new years Word Searches

Vayishlach 6.0 2025-12-07

29 Items: Who rapes Dinah?Jacob ________ with G~d.His ______ clings to Dinah.“for this is a _______ to us”Jacob gets a _________ injury.Jacob names that place ______ .Jacob became extremely ________ .G~d tells Jacob to go to ______ .Simeon and Levi ________ ever male.The family stayed until _____ died.Jacob’s name is changed to _______ ....

Unit 14 Word Search 2026-02-14

30 Items: a six-pointed stara seven-sided shapeto multiply by sevena shape with six sidesone of six equal partsa shape with eight sidesa person in their eightiesa group of seven performersa person in their seventiesa group of eight performersto multiply something by sixa sea animal with eight armsa solid figure with six facesto multiply something by eight...

Miketz 2025-12-21

26 Items: “I give them ________ life!”Joseph is given _____ as a wife.His second son is named ______ .Joseph’s first son is called ______ .Pharaoh sees G~D’s _________ in Joseph.The whole world came to _____ for food.Joseph tells Pharaoh to appoint _______.Pharaoh puts his _____ _____ on Joseph.The seven years of famine were ______ ....

Unit 13 Word Search 2026-01-31

29 Items: a five-pointed stara shape with four sidesa shape with five sidesa shape with three sidesa period of three monthslikely to argue or fightoccurring every five yearshappening four times a yeara vehicle with three wheelsa solid shape with five facesmade in three identical copiesa musical scale with five notesan animal that walks on four legs...

Challenger - Comet Vocabulary ALL - Word Search 2023-05-16

30 Items: The compactness of an object.To move in a circle or orbit around.The seven colors that make up white light.The title of elected US government officials.A group of stars that form a picture or a shape.The action of rotating around an axis or center.A comet that orbits the Sun in less than 200 years....

Final Review 2025-12-17

17 Items: Variations of a trait.A part of a nucleotide.The site of translation.A change in the DNA sequence.Having two different alleles.Made by a chain of amino acidsType of cells produced by meiosis.The process of new species forming.A group of the same species in an area.When the last member of a species dies.A structure that no longer has a function....

WHI.1 Vocabulary Practice 2025-05-25

15 Items: more than necessary ___________________skilled craftspeople __________________way of life of a society ____________________also known as the New Stone Age ____________________also known as the Old Stone Age _________________________way of life characterized by little movement _________________...

review 2024-05-15

16 Items: a push or pull on an objectmoving away from what is expectedmolten rock stored below Earth's surfacetwo tectonic plates move towards each othera substance that consists of only one kind of atomplaces where plates slide sideways past each other.all the living things and nonliving things in given area...

July word seach 2023-07-05

13 Items: Name of the L&D newsletterPresident of ICAST (Last name)ICAST was founded in this stateYou might get some great "cooking" tips watching herThe Learning Management System (LMS) we use - called ___1Selected ICAST as the multifamily program implementer in DCOnly ICAST employee in New Jersey (First name) as of 6/30/23...

Mohican People Unit 3 Word Search 2024-10-25

10 Items: Introduced to the Americas by EuropeansDisease that killed many Mohicans brought by EuropeansRiver where the Mohicans originally lived to the west ofCreated after Henry Hudson arrived in the Mohican CommunityWhere the Mohicans moved after conflicts in the early 1700sWho declared the land where the Mohicans lived by "right of discovery"...

Environmental Policy and Global Challenges 2025-04-14

10 Items: Emissions : The release of harmful gases or pollutants into the atmosphere.Sustainability : Meeting present needs without compromising future generations.Ecosystem : A community of living organisms interacting with their environment.Conservation : The protection and preservation of natural resources and ecosystems....

Cotton 2025-10-18

10 Items: The process of crossing threads to make fabric.A large farm where cotton and other crops are grown.Twisting cotton fibers together to make yarn or thread.The time when farmers collect ripe cotton from the fields.A fabric or cloth made by weaving or knitting cotton fibers.The cleaned cotton fibers that are ready to be spun into thread....

