 Items: what’s your favorite color?Who did you go to prom with?what’s your favorite desert?what cold sport do you love?who’s your ride or die friend?what’s one luxury car you want?what’s your least favorite thing?what’s your favorite music genre?what’s your favorite thing to do?what’s your favorite song by SZA?what’s your favorite type of food?...

Kehan & Milleni 2024-09-04

25 Items: The bride's favourite fruitThe bride's dog's full nameThe groom's favourite sportThe month the groom proposedA fruit that the groom hatesThe groom's favourite cocktailThe hospital the groom was born atThe suburb the couple just moved toThe host of the bride's favourite showA chore that only the groom will ever do...

Medieval Europe & The Middle Ages 2024-04-03

21 Items: plaguepitsPeasant: A farmer or poor labourer.Century: A period of one hundred years.Sanitation: Availability of clean water.Medieval: Another name for the Middle AgesSymptom: Evidence a person has an illness.Nobles: Wealthy class in the feudal system.Agrarian: Of farming or cultivation of land.Servitude: To be a slave or subject to someone....

Pathways Word Search 2025-09-12

20 Items: Skills needed to obtain and maintain employment.Organizing your schedule to complete tasks on time.Working effectively with others toward a common goal.A trained professional who provides therapy for clients.A worker who provides care and supervision for children.A professional who advises people about money decisions....

Week 4 2024-09-09

9 Items: plan of the bookthe message the story is tellingthe place were the story takes placethe conclusion and ending of the conflicta sheltered state or stage of being or growthhe elongated wormlike larva of a butterfly or moththe situation between the Antagonist and Protagonist...

Hair 2025-10-21

9 Items: hair only found on new born babiesthe pigment found in hair and skin.the first stage of the hair growth cyclethe final stage of the hair growth cyclethe middle phase of the hair growth cyclescale like cells found on the outer layer of the hairthe base of the hair follicle and produces germ cells for the hair....

Congress Word Search 2025-10-06

19 Items: meaning two chambersOne of your US Senatorsthe lawmaking branch of governmentthe vote taken to end a filibusterthe number of members in the Senatethe process of redrawing district linesthe type of representation in the Housethe type of representation in the SenateYour US House Representative for District 5...

Loversky Word Search 2025-05-01

9 Items: Favorite Movie: "I am Iron-Man"Favorite Song: "Sing Along! ___ ___, Take Me home"Favorite Color: like from the cookie monster to the skyFavorite Subject: reading and writing to understand our worldFavorite Book: A book where a wardrobe leads you to a new worldFavorite Drink: A refreshing and essential drink most people love...

Vocabulary 8 2025-01-23

12 Items: Mrs. Jaggers is very _______.The driven young man _______ to greatness.The girl had the _________ after her cat died.The old lady began to _______ due to dementia.Snail mail ads are sometimes addressed to ________.The class came to a _______ about the theme of the prom.The man was a _______; he ate the entire pie on his own!...

IT'S CORN 2025-10-18

12 Items: The small seed part of a corn cob.The science and practice of farming.The layer of earth where plants grow.The tall, sturdy stem of the corn plant.A person who grows crops or raises animals.The center part of the corn where kernels grow.The process that helps corn plants make new seeds.The process by which plants make food from sunlight....

welcome to post student life 2025-09-04

16 Items: Liquid motivation for 8 a.m. classesOne person works, everyone gets credit.When sleep and sanity file for divorce.When 12 months just isn’t enough stress.That one-page drama of your entire life.The only social media you update monthly.The mysterious force deciding your future.Where “Can you hear me?” is the new hello....

Places Around Town Word Search 2026-02-12

16 Items: The place where journalists workThe place where you can exerciseThe place that has mass every sundayThe place where football players playThe place where you see dinosaur bonesThe place where you can buy fresh breadThe place that has shops and restaurantsThe place where you fill your car's tankThe place where you can read lots of books...

