incl some with Word Searches

Phonetics_1st_Yr_Introductory _Lec. 2023-10-06

9 Items: phoneticsthe adjective of lungThe cavity of the Pharynxthe voice box or Adam's applelies after teeth ridge and hard palatedivided into tip,blade,front, back and edgesounds produced with vibration in vocal cordsSmall fleshy structure at the very end of soft palatethe study of speech sounds and the way it transfers to the listener

Wake Word Search 2025-07-29

8 Items: to put on clothesto chew and swallow foodto put things into a bagto move by using your feetto clean your teeth or hairto rest with your eyes closedto stop sleeping and open your eyesto use water to make something clean

Unit7 Word Search 2024-11-06

13 Items: unit7not complexall negativethe countrysidelikes to stay socialto fulfill somethingliving outside of a cityfarming, field, cornfieldgoing to a foreign countryteachers getting kids into a linesomething that is associated with the countryif you get the worst grade on a test you might besomething that might be your favorite thing to eat

ROPA 2024-03-15

32 Items: socksshoesbootspajamaspajamasrobe(B)robe(A)slip-onssandaliasrain bootssnow bootsnight gownumbrella(q)umbrella(S)short bootswith a hoodrain coat(I)rain coat(C)umbrella(sol)high heels(T)umbrella(qaus)tennis shoes(T)flip-flops(LONG)flip-flops(short)wind jacket(1word)bathing suit(LONG)wind jacket(2words)bedroom slippers(P)bedroom slippers(Z)...

Spanish Vocab 7 2024-11-21

41 Items: HamTeaEggsMilkWithBreadToastBaconLunchSaladApplePizzaWaterNeverCerealBananaYogurtCookieOrangeCheeseCoffeeTo EatAlwaysRight?SausageHot DogWithoutLemonadeTo DrinkBreakfastHamburgerHow awfulSoft DrinkFood, MealFruit SaladStrawberriesFrench FriesWhich? What?More or LessTo understandDrink/Beverage

Period 4 Early Review 2024-10-24

17 Items: Saved Baltimore from being burnedDeath nail of the Federalist PartyMan who won the "Revolution" of 1800The treaty that ended the War of 1812This young Native American saved Lewis and Clark.Frontiers men who wanted to fight the War of 1812Old Ironsides, famed US ship from the War of 1812This man explored the southern half of the LA Purchase...

Multisyllable Words with Short Vowels Igloo /i/ Ostrich /o/ and Up /u/ 2025-08-28

12 Items: wiltedinjurysignaligniteobscurenonsenseultimateshriveledponderingpulsatingfunctionalpublication

Tunnel Word Search 2024-10-06

7 Items: unusualroof inside a roombend head or body in respectfemale member of a king's familya meeting of people with same interestan underground passage for people or vehiclemaking air blow on to someone or something by waving a fan

The Daily Word Search 2025-05-21

14 Items: sideto give outU.S. currencyto meet, come uppositioned in trenchessomeone to take the place of anothera decline in the buying power of moneyto understand or explain the meaning ofa sum of money offered or given as a rewardsurrounding and blockading a town or outpostthe selection system for required military service...

Featured Destination: Central Europe Save $400 per person with code CTCEP400. Book by November 9. 2023-10-29

31 Items: rigabrnosofiasibiuohridsopottorunviennapragueberlinwarsawgdanskkrakowmunichbarsovskopjetiranatallinnvilniuswroclawbojniceplovdivolsztynbudapestsalzburgbelgradetimisoarabucharestbucharestbratislavaboleslawiec

Photosynthesis Word Search 2025-03-23

20 Items: A large, slow-moving mass of iceA dry region with little rainfallThe layer of gases surrounding EarthEarth’s spinning movement on its axisThe second layer of Earth’s atmosphereThe path a planet follows around the sunA mountain that erupts with lava and gasesA piece of land nearly surrounded by waterRain, snow, sleet, or hail falling from clouds...

Latin 10-12 Review 2025-04-14

61 Items: wenogodyouournewyesgiftfirenamecavelikealsohorseflameenemyangernightqueenstormcrueltheredangerforestto sendto moveto killto showso greatto buildto fightsuddenlytogetherright handto consumeto destroygrief, painyour, yoursyour, yoursto do, makeimmediatelykeen, fierceand not, norbrave, strongto put, placeto desire, wantfortunate, happy...

Workplace Issues 2024-11-18

13 Items: prevent against electrical firescommonly known as the “grapevine”protects employees with disabilitiescontrol loose wires or fraying cordsensures employers establish safe working conditionsconsists of upward, downward and horizontal communicationresponsible for the “fair and equitable treatment of employees”...