Martin word search about sky science 2023-12-19

19 Items: our galaxya furry that is biga furry which is smalla form of billons of starsa rocky surface or gas surface.Some plnaet that goes around the suna pot looking star which is very famous.a pot but is more smaller then the another one.some that give us light but not from a fire ballis something to do to study planet moons and more....

Angel Word Search 2024-05-08

1 Item: peace, God, romance, proposal, Bible, Jesus, engagement, abundance, freedom, health, dating, enlightenment, growth, dating, create, new, courage, faith, opportunities, second chance, new job, healing, faith, moving, building, entrepreneur, school, lessons

Angel Word Search 2024-05-08

1 Item: peace, God, romance, proposal, Bible, Jesus, engagement, abundance, freedom, health, dating, enlightenment, growth, dating, create, new, courage, faith, opportunities, second chance, new job, healing, faith, moving, building, entrepreneur, school, lessons

Week 12 2023-05-17

15 Items: Another word for _________________ is new.I would love a ______________ pokemon doll!He _______________ the cookies for the party.Crabs and lobsters are ______________________.Their form of ____________________ is dancing.A cat in a tree writes _______________ for me.The water was too ______________ so I got sick....

Sinewy Word Search 2026-03-02

10 Items: Prone to sudden, intense changes in mood; they are a "powder keg" characterMoving with a grace that is thin, flexible, and effortless—almost like a cat.Lean and tough; they look like they’re made of wire and muscle rather than bulk.They move with a heavy, slow, and powerful gait—like someone who can't be easily stopped....

Encuentra las palabras 2025-08-08

1 Item: steeet Food, cheese, bacon, Wings, sabor paralelo, New York, caprichosa, cariñosa

Life Cycles 2025-11-11

11 Items: The adult bird that lays eggsA young plant that has just started to growThe larva stage of a butterfly that eats leavesThe first stage in the life cycle of many animalsThe stage when a caterpillar changes inside a cocoonThe young stage of a chicken that hatches from an eggThe adult amphibian that can live on land and in water...

A Job Defined: Fashion Buyer 2026-02-23

11 Items: knowledge of a productentering of data into a systemproducts being sold at a particular storebusiness which sells a particular type of productamount of money allowed to spend at a particular timeamount of products and merchandise on-hand at any given timename on a product to help it stand out against the competition...

Angel Word Search 2024-05-08

1 Item: peace, God, romance, proposal, Bible, Jesus, engagement, abundance, freedom, health, dating, enlightenment, growth, dating, create, new, courage, faith, opportunities, second chance, new job, healing, faith, moving, building, entrepreneur, school, lessons

Vowel Team Digraph 2025-04-15

1 Item: clue, crew, fruit, glue, juice, new, threw, true, hue, blew, suit

The Vanderbeeker's of 141st Street 2025-10-01

1 Item: tree, brownstone, Oliver, Hyacinth, Laney, Jessie, Issa, Biederman, Vanderbeeker, New York

08 2025-08-16

15 Items: a footresta footrest for the riderThe part where the rider sitsSmall footrests for the rider or passengerA device for slowing or stopping a motorcycleFootrests mounted on the bike frame for supportA backrest bar for passenger comfort and supporta term used for the first ride of the new seasonFoot controls used to operate brakes or gear shifts...

Lilo 1 2025-11-17

14 Items: – Unable to be destroyed or damaged.– Likely to cause harm, injury, or damage.– Caught or arrested by authorities; captured.– An extremely cruel, violent, or shocking act.– Impossible to stop or prevent from continuing.– Not allowed by law; against the rules or regulations.– A statement or situation indicating the possibility of harm or danger....

Organometallic Chemistry Word Search 2023-11-09

11 Items: Precursor to dihalocarbeneTransition metal found in Grubbs' catalystGas byproduct in Grubbs' olefin metathesisTransition metal used in both Heck & SuzukiReactive intermediate in which C has a lone pair, but open octetTransfer of an R group from a main group metal to a transition metal...