Blatant Word Search 2024-10-20

10 Items: ( the way someone see something)(creating news using photographs)(done openly and don't care about it)( a claim to make a different point than a earlier claim)(a story written or told on someones account about an event)( assert that something is what is true without using evidence)( using someones name or something they mode with out authorized...

Benefits Word Search 2025-05-01

10 Items: Who is our Vision providerWho is our 401K/403B provider?Where can I find a list of my benefits? (abbreviation)How many days does a New Hire have to enroll in Benefits?Who is our Dental provider? ____ Cross Blue Shield of TexasWho is our USRC/SHC Employee Assistance Program (EAP) with.Who would receive my life insurance benefit once I pass away?...

0816 Here we go ! 2022-08-16

20 Items: The gas helps the dough ____.These CDs are round and _______.This bread ____ looks very soft.Be careful around the hot ______.These chips are really _________.You can _____ butter on your bread.Water is ________ in the red kettle.Artists ________ beautiful paintings.He sat down in the ______ of the room.You can _____ one and two to make three....

Feelings- Adjetivos-Animals 2023-03-02

20 Items: Its night so it isSpanish word for dog.Its winter so the outside isThe opposite of entertainingThe fact wasn't true so it wasA feeling when someone is cryingThis is a good neighborhood so it isHe is mad, another feeling word for madEveryone is so---of her accomplishmentsA feeling,she is scared around new people...

Vocabulary for Test 2023-05-16

25 Items: an egg or sperma form of a genea fertilized eggrequires one parentpart of a chromosomethe inherited allelessperm and egg combinethe study of geneticsa difference in a traita family tree for a traitan inherited characteristica change to genetic materiala type of asexual reproductionthe process that makes body cellsstructure made of DNA and protein...

JACOB SEEKS A WIFE 2025-10-11

1 Item: JACOB, YOUNGER, LABAN, LEAH, WORK, LOVE, DECEIVED, RACHEL, SEVEN, OLDER, BEAUTIFUL, DAUGHTER, YEARS, HARAN, SHEPHERDS, WILL, MARRIAGE, STONE, SHEEP, TRICK

Switcheroo Word Search 2024-04-13

24 Items: Bertle _____Aussie cowboy hatOne main characterWhite trunked treesJool's mum's recipeAn inhospitable regionThe station competitionHayley's New York hobbyThe other main characterOne of the station ownersThe nickname given to HayleyChantelle got fired from hereSlugger's favourite lunch foodHis girlfriend nicknamed him this...

fans 2024-09-10

160 Items: gohimybinbeebusbuncupcandendindigeareyeendfunfanfogfadgodhueheyiceinkivyjimjamjoykitmapnodnewnotnapnagnetowloiloptawedballboonbabybackcoolcoldcampDeepdirtdeskdatedoordivedockfacefrogfeedgamegirlgoalgoldgluegoathoophookhandheadheelheapideainchiranjailjustjacklogomeltmilknamenestnicenotenailnetsbloomblissbirdsbelowchaireagereagleeruptexertglovegoose...

July Wordsearch 2025-05-03

20 Items: A cooking device used outdoors.gear Equipment for outdoor adventures.A popular cold drink served at picnics.Activity involving visiting new places.Eyewear to protect eyes from sun glare.Footwear commonly worn during hot days.Moist air, often high during the summer.A central theme of national celebrations.Handheld fireworks used during celebrations....

Back to School 2025-08-03

20 Items: The adult who teaches the class.Schoolwork you take home to finish.The room where you learn at school.A tool used for writing or drawing.A book with blank pages for writing.A table where students sit and work.A child or person who goes to school.The solution or response to a question.Looking at words and understanding them....