Blue Word Search 2024-06-16

15 Items: love languagehow many kidsfavorite foodfavorite colormy biggest fearapology languagehow to keep trustmy five year planfavorite dead yearmy favorite part about youmy favorite memory with youhow can you better support mehow have you benefited my lifemy idea of a successful relationshipmy one non-breakable relationship rule for you

Writing 1 2022-11-01

21 Items: lay eggssays meowsays woofgives woolmakes milkuses a saddlesells you foodsells you foodhas a curly tailroars with a maneworks on the farmworks in a schoolis a famous pokemonlives in a pineapplewiggles on the groundmakes you feel betterhas feathers and fliesdrives a big red engineprotects your neighborhoodtakes care of you in hospital...

Beber Word Search 2024-03-13

35 Items: hamwitheggsmilksaladappleneverbreadtoastcoffeecerealto eatcookieI loveI likeorangecheeseto drinkto sharelemonadebreakfastfor lunchhamburgerfood, mealfruit saladapple juicepizza pizzaWhich? What?strawberriesorange juicemore or lessfrench friesto understandfor breakfastdrink/beverage

Les fêtes 2025-09-10

33 Items: lovelifecakehostteendeathbirthcandyadultcoupleguestshostesscookiesold agetogethersurprisehappinesschildhoodice creamice cubesadulthoodfriendshipretirementto celebrategift, presentin love (with)(public) holidaymarriage; weddingparty; celebrationyouth; adolescenceto seem, to look likedate/appointment/meetingit is necessary, you must, one must

Verbos Reflexivos 2025-11-25

22 Items: AfterBeforeTo put onTo try onTo wake upTo rememberTo take offTo sit downTo go to bedTo fall asleepTo get dressedTo dry oneselfTo worry aboutTo become (adj)To put on makeupTo wash one's selfTo comb one’s hairTo get angry(with)To stay; to remainTo be called; namedTo go away; to leaveTo shower; to take a shower

Caffeine Word Search 2024-11-25

20 Items: a severe allergic reactionproduced from the formation of beetsa stimulant found in coffee, tea, and cocoanutrients people take in addition to the food we eat.a type of vegetarian that eats plant sources and eggsa type of vegetarian that only eats food from plant sourcespopular diets that claim to offer a quick fix to health issues...

The Word Search 2025-04-15

250 Items: aIbeoftoinheitasonatbywedoorifnosoupgotheandnewhowtoofornotsheseeusegetanyoldyoubutonenowmayallsaywhocandaywaymanoutownofffewaskputwaryetendletbigboywhytrypayhavethanintoonlyyearsometakegoodeachfeelseemhighthattheywithcomeknowlikethenveryhandlifetellthisfromworksuchgiveovermostevenfindhereshowBothneedmeancallwillmakewhenmorealsomanymustlookbacklast...

Cats 2025-07-16

25 Items: Cats are animals that mark their space with scent.Defensive vocalization warning others to stay away.Began approximately 9,000 years ago in the Near East.Cats spend 30-50% of waking hours cleaning themselves.Adult cats have 30 designed for their carnivorous diet.Exceptional range up to 64,000 Hz, much higher than humans....

British and Irish Dogs 2025-08-05

20 Items: Scent hound, used primarily to hunt hareA large, black and tan gundog from ScotlandPembroke and Cardigan are both types of what?What word goes in front of 'beagle' and 'blue'?Pepper and which other colour can Dandie Dinmont Terriers be?A terrier was associated with this city long before Noel and Liam...

Zeus Basics 2025-09-10

28 Items: food of the godsruler of the seadrink of the godstitles or nicknamestree sacred to Zeusruler of the underworldLocation of Zeus’ oraclebird associated with Zeusweapon of Zeus, forged by the CyclopesKing of the Gods, the lord over the Skyson of Zeus and Aegina and king of Aeginawas the King of the Titans and father of Zeus...

Afro Word Search 2025-11-19

43 Items: Study of past eventsMovement to end slaveryTime that is yet to comeAfrican-Brazilian religionFamily descent and lineageFair treatment and behaviorAct of setting someone freeMusical bow used in capoeiraLegal and moral entitlementsProcess of receiving knowledgePolitical activist and academicLeader of Quilombo dos Palmares...

10 History Word Search Revision 2024-08-18

42 Items: NAZI symbolAn Axis powerTreaty at end of WW1Prime Minister for most ofAllied power starting with FJapanese Prime Minister in WW2Group Hitler wanted eliminatedRussian leader in WW2.(2 words)German leader in WW2 (two words)Ban on a country trading with othersItalian leader in WW2 was Benito XXXXJapan's resource shortage of R???????...

The Great Depression 2025-01-10

22 Items: (CCC) gave unemployed people unskilled jobs.Successful in material terms; flourishing financially.The condition of having paid work; a job or profession.act gave drastic new powers to labor unions, causing another economic collapse.40,000 World War I veterans who marched to Washington DC for money promised to them....