Cristmas Revision 2022-11-28

15 Items: Buying and selling of church positionsSupporter of reform in the Catholic churchEnglish or Scottish soldiers who had fought for the crownPeople who were planted in foreign territory by the crown.The appointing of relatives to Church jobs regardless of meritLaws, Laws that suppressed the status of Catholics in Ireland....

Buddhism History 2023-07-28

12 Items: evolvemeditationsiddharthaSiddhartha Gautama was a prince who renounced his royal life to seek _____ and the end of suffering.Over the centuries, Buddhism diversified into different schools, each with its distinctive interpretations and ______....

Ancient Chinese Dynasties 2025-12-11

15 Items: She's a big Star Wars fan.He loves to hunt, fish, and eat squirrelShe can get a little scary when she plays Grudge Ball.Classmate whose name starts with an I but souds like an E.He doesn't know when his birthdate is or how old he really is.He's the newest kid in this class and we're glad he joined us....

Bangkok Word Search 2024-07-19

12 Items: Traditional Thai martial art known for its striking techniques.National animal of Thailand, revered in Thai culture and history.Thai New Year festival celebrated with water fights and festivities.Three-wheeled motorized vehicle used as a taxi in Thailand's cities.Hand-woven fabric known for its intricate patterns and vibrant colors....

Sustainability 2024-10-09

12 Items: The variety of all living species on the planetMass destruction of forests, often for agricultureKind of energy obtained from the heat inside the earthThe process of reusing waste as raw material for new productsThe ability to do work, often obtained from renewable sourcesThe presence of harmful substances in the air, water, or soil...

Abraham, Lot and Hagar--Genesis 13 and 16 2026-02-21

12 Items: Command given to Hagar regarding her mistress (16:9)Abram's wife who dealt harshly with her servant (16:8)What broke out between Abram’s and Lot’s herders (13:8)Promise made to Hagar regarding her descendants (16:10)The well-watered region Lot chose for himself (13:10,12)The direction Lot traveled to reach his new home (13:10)...

Moose Lodge 509 Nov 2023 Word-Search 2023-10-11

20 Items: Our Lodge MascotMan's best friendCurrent US PresidentCurrent Chapter Senior RegentFirst name of the LOOM ChaplainNumber of barstools we have in useEditor of Anderson Moose HighlightsLast name of our Lodge AdministratorThese Members deserve our many THANKSThe largest planet in our solar systemLast name of our 2022/23 LOOM President...

CHOO CHOO! 2025-11-06

88 Items: BHRLRKFLGMRCTUSBFDEMYFNORICSKNDENGRABERNLCWASWILLAKPAKJSPSAVCRNOSCSPTCHIPLOSPIINDWTINEWTOPAKYNOLBOSRTEWORBALBWIALIBRKDETPNTARBMSPWINSTLSEDJANWFHBNCGROFAYSSMSOPFARDVLHASHLDCLAMETNWKTRERATRNOALBBFXNYPYNYSKYCLETOLADMASTPDXSLMHARPHLPGHPVDSPBMEMELPHOSDALPROALXLYHKELALD

Month of November 2025-11-22

20 Items: Name of brideName of groomNew last nameDavid's favorite animeWho crashed the wedding?Who is your ARC Raiders duo?What property did we stay on?What is your current favorite game?What holiday were you given this on?What is broken bone 1? (Starts with C)What is broken bone 2? (Starts with M)"BLANK" by the sea (Fill in the blank)...

Industrial Revolution Word Search 2026-01-21

24 Items: Steel-making processCo-creator of communismBlack rock used for fuelModernized the steam engineFather of modern capitalismUses steam to power machinesCreator of the Spinning JennyAcute contagious viral diseaseBuilding where goods are producedTurns cotton to threat super efficientlyStimulates immunity to a certain disease...

SS Word Search 2026-02-24

21 Items: Against slaveryForbid Settlement WestRemoving One's Right To VoteCoined The Phrase,"New South"Caused by disputes over SlaveryReplublican Abraham Lincoln WonFighting Over Ohio River ValleyReliied on slavery for economicsPeopleAllowed Black People Voting RightsBelieved In Economic Independence For BlacksA Murder Case Resulting In The Death Penalty...