Feelings- Adjetivos-Animals 2023-03-02

20 Items: Its night so it isSpanish word for dog.Its winter so the outside isThe opposite of entertainingThe fact wasn't true so it wasA feeling when someone is cryingThis is a good neighborhood so it isHe is mad, another feeling word for madEveryone is so---of her accomplishmentsA feeling,she is scared around new people...

just about every word 2023-10-01

158 Items: ashiifinnoonupandantbigbutbedbancatcanendelffryfanfatforgetgodhowlowmommannapnewpanpadvetwetyesyumbendbandboatboltcastcasecopydowndumbdoneeasyfirefoodgamegoodhelphandhoophosehowliowajumpjunejulylionlesslumpmoonmissmalemallnoonoverohioridereadstepslamsongsendtimetestundowordwhatwildxrayyarnyoyozoneaprilblamecrapecloneflamefloorfryergummygoosehello...

No Place Like Home 2025-04-29

22 Items: purple Texas wildflowerThe beach we frequentedMy ______ is back in TexasRicky's favorite University- Music festival abbreviationCity where all the yuppies live- Town where Ricky's dad residesFunny name for the collie at A&MExtravagant decor for prom girlsTexas team with pointy head-thingsThe best grocery store in the world...

Echo Word Search 2025-08-09

25 Items: "Sicko Mode" rapper?Kanye West’s new name?"Peaches" singer (2021)?SpongeBob’s best friend?Who is Batman's alter ego?Tony Stark’s superhero name?Who sings “Blinding Lights”?Meme frog known for being sad?Most-used app for viral dances?Who runs fast in the DC universe?GOAT soccer player, Messi or ___?Green Jedi Master from Star Wars?...

Word Search, Geography and Places of Rome 2025-12-31

18 Items: The river where Rome began.The peninsula shaped like a boot.City later renamed by Constantine.Modern name for much of ancient Gaul.Continent where Carthage was located.City where Jesus was said to be born.The sea surrounded by many Roman lands.“New Rome,” capital of the Eastern Empire.Mountains Hannibal crossed to invade Italy....

Spelling/Vocabulary word search puzzle 2022-11-10

15 Items: not alivebring to lifestrong disliking.a small, yellow birdrelating to metaphysics.an animal that feeds on flesh.the form and size of a persons bodythe rebirth of a soul in a new body.a traveling amusement show or circus.a person qualified to practice medicine.relating to the body as opposed to the mind....

Project Management 2024-10-03

15 Items: Moving from the old to the new."a push in the right direction".8-Step Project Management Theory.Going against the flow of change.Run according to law or regulations.Carrying out change within a business.Kotter and Nudge are 2 examples of this.The process or activity of running a business.Competition to your business is referred to as......

The Electoral College 2024-10-21

15 Items: ________ DC has 3 electoral votes.This state has 40 electoral votes.Indiana has how many electoral votes?Symbol of the Republican party (animal)Symbol of the Democratic party (animal)This state has the most electoral votes.This southern state has 8 electoral votes.This southern state has 30 electoral votes....

Board Games 2023-12-21

10 Items: the game that can be played in braille: unothe game invented in New York in 1938: scrabblethe game invented by the Kohner Brothers: troublethe game invented in 1957 by a French filmmaker: riskthe game that can be played on a chess board: checkersthe game with 400 possible moves after each move: chess...

Good Laboratory Practice 2024-05-20

20 Items: The G in GLPThe L in GLPThe P in GLPThe L in ALCOAThe C in ALCOAThe O in ALCOAYear GLPs proposedYear GLPs finalizedThe first A in ALCOAThe second A in ALCOAYear GLPs written into lawSingle point of control for a studyDescribes how a task is done on a studyCurrent Summary of training and experienceFormed because safety of animals used was at risk...

MARVEL CINEMATIC UNIVERSE FILMS WORD SEARCH 2024-05-22

37 Items: THORBLADEANT-MANIRON MANETERNALSBLACK WIDOWTHE MARVELSTHE AVENGERSTHUNDERBOLTSBLACK PANTHERDOCTOR STRANGETHOR: RAGNAROKCAPTAIN MARVELAVENGERS: ENDGAMETHE FANTASTIC FOURTHE INCREDIBLE HULKTHOR: THE DARK WORLDANT-MAN AND THE WASPAVERGERS: SECRET WARSSPIDER-MAN: HOMECOMINGAVENGERS: INFINITY WARTHOR: LOVE AND THUNDERDEADPOOL AND WOLVERINE...