School supplies 2022-08-22

6 Items: used to write inhelp keep paper nice and safehelps keep your pencils sharpused to help carry stuff aroundcase is used to have pens and pencils togetherare usually used to write with only during writing

Minnesota 2023-01-24

30 Items: hockey teambiggest lakebaseball teamnot saint paulthe state birdthe metro areaa northern citythe state flowerthe capitol citythe biggest rivera delicious burgerthe real state birdwe get a lot of thiswe got a lot of thesesport you play on icewhere the mayo clinic isour men's basketball teama saying to express dismayour women's basketball team...

Unit 1 Test Review 2023-10-24

21 Items: one way we use our foodused to handle hot potsphysiological influence examplethe body's main source of energythis is used to reach high placestype of shoes worn in the kitchenthis provides our body with energyshould be disposed of with a broomcarries nutrients throughout the bodythis is an example of a media influence...

Writing 1 2022-11-01

21 Items: lay eggssays meowsays woofgives woolmakes milkuses a saddlesells you foodsells you foodhas a curly tailroars with a maneworks on the farmworks in a schoolis a famous pokemonlives in a pineapplewiggles on the groundmakes you feel betterhas feathers and fliesdrives a big red engineprotects your neighborhoodtakes care of you in hospital...

PMC Tech Week Word Search 2024 By Dr. Kristin 2024-09-06

22 Items: Our RescueWe work atClinic CatDogs are __PMC ManagerOur Pet StoreBlood SpinnerOur newest vet!Our CorporationWho’s that girl?Dr. Chuck’s breedThe OG technicianDr. Todd’s nemesisNot just a mustardSqueeze with caution!Heather’s favorite animalDr Kristin’s fabulous dog!Diabetic monitoring systemThe Great Pretender (dfdx)Dr. Kristin runs a lot of ___...

HW Word Search 2025-08-24

90 Items: toinisitgosobehemewenodomyamatasofbyorantheseeforyouwhosawshearewasonetwotoocanhadandnownewnotallsaybutallourouteatplaylikehavewhatlookwantcomesaidbluewithfindtheyhelpjumpwillwentfourthatthisdownmustwellgoodfromwhenweresoonrideintoawaycamewhereblackbrownthreetherewhiteunderfunnytheiraboutyellowlittlepleasepretty

GRIV Quiz 1.1/2 2025-08-26

24 Items: laweliteexcitedto publishfluent(ly)monolingualto throw outtraffic signto recognizeto miss somethingofficial languagenational languagelinguistic regionto furnish, set upto gain experienceto befriend (someone)to expand (one’s self)multilingual, polyglotto empty out, clear outlonging, wistful, yearningto clear out, muck out (slang)...

Deutsch III und IV Buchvokabeln 3 2025-12-03

26 Items: rulenountablemeaningheadingmissingfittingcompoundtwo-partbeginningexpressionword ordersubheadingto collectpossibilityeach, apieceto join somethingexpression, sayingown, as in “one’s own”connection, associationrewriting, reformulation(in order) to double-checkmultiple, several, umpteento mark with a cross, tick a boximpactful, convincing, meaningful...

Las Actividades 2025-12-05

21 Items: to runto skito singto drawto readto swimto workto danceto watch tvto ride a biketo play sportsto play guitarto go to schoolto write storiesto listen to musicto play videogamesto use the computerto talk on the phoneto ride a skateboardto hang out with friendsto skate (roller skate or ice skate)

Chemistry Word Search 2025-03-04

16 Items: The narrator quits this activityIn science, these are never stillWhat does the father tell her to not sayScience cannot advance without ________?What does she realize mothers have as well?What type of stories are her jams right now?What does her father give her from his gardenWhat is trapped that the narrator wants to let free...

Recovery Wordsearch 2.0 2025-03-02

29 Items: Being open to change, growth, and recovery.Appreciating the blessings of sobriety and life.A state of peace and acceptance, free from turmoil.Believing that a better and sober life is possible.Letting go of resentment towards oneself and others.Helping others in the recovery community and beyond....

Quality and Patient Safety 2025-05-26

31 Items: An incident that caused no injury or damageThe core purpose and values of an organizationA yearly evaluation of processes or performanceA situation with minimal chances of causing harmThe process of handling patient safety incidentsSerious safety events that lead to severe outcomesA situation with a high probability of causing harm...

Unit 107 2025-10-05

30 Items: and they are...-Offer money as payment-Something given as a gift-An outdated type of payment-This could be wrong on the bill-A modern way of making a booking-An analysis from the billing system-How to make a booking whilst visiting-This person deals with group bookings-This could fail when taking a payment-A birthday may be a special one of these-...