2423 2024-05-23

174 Items: cambeldomposbohsrsavtpaykpibuypennewluketonysafepicokidsgolfipadbulkoddstagsrateteamsellopensealcodekeysrailagedsizeslimkevinraniafrankjamesrishiluanaanikaethanpricesportsaleslabelvoidsflooralarmbreakcovershiftstoreclosefloatsweepmusicstylerangejordanjelenaoliviahamishreturnpolicyunisextennisbudgetrosterrefundfaultylightssigninoutletreviewmarker...

Hospital Pharmacy Week 2025 2025-10-06

22 Items: Tum,ta tum, tum tumsGeneric name for Prozac.The opposite of formularybrand name of acetaminophenHumulin R is a kind of____?Our Newest automation/robot.common weight loss injectiondifferent brand name for ozempicGives you a jolt- right to the heart.AKA Easybake oven, stuff of nightmares.Tech with most seniority at the Valley....

Team Logistics and Knowledge Check 2025-11-11

20 Items: the “R” of VARKleading the preceptor bucketfirst step in the ADDIE processlearning the orientation bucketleading the “just in time” bucketlevels used for learning evaluationleading “back to basics” and ACLS/BLScreator of experiential learning theoryjumping into EDR with approach expertiseverbs used when writing learning objectives...

Option G: Urban Environments 2026-02-12

20 Items: Capital of France1/nth largest citySmart city in South KoreaEco/Sustainable City in UAEChinese registration systemWhen two or more cities mergeCity that leverages technologyCity centered around an airportOutward expansion of towns and citiesNew York plan to make it more resilientUrban area with population above 10 Million...

Earth and Space 2025-03-13

21 Items: The red planetThe Jewel of the SkyThe planet we live onTo light something upThis planet is a dwarf planetThis means the moon is growingWhat we see in the sky at nightThis means the moon is shrinkingA group of stars creating a shapeThis planet is closest to the SunThis planet has a tilt of 90 degreesThis planet is furthest from the sun...

Global Convergence 2026-03-09

30 Items: propertydestroyednot movingvery profitableextremely dangerousextremely dangerousgold and silver barspeople born in Spainscience of map-makingability to fight diseasesbuilding things with wooda revolt on a sailing shipan open free-market economypirates supported by a countrySpanish explorers and conquerorstravel completely around something...

Invasive Species Word Search 2025-11-24

16 Items: To shake quickly back and forth.So scary or gross it makes you shiver.To watch or check carefully over time.Needs to be done right away, no waiting!A person you work with or do projects with.An animal that hunts and eats other animals.Very mean or likely to hurt someone or something.To stop something from happening before it starts....

Geography Unit Word Search 2026-01-13

22 Items: Which Great Lake is the warmest and shallowest of the five?Which Great Lake is the largest freshwater lake by surface area?Which major river flows from Minnesota south to the Gulf of Mexico?Which river flows through Virginia and empties into the Chesapeake Bay?Which mountain range runs from Canada to New Mexico in the western United States?...

The Role of Nurse Residency Programs in Supporting New Graduate Nurses 2025-11-21

4 Items: SafetyBurnoutRetentionCollaboration

Factors Influencing Selling Techniques Today! 2023-11-23

14 Items: criteriadirectly or indirectlyshare and new product development.The name, logo and attributes of a business.The amount that consumers are asked to pay for a product.The way that a product makes its way from producer to consumerThe goals set by a business to increase sales, brand awareness,...

POSTIES 0407 BIG READ 2025-03-07

6 Items: the ability to seeto get used to a new situation by changing the way you behave and think_____ is a way for people who cannot see well to read by feeling raised dots.the process of helping somebody to return to a normal life after they have been very ill...

Bible Random Word Search 2025-04-25

38 Items: the lastthe firstUriah’s wifedaddy synonymrunaway slaveIshmael’s father12 sent out onesIshmael’s motherJacob’ s new namewrestled with GodJew’s ruling bodyold name was Abrambirthplace of JESUSJew who ruled Egyptname hanged to PaulJew who ruled BabylonMary’s son of thunderrunaway slave’s ownercalled out David’s sinfirst king of the Jews...