DNA Replication & Protein Synthesis 2024-10-06

22 Items: start codonReplicate AAGBackbone of DNA & RNAWhat does GCU code for?What does UAA code for?The process of making mRNACytosine binds with _______The process of making proteinsProteins are a made of _______Transcribe the DNA code: GATGCACTAThe process in which DNA is replicatedUnlike DNA, mRNA can _____ the nucleus...

Funny Ham Radio 2024-11-19

25 Items: "More power!""Beep boop beep.""How strong am I?""Is this thing on?"Wart (power supply)"Ham radio in space!""Hopefully it's low!""I need more spectrum!"Load (not the operator!)"Chasing those rare ones.""Who can talk the fastest?""Gotta keep the noise down.""My other antenna is a dish.""Just chatting with friends.""Sounds like a blender in here."...

A+ Unit 9 2025-05-29

17 Items: – Not fun or interesting.– About health or doctors.– Feeling scared or worried.– To show something clearly.– Has something as a part of it.– Programs you watch on television.– Wanting to know or learn something.– Someone getting help from a doctor.– When someone or something stops living.– Being alive or the time a person is alive....

A+ Unit 9 2025-05-29

17 Items: – Not fun or interesting.– About health or doctors.– Feeling scared or worried.– To show something clearly.– Has something as a part of it.– Programs you watch on television.– Wanting to know or learn something.– Someone getting help from a doctor.– When someone or something stops living.– Being alive or the time a person is alive....

IIM And LD Module 2023-09-29

26 Items: Where we put notes in the module.The tab you go to to open a new claimWe find documents in the module here.In claim documents S stands for _____.In claim documents P stands for _____.In claim documents U stands for _____.We typically search for claims using the ____.We send the procedure packet on the _________ tab....

Películas clásicas icónicas de los años 70, 80, y 90 2024-09-13

15 Items: friendly alien wants to phone homeGiant shark terrorizes Amity IslandHenry Hill’s rise and fall in the mafiaDinosaurs run wild in a modern theme parkMafia family drama led by Don Vito CorleoneUnderdog boxer rises to fame in PhiladelphiaA priest battles evil to save a possessed girlA time-traveling cyborg is sent to kill Sarah Connor...

New start 2022-11-11

1 Item: exercitiufizic apa soare temperanta aer recreere incredereindumnezeu

AMAZING 2018-02-20

156 Items: heyhaydaybaymaytaypaywaynayfaycaykayjaywonwintinbinminlinpinfinrinsinzinvinyinvancanmandanlanpantanranyansanwanjanboytoyhoyjoypoyloyroywoymoynoyvoycoyzoysoykidbidfidpidridsidwidcidzidfornownewnottontennetwetfewdewpewtwofanboypoddottotpotmotnotlotyothotjotgotfotrotwotzotcotvotsotwipdiplipsiptipripviphipcapgaphaplapmapnapvaprapyapwapsapbundungunguy...

F6 Module 3,3a 2023-11-20

44 Items: (n) uba(n) õlg(n) mask(n) rütm(n) pähkel(n) kostüümellu ärkamavaimustuses(adi) kuldne(adj) tüdinud(adj)pettunud(adj) ovaalnetänavarongkäik(n) toit, roog(v) valmistamahiilgav, särav;(n) ahv, pärdik(adj) üllatunudtraditsioonilineparaad, rongkäikmuistne; antiikne(adj)kurb; õnnetu(n) orkester, bändpidulik tähistaminegigantne, hiiglaslik...