Pathophysiology Terms 2026-01-21

20 Items: present at birthcause of a diseaseobjective evidence of a diseasesubjective evidence of a diseasecompilation of signs and symptomsprospect of recovery from a diseasestudy of the structure of cells/tissuesthe nature and cause of a health probleman acute increase of severity in a diseasethe origination and development of a disease...

Personal Financial Planning 2023-10-17

23 Items: The assets a person ownsPerson who depends on another personLong-term insurance with a savings elementShort-term insurance with no savings elementPayments made by a corporation to its stockholdersThe increase in the value or usefulness of an assetThe decrease in the value of usefulness of an asset...

Coffee Break - June Word Search Puzzle 2025-05-27

15 Items: - President that ended slavery.- One of June's three birthstones.- One of June's two birth flowers.- The first month of the Islamic year.- Second president to ever acknowledge Pride month.- Series of political scandals by President Richard Nixon.- U.S. Congress establishes the ________ Rights, June 1966....

08 2025-08-16

15 Items: a footrest for the riderThe part where the rider sitsSmall footrests for the rider or passengerA device for slowing or stopping a motorcycleFootrests mounted on the bike frame for supportA backrest bar for passenger comfort and supporta term used for the first ride of the new seasonFoot controls used to operate brakes or gear shifts...

Balboa 2025-09-09

15 Items: There is a _________ between right and wrong."Under the weather" is an example of ________."Her smile was a mile wide" is an example of __________."He's as healthy as a horse" is an example of a ________."His mind screeched to a halt" is an example of _________.His new white kicks were ________, with no scuffs on them....

Communism Word Search 2023-12-13

15 Items: 9/11 was an act of _________.Making a law better than it was prior.The Soviet Union had a _________ economy.Occurs when the economy begins to decline.A country that is considered superior to others.This is a type of warfare used in the Vietnam war.A popular political idea associated with Democrats....

Getting away 2023-12-09

20 Items: feeling calm,quietsomething that is very oldbeing the only one of its kindwhen a place has lots of peopleto go on a difficult journey on footsolid substances such as wood,plasticsomething that makes you feel relaxedsomething that makes you feel excitedunusual and often from another countryto become larger and rounder than normal...

Mattot Massei 5.0 2025-07-20

20 Items: SaltHaShem’s footstoolThe place where Aaron died.Who can annul a women’s vow?Where is The Holy Ones throne?The Holy One looks for the _____.What is never quenched in Gehenna?He spoke to the heads of the tribesWhere did Israel begin their journeys?Hpw many cities of refuge were appointed?This tribe requested land East of the Jordan....

Units 6-9 2026-02-24

20 Items: Main cause of civil war, supplies, and international aid.A union strategy to restrict the south of itsAdmendment that gave African Americans equal rights.Admendment that gave All males, colored or not, voting rights.Admendment that officially freed all slaves in the United states...

European Age of Exploration 2024-08-12

10 Items: What was the name of the reconquest of Hispaniola?What nation discovered a new route to India and China?What were southern cities of Spain in terms of religion?What was the name of the trade route from Asia to Europe?What land was known for the large amount of spices produced?What city fell to the Ottoman Empire and cut off the silk road trade?...

Vocuabulary Unit 1 Focus 2025-12-11

10 Items: ... but A and C only are connected...There is a... connection between points A and B...A sign that says “…” warns you not to enter a place.Tom can’t cook so he eats junk food. Not all the time but …With some people … is difficult because they just won’t listen.I was … to water my friend’s plants, but I forgot, and they all died…...

Sustainability 2025-09-26

15 Items: The act of using goods, energy, or food.Bringing nature back to a healthy state.The variety of animals and plants in nature.Harmful materials in the air, water, or land.Fair treatment for all people and the planet.When people have the same rights and opportunities.Things we use from nature, like water, trees, and oil....