Earth Structure Word Search 2024-04-24

20 Items: study of rock layersmolten rock above Earthmolten rock below Earthmovement of rock overtimesmaller particles of rockbreakdown of rock overtimehottest part of Earth's layersettlement of rock in a new locationpart of Earth's layer that we step onrock formed by the cooling of lava/magmarock formed from compaction of sediments...

the scourge made in psd 2025-05-20

35 Items: chainsdiseaseconfessstarvingto scarecurse worda hospitalto put downdellas fatherlong windy pathfeel bitternessbusy and crowdedno pity or mercyto commit or helpani's best friendhard piece of skinto heavily destroyhanging in the airable to catch firea guard of a prisonto try and break freevisible or vulnerablebetter than or greater...

Ghost word search 2025-12-19

20 Items: Ghost's real name?The persons mom diedGhost enemy at school?Main characters nicknameWhat is the team called?The boss of the track teamThe only girl on the team?What Ghost does for Coach?Who's store does Ghost go to?What Ghost wants to do one dayWhat is Ghost and his friends?He is now what on the track team?What did Ghos's dad try to use on them?...

Fun trivia about the birthday girl 2026-02-04

21 Items: Alma materFavorite movieHer Dad’s nicknameCity where she grew upHer animal hobby as a kidHer Mom’s “grandparent” nameHer Dad’s “grandparent” nameHer favorite alcoholic drinkWhat city did she work in FL?Her favorite non-alcoholic drinkHer favorite cable movie channelWhere did she first live with Ted?Her 3 siblings' names concatenated...

New beginnings 2025-12-11

1 Item: positivehabits, routines, personalgrowth, health, meditation, yoga, hobby, gratitude, selfcompassion, organized, financialclarity, socialactivities, volunteer, goals, january, accomplishments, reading, environment, relationships

Jennie's 2023 Wrapped in 23 Words 2023-12-23

23 Items: Klaus - My favorite holiday movie. Find it on Netflix!Raccoons - A family of five of them lives in our backyard.Barbenheimer - My favorite 2023 holiday. Cinema's back, baby.Apple Tree - We planted one this year, and it grew three apples.Trader Joe's - My favorite grocery store of 2023. Try the kimbap!...

All about the Lab Word Search 2025-04-08

15 Items: AlarmingThe name of our labThe platform we analyze raw data onThe last master mix that is made is_Name of the folder .txt files go into_ process has Molecular Inversion ProbesAn equipment that fluctuates temperaturesCompare these on the tubes and worksheetsThe machine needed to spin down a plate is a _SOP version of the document we use for Analysis...

Choice Word Search 2024-11-11

19 Items: an apartment buildinghow heavy something isstories, poems and playsdepartment that sells productspersuade someone to by somethingunit of measuring liquid in Europeopportunity to decide between optionsowned/ used by someone else before meworried that something bad will happenunit of measuring liquid in the UK and US...

ss 2026-02-24

20 Items: taking away the right to votean entrepreneur that created the Atlanta Mutual Insurance Companyraised the morale of the Georgia Patriots gave them needed suppliescreated to keep the races separate in the South after Reconstructionleader of the Populist Party in GA, known for the Rural Free Delivery Bill...

ORIGINAL 2023-02-21

1 Item: genuine, true, innovative, unique, creative, unconventional, fresh, new, inventive

V5 1-16 2025-10-30

17 Items: – not afraid; brave.– easy to reach, enter, or use.– taken away by force; kidnapped.– not able to bend or change easily.– told or taught how to do something.– taking away an amount; subtraction.– a person who gathers and shares news.– rude or unkind behavior toward someone.– not being accepted or being turned down....

ROCKS! 2026-01-07

7 Items: this type of melted rock is found inside the Earth.a type of rock formed by compacted and cemented sedimenta type of rock formed directly from cooled magma or lava.this type of melted rock is found on the outside of the Earth.this type of crust, or tectonic plate,is found beneath the ocean!...

The Word Search 2025-04-19

6 Items: the introduction of harmful substances or products into the environment.the presence of harmful substances in the environment, making it unsafe or unclean.the protection and careful management of natural resources to prevent their depletion.the process of converting waste materials into new materials and objects to reduce waste....

4 Years With You 2025-07-19

1 Item: 123

Online Activities 2025-10-30

8 Items: email To open your email and read or send messages.music To listen to music online without downloading it.games To use your phone, computer, or console for fun games.online To buy things on websites or apps instead of in a store.videos To see short or long clips online, like on YouTube or TikTok....

Entrepreneurship 2025-08-19

14 Items: A bad workerA company carBusiness loanAuntie AnniesNike paying their taxesWalmart and Target make a dealMcdonalds selling burgers to a customerA bakery has a budget of $5,000 to run a businessStarbucks advertises a buy one, get one free couponA clothing store tracks monthly sales growth to track success...

Recap Unit 9 2024-11-11

19 Items: an apartment buildinghow heavy something isstories, poems and playsdepartment that sells productspersuade someone to by somethingunit of measuring liquid in Europeopportunity to decide between optionsowned/ used by someone else before meworried that something bad will happenunit of measuring liquid in the UK and US...

John Cabot 2023-02-15

16 Items: John's last nameThe name of his first shipCabot's first name at birthThe name of John Cabot's sonThe country John Cabot was born inCabot was an expert sailor and _____The country he had actually landed onHe was given the name the great _____Sebastian sailed down the ________ to CanadaThe country John Cabot moved to when he was 40...

Science 10B T3.1 SPACE 2025-09-04

16 Items: A push or pull (5)A negatively charged particle (8)A positively charged particle (6)Two or more atoms joined together (8)A rocky object that orbits the Sun (8)The smallest particle of an element (4)A large body that moves around a star (6)How fast a chemical reaction happens (12)The ability to do work or cause change (6)...

Unit 2.3 - Recruitment, selection and training of employees 2024-11-14

19 Items: employess will usually work 35 hours or more a week.to the point where applications arrive to the business.Occurs by watching a more experienced worker doing the jobis the process from identifying that the business needs to employemployments is often considerd to be between 1 and 30-35 hours a week...

Dialogue: Word Search 2023-10-04

6 Items: ‘Chef’ and ‘Cook’ both words mean someone who prepares food.clause what do you mean when you wrote: “You got home and.”When a teacher and student are talking about his or her homework.A country with no laws and people can do what they want to do whenever they want to....

Dialogue Word Search 2023-10-05

6 Items: What do you mean when you wrote: “You got home and.”‘Chef’ and ‘Cook’ both words mean someone who prepares food.When a teacher and student are talking about his or her homework.A new classmate is very positive and seems to want to help people.A country with no laws and people can do what they want to do whenever they want to....

POSTIES 0127 BIG READ 2024-12-27

6 Items: Oyster shells are mostly made of _____.to make new objects out of waste materialused to describe someone who is slow to act because they feel uncertainBefore the oysters can be sent to Green Island Cement, the hotel staff must _____ and store them.a grey powder used in building which is mixed with water and sand or stones to make a hard substance...

Vocab 7 2023-11-16

12 Items: I got a ___ to search this house.I felt _____ about running the mile.The amount of money they owe is too ________.After she was sick she was ____ from everythingThe little was able to be _____ by the evil witch.After i dropped my phone it was ___ and not workingThe kind begged for his life or he _____ for his life....

Vocab 7 2023-11-16

12 Items: I got a ___ to search this house.I felt _____ about running the mile.The amount of money they owe is too ________.After she was sick she was ____ from everythingThe little was able to be _____ by the evil witch.After i dropped my phone it was ___ and not workingThe kind begged for his life or he _____ for his life....