Vietnam Word Search 2023-03-08

6 Items: Between July 1966 and December 1973, more than 503,000 U.S. military personnel _________The later years of the war saw increased physical and psychological __________ among American soldiers.Westmoreland pursued a policy of _______, aiming to kill as many enemy troops as possible rather than trying to secure territory....

Cardiac Rehab Word Search 2023-02-23

15 Items: cessation To stop smokingweight in pounds divided by heightRisk Factors risk factor YOU can changeattack obstruction of blood flow to heartmonitoring continuous monitoring of a patient's EKGWhat you will experience in our cardiac rehab departmenttype of chest pain caused by reduced blood flow to the heart...

Burberry 2024-07-26

15 Items: Who is the new CEO?where are Burberry bags made?The peg bag is made from what?How should a bag be stored in SB?What closure does the snip bag have?Which bag is inspired by a child’s toy?Where are Burberry cashmere scarves made?What tones are used in the AU24 collection?What is one of the AU24 seasonal micro prints?...

Legendary Sports and Athletes 2024-09-20

15 Items: Golf legend, won 15 major championships.Brazilian soccer star, won three World Cups.NFL quarterback with seven Super Bowl victories.Tennis champion with 23 Grand Slam singles titlesSwimmer with the most Olympic gold medals in history.Gymnastics superstar with multiple Olympic gold medals.First African American to play in Major League Baseball....

2026-02-08: Money Redeemed Through the Grace of the Gospel 2026-02-08

15 Items: what the 10% tithe serves aswe, by Jesus' ____, become richThe country Pastor Jacob prayed forWhat everything God gives us containsThe city Paul encouraged to be generousThe ministry highlight that Elaine shared aboutThe parable our new Confession/Assurance is based onThe disciple who betrayed Jesus for 30 pieces of silver...

High frequency facials and machines 2023-03-07

25 Items: the ozone has a ___________ smell to it.High-frequency _______ oxygenate the skinThis treatment promotes _______ productionthe high-frequency machine creates ______.high-frequency machine __________ the skin.This treatment promotes ________ stimulationhigh-frequency machine stimulates ____________.High-frequency devices kill ________ with contact...

9.The 1950s saw the emergence of a new youth culture, as teenagers became a distinct demographic group with their own music, fashion, and attitudes. 2023-03-04

20 Items: souldoowopmotownthetwistbillhaleydickclarkalanfreedchuckberryfatsdominobuddyhollyedsullivanrockandrolltheplattersthecoastersstaxrecordselvispresleylittlerichardjerryleelewisrhythmandbluesamericanbandstand

Intellectual Property and Digital Media Ethics 2026-03-02

20 Items: A notorious type of malicious software that encrypts all your files and demands a payment to unlock them.This term refers to false information spread unintentionally, without a malicious motive to deceive others.This is false information that is deliberately created and spread to deceive people or cause specific harm....

MS13 Ch5 Vocab 2025-02-21

67 Items: loveherethenfearyearsstillfaceswhichblameshotstodayprideproudsweattimesnobodyreasontattoobulletswalkingenemieswe wereyou aretriggertowardsyou didremorseyou seeconfusedthey saidto arrivethey tookit soundsstill hadover thereI squeezedI remembercompartmentthey killedI have shownhe/she/it waswe were goinghe/she/it puthe/she/it gaveit had made me...

Bo 6.0 2026-01-25

28 Items: …. And _______ ______. “What was the eighth plague?“It is Adonai’s ________. “The lamb is to be _________.The ninth plague was _______.You eat it with loins ______.It is to be eaten with “ ________ …“Not a_____ of His shall be broken.”You are to eat ______ for seven days.This plague lasted for ________ _____....

OurDay Work Search 2022-08-29

1 Item: The name of the new ERP system that is being implemented at MUSC

Vayera 6.0 2026-01-18

29 Items: “The ruler of demons”Who speaks to Pharaoh?and with great ______. “Moses’ and Aaron’s mother.G~d ________ Pharaoh's heart.Next came the plague of ____?The sixth plague was ________.The seventh plague was a _________.The fifth plague was Egypt’s _______ died.Yeshua drives out a demon from a ______man.After Gnats came mosquitoes, flies or wasps....