Unit 7 vocab practice 2024-05-03

14 Items: The ___ fireworks lit up the sky.The sudden change of plans ___ me.Cleaning up my neighborhood is ___.The old house had a ___ appearance.I took medicine to help ___ my headache.I put a lid on my water so nobody could ___ it.During war, the invading armies would ___ towns.When we moved into our new house, it was very___....

REFUGEE MENTAL HEALTH 2024-10-08

6 Items: The global organization focused on protecting refugeesSupport that focuses on emotional, psychological, and social well-beingA term for people forced to flee their country due to conflict or persecutionA psychological coping mechanism where someone avoids thinking about traumatic events...

Landmark HTN Trials 2026-02-22

13 Items: In high-CV-risk patients without diabetes, an SBP target < 120 vs < 140 reduced major CV events and all-cause mortalityBenazepril–amlodipine was superior to benazepril–hydrochlorothiazide in reducing CV events in patients with high-risk HTN...

The American Revolution 2023-10-11

9 Items: freedom from being controlled by someone elsea disagreement or fight between two or more groupsa sudden and complete change in government or social orderagreements or partnerships between different groups or countriescomplaints or problems that are considered to be unjust or unfair...

Forgotten, Word Search 2024-02-02

1 Item: committed, sobbing, quizzed, shipping, recreation, foundation, collection, tradition, ambition, New Jersey, New Mexico, admire, chaotic, museum, practical, prior, proceed, revised, visible, compliment, condemn, defective, deity, emblem, excel, improvise,

Matter unit 1 5th grade 2024-08-27

9 Items: how hot or cold something isbe able to be dissolved in a liquidanything that has mass takes up spacethe amount of space something takes upmatter in which a substance does not have a Divine shape or volumestate of matter in which a substance has a Divine shape and divine volume...

Terumah 6.0 2026-02-21

29 Items: Oil =?GOLD = ?Silver = ?Purple = ?Fifty equals _______.and ________ _________.This held the testimony.Located in the courtyard.What was placed inside the ark?Curtain dividing the Holy Space.How many coins did the widow give?This was shaped with apple blossoms.The scribes devoured _______ houses.What wood was used to construct the Ark?...

Pinchas 5.0 2025-07-13

16 Items: What tribe was Zimri from?Tzelofchad had how many daughters?What was poured with each offering?Which tribe had no land inheritance?Who did Moses appoint to succeed him?The central figure of this Torah portion.What stopped the plague among the Israelites?Which holiday includes fasting and atonement?What holiday includes the blowing of the Shofar?...

A+ Unit 7 2025-05-12

18 Items: – I feed my cat every morning.– Let’s sort the toys by color.– The books are on the top shelf.– She wants a career as a doctor.– The school play was a big event.– Water is a basic need for everyone.– Let’s set up the chairs for the party.– We used teamwork to finish the puzzle.– He helps care for the classroom plants....

Wedding Word Search 2025-03-05

37 Items: loveYou're ahe's fromShe's halfwhere they metHas three heartsdaisy in spanishit's a great pintinvented in newryCan form in space.It follows the sunModern Love Letterdeep dish came fromshe said yes in theCannot walk backwardA wedding with no guestsan instrument that ascendsWhat you do while paintingWas once used as currency....

Sip & Search 2025-09-18

29 Items: Who is older?Bride’s Last Name?Groom’s middle name?Who is the flower girl?Who is the maid of honor?Who said I love you first?What does the Bride collect?Who was the wedding planner?Who made the bridal flowers?Bride’s favorite football team?Who played cupid for the couple?What school did the couple go to?What is the Bride’s favorite color...

Vocab 7 2023-11-16

12 Items: I got a ___ to search this house.I felt _____ about running the mile.The amount of money they owe is too ________.After she was sick she was ____ from everythingThe little was able to be _____ by the evil witch.After i dropped my phone it was ___ and not workingThe kind begged for his life or he _____ for his life....