11.The 1950s saw the rise of consumer culture in the United States, as Americans began to embrace a new era of abundance and materialism. 2023-03-04

20 Items: ibmpepsifordismcocacolakelloggsbrandnamesadvertisingconsumerismcreditcardsassemblylineshoppingmallspopularbrandsgeneralmotorsmassproductionappliancestoresgeneralelectricinstallmentplansdepartmentstorespostwarprosperityplannedobsolescence

4B 0617 2023-06-16

24 Items: The beach ball is floating on the ________ of the sea.When you go to the zoo, you can see a ________ of animals.After drinking too much ice cream, Emily had a terrible ________.The more you exercise, the faster and stronger your ________ are.Dolphins are very smart animals. They can __________ with each other....

0817 Let's do it ! 2022-08-16

18 Items: Baguettes are from ________.definition: very smooth, not bumpyIn the past, bad ____ lied to people.May I have some _____ cookies, please?We should _________ our homework soon.Betty never lies. She is very _______.That's why "a baker's ______" means 13!This necklace is worth a lot of _______.definition: to move something around an area...

19th Century History 2023-03-14

18 Items: to legally voidthe right to votethe idea of withdrawing,system of underground routesexpansion of the united states in size.an individual who wanted to end slaverynative americans forced from their landsemployment based on friendship and loyaltythe way of getting territory through living or by force...

Bed Word Search 2025-11-10

17 Items: – Technical name for the nail.– Half-moon shape at base of the nail.– Area where new nail cells form and grow.folds – Skin that surrounds the nail plate.groove – Slit or furrow along the nail sides.– Dead, colorless skin attached to nail plate.edge – Nail part that extends past the fingertip.– Fibrous tissue connecting bones or holding organs....

BBB4M Unit #1 Review 2026-03-09

18 Items: Sends goods or services to another country.Are taxes or duties put on imported products or services.Is the amount of worth that is added to a product at each stage of processing.Brings products or services into a country, for use by another business or for resale....

Chemistry Chapter 1 2025-11-13

14 Items: The change from gas to liquidA change that forms a new substanceAnything that has mass and occupies spaceThe process in which a liquid changes into a solidThe process in which a liquid changes into a vaporan example of a substance that undergoes sublimationThe temperature at which a solid changes into a liquid...

Branding Wordsearch 2025-10-24

14 Items: funnestest class LOLtry-hard funny not so funnywonk wonk wonk classroom funnyrelationship with a distribution partnerconsumer’s commitment to continue using a brandme cant wait to go home and i bet you too classsomeone who is interested, involved and engaged in the eventpractice of using a successful brand name to launch a new or modified product...

A+Unit 8 2025-05-19

18 Items: –We can trade our toys for fun.–I like to relax by reading a book.–She is not only smart but also kind.–I will be done with my homework soon.–This cake is so delicious, I want more!–We walked one kilometer to get to the park.-We poured condensed milk on the shaved ice.–Long ago, people came to colonize new lands....

The Age of Exploration 2023-11-15

12 Items: A settlement of peole living in a new territoryA leader in the spanish conquest of the AmericasA person mixed with African and European descentThe slave trade route from Africa to the AmericasA large plot of land to grow sugar,cotton,and vanillaA person of mixed European and Native American descent...

Onethreefiverule Word Search 2024-09-26

13 Items: Actions the goal-setter wants to performDesired results an individual wants to achievegoals which can be accomplished in days or weeksGoals which can be accomplished in months or yearsperson’s ability to use time productively, especially while workingDependent on the goal-setter setting and maintaining a personal standard...

Boom or Bust 2025-04-02

12 Items: right to votegave women the right to votedark thick liquid commonly called oil.A sudden, extensive, or notable, disaster or event.A town undergoing rapid growth due to sudden prosperityindependent oil operators who searched for new oil fieldsAn economic principle which says that prices change when supply or demand changes...