7th Grade Extra Credit Word Search 2026-03-09

18 Items: EndlesslyNot active or in useA widespread diseaseTo move back or away fromTo include as a necessary stepFriendly, lively, and enjoyableHaving a good outcome; favorableDoubtful; of unlikely authenticityTo explode; to break out with forcePitifully sad and abandoned or lonelyExtremely important; vital in resolving something...

madison 2023-01-25

2 Items: new cast motorcycle overseas quick-witted stomacheache bulletin boarduproar home run headache top-secret teammate wheelchair light bulb well-know throughout life preserver barefoot part-time warehouse overboard post office outspoken up-to-date

Your name's fine. Just your name. (Audrey) 2025-04-23

10 Items: The pilgrims were a specific group of?Who published the new testament in Greek?Who was from what is now the Czech Republic?What war ended with the signing of Westphalia?Who called for reform just to divorce his wife?Who was from England and translated the Bible into English?...

Love and Relationships 2025-02-13

15 Items: ‘Porphyria ____ me’ – Porphyria’s Lover‘The ____ had given their all’ – Winter Swans‘They ____ to me from the other bank’ – Eden Rock‘Nothing in the world is ____’ – Love’s Philosophy‘More like a ____ little fay’ – The Farmer’s Bride‘Pale grew thy cheek and ____’ – When We Two Parted‘And breathe within thy ____ a new air’ – Sonnet 29...

WHI.1 Vocabulary Practice 2025-05-24

15 Items: more than necessary ________________________way of life of a society _____________________skilled craftspeople __________________________also known as the New Stone Age ______________________________also known as the Old Stone Age ______________________________way of life characterized by little movement _______________________________...

LFW- HR POLICY WORD SEARCH 2023-05-18

10 Items: one of the value of LFWExpenses expenses that cannot be reimbursedMandatory three month every new hire has to serveWhat needs to be checked for accurate paid days dataMonth Tenure of notice period an employee has to serveOff leave that has to be utilised within 1 month’s spanMinimum no. of hours an employee has to give to call it a half day...

Voca 4000 Lesson 11 & 12 Review 2025-10-20

15 Items: to go away (le***)to take place; occur (ha****)a problem or trouble (mat***)having little strength or power (we**)a community of people as a whole (pub***)to come to or reach a certain place (arr***)as much or as many as needed or required (en****)all the members of a community or group (soc****)the ability to manage someone or something (co****)...

Miketz 2025-12-21

26 Items: “I give them ________ life!”Joseph is given _____ as a wife.His second son is named ______ .Joseph’s first son is called ______ .Pharaoh sees G~D’s _________ in Joseph.The whole world came to _____ for food.Joseph tells Pharaoh to appoint _______.Pharaoh puts his _____ _____ on Joseph.The seven years of famine were ______ ....

Unit 13 Word Search 2026-01-31

29 Items: a five-pointed stara shape with four sidesa shape with five sidesa shape with three sidesa period of three monthslikely to argue or fightoccurring every five yearshappening four times a yeara vehicle with three wheelsa solid shape with five facesmade in three identical copiesa musical scale with five notesan animal that walks on four legs...

Marissa & Joseph 2025-09-22

37 Items: Best Man's Name?Groom's Birthday?Bride's Birthday?Groom's Eye Color?Bride's Eye Color?Groom's Middle Name?Bride's Middle Name?Maid Of Honor's Name?Bride's favorite food?Groom's Favorite Food?Groom's Favorite Band?Bride's Favorite Band?Bride's Favorite Color?Groom's Favorite Color?Bride's Favorite Drink?Groom's Favorite Hobby?...

Vayishlach 6.0 2025-12-07

29 Items: Who rapes Dinah?Jacob ________ with G~d.His ______ clings to Dinah.“for this is a _______ to us”Jacob gets a _________ injury.Jacob names that place ______ .Jacob became extremely ________ .G~d tells Jacob to go to ______ .Simeon and Levi ________ ever male.The family stayed until _____ died.Jacob’s name is changed to _______ ....