Topic 7 Part 2 2026-02-12

14 Items: deliverance from sinto see in the best possible lighta person who wanted to end slaverythe protection of natural resourcesthe views held by people, in generalthe campaign against alcohol consumptiona person who cannot pay money he or she owespeople who have a certain concern or belief in common...

Famous places around the world 2024-07-19

12 Items: - Home to the pyramids of Giza and Sphinx.- Known for its Opera House and harbor bridge.- Famous for its canals, gondolas, and St. Mark's Square.de Janeiro - Famous for its carnival and Copacabana Beach.- Known for its ancient history, Colosseum, and Vatican City.- Known as the City of Lights and famous for the Eiffel Tower....

Revelation Word Search 2025-06-29

1 Item: Times, Kingdom, New Covenant, Abomination, Sixth Seal, Trumpets, Bowls, Theif In The Night, Bridegroom

Madagascar 2025-07-08

1 Item: marty gloria Melman penguins leemers zoo zookeepers king Julian rainforest Africa New York madagascar

1st grade spelling 2026-01-29

1 Item: nail, train, rain, tail, boat, float, coat, load, one, would, could, new, were, come

2026 Winter Olympic Games 2026-01-13

18 Items: The host nationThe host region of the competitionA sport that combines skiing and shooting.A sport involving fixed-heel bindings over free-heel.A skiing hybrid of several tracks and a jumping start.A variant of skiing that covers various tracks and durations.Four participates race around an oval to compete for the best time....

Plant Diversity 2025-11-11

13 Items: The part of a plant that makes foodThe part of a plant that holds the seedsplant A plant that does not produce flowersplant A plant that produces flowers and seedsThe part of a plant that can grow into a new plantA tall plant with a thick, woody stem called a trunkA tiny non-flowering plant that grows in damp places...

Executive branch 2025-04-23

17 Items: The spread of a secretCovering of a wrongdoingHighest-ranking diplomatic officerlead staff member of an administrationWritten directive, signed by the president,Process of electing president & vice presidentResponsible for the day-to-day management of the governmentOversees the performance of federal agencies, and administers...

Fleet Farm Word Search! 2025-07-20

17 Items: Where we work.Each zone has one of their own.The city our store is located in.The color most associated with us.We sell these in the Garden Center.Auto has a large selection of this.We have our own brand with Eileen's.Our biggest promotional event every winter.You can get this exclusively at our C-Stores....

Technological Innovations of the 21st Century 2025-04-14

10 Items: CLEANENERGY : Energy that is produced using renewable and non-polluting sources.GENETICEDITING : The manipulation of an organism’s DNA to achieve desired traits.VIRTUALREALITY : A simulated environment that can mimic or completely alter reality.INNOVATE : To introduce new ideas, methods, or devices to improve or advance a field....

U2-1 2025-08-02

10 Items: The way that someone or something looks.To express the sense of words or text in another language.Elaborate or decorative; or, to feel a desire or liking for.To cause (someone) to believe firmly in the truth of something.A person who is in charge of a department, organization, or film....

Journals, Documentation Standards, and NOAs 2026-01-28

8 Items: The amount of time to convert notices to Large Print and Data CD.Form provided to customer after completing a telephonic signature.One of four standard options for alternate formats provided by DHCS.This is required to document all customer contacts and all case actions in CalSAWS....

Pathways to Excellence Knowledge Word Check! 2025-01-31

10 Items: Strategy in place to address physical fatiguePromoting a Culture of Interprofessional decision makingMethod to involve direct care nurses in hiring decisionsAward received by nurses promoting a culture of staff recognitionSurvey that allows staff to provide input into wellbeing initatives...

Precision in Academic Vocabulary 2025-04-14

10 Items: EVALUATE : To assess the value, quality, or significance of something.SYNTHESIZE : To combine different ideas or information to form a new whole.ANALYZE : To examine something in detail to understand its structure and meaning.FORMULATE : To create or develop a clear and systematic plan, theory, or solution....

Age of Discovery 2025-12-09

1 Item: Columbus, New World, exploration, slave trade, discovery, gold, plantation, old world, tobacco, disease, Magellan, columbiaexchange,