Find the Right One With A1Z26 2025-11-19

4 Items: 14.9.8.15.146.5.21.4.1.1219.8.15.7.21.1419.1.13.21.18.1.9

Be Super Scooper 2025-04-10

11 Items: Day ____ of admission is suitable to catch C. diff under protocol.Day ____ of admission is suitable to catch C. diff under protocol.Clostridiodes ____ is a bacterium that causes diarrhea and colitis.Day ____ and beyond of admission is NOT suitable to catch C. diff under protocol....

Relativeatomicmass Word Search 2025-09-21

38 Items: two or more atoms bonded togetheratoms with the same number of protonscolumns going down the periodic tablerows that go across on the periodic tableA spherical orbital found in all energy levels.Outer most shell that is occupied by electrons.Electrons occupy orbitals singly before pairing up.A substance formed as a result of a chemical reaction....

Evolution of plant-based meat - October 2 2023-09-18

6 Items: another word for "delicious"a person who does not eat meat or fishthe soft part of an animal or a bird that can be eaten as fooda great source of vegetarian protein that was invented in Indonesiaa soft white food that was invented in China and is made from soybeans...

spanish vocab 2023-10-02

5 Items: you do this to spriteyours is Edward Koryckayou use this to buy stuffyou do this if a murderer is chasing youwhen you meet up with friends, you form one

Gatsby Vocab #2 2025-03-03

5 Items: a wild gatheringa plant or animal naturalized in a regiona slight suggestion or vague understandingcharacterized by extreme care and great effortcontented to a fault with oneself or one's actions

Biology S1 Exam Review 2024-12-11

31 Items: water lovingself feederssplitting wateradding phosphatesplitting glucoseenzyme that makes ATPaffinity for electronsmore stiff fatty acidsreaction releases energyorganelle that holds DNAcycle with Acetyl CoA inputtransport that requires energybreaking down larger moleculesNADH and FADH2 are electron...organelle that synthesizes proteins...

Lowe's 2025-04-13

24 Items: Toothy toolNot a door but aA door swings on itApplicator for paintOur Live Goods itemsThe thing #12 turns onWho maintains our bays?The ceramic style flooringPower tool used for screwsYou groom your lawn with itAppliance to clean your dishesUsed to pull on to open drawersAppliance to keep your food coldCabinet that your sink goes into...

Social Studies 2025-11-10

20 Items: the right to votethe father of Communismbelief in equality of the sexesman who unified Germany in 1871the rights everyone is born withfirst ten amendments to the US Constitutionresources used to create goods and servicesJefferson, 3rd president of the United Statesthe middle class that owns the means of production...

Elisa 2025-01-16

1 Item: some looked people make

About Word Search 2022-11-28

1 Item: many some the down

3B 0726 2022-07-23

25 Items: unwisegreatly surpriseda very large expanse of seafeeling or showing surprisehighly pleasant to the tasteknown and recognized by many peoplea piece of land surrounded by waterfeeling fear or anxiety; frightenedcome or go back to a place or personcoming before all others in time or orderpursue in order to catch or catch up with...

Basic Training - Week 1 of M5 2024-04-18

13 Items: 14 consecutive days.To abandon something.Climb up or over (something high and steep).Expression used to say someone is finished paying.A narrow channel dug in the ground, typically used for drainage.This describes a person's ability to shoot a firearm accurately.Extremely enthusiastic about doing something, especially going to war....

Biodiversity 2025-06-02

13 Items: The variety of life on earth.One of the major threats to biodiversity.Organisms that have a backbone are called:A species not native to the area is known as:A geographic area where organisms are connected.Organisms that don't have a backbone are called:Living organisms capable of reproducing are known as:...

Workplace Issues 2025-09-29

13 Items: Prevent against electrical firesCommonly known as the “grapevine”Protects employees with disabilitiesControl loose wires or fraying cordsEnsures employers establish safe working conditionsConsists of upward, downward and horizontal communicationResponsible for the “fair and equitable treatment of employees”...

Stamp and Go Requests 2025-03-04

16 Items: Who issued the checkWhat we send for endorsement.Document needed for USDA claims.This loan type has a $20,000 threshold.Where we notate the Stamp & Go request.Where we create the Stamp and Go letter.Document that includes all claim information.Found in the bottom left corner of the check (always)....

T.L.E WORD SEARCH 2025-02-03

21 Items: This are small, medium ,and large.This are use to grating cheese,meat and other ingredients.This is come with various lengths of 6,8,10 and 12 inches.This are use to costomized edge on bread for tea sandwich.Small flat,round bladed utensils that is serrated on one side.This is a long and flexible with ah rounded end level off ingredients....

Terminology D 2025-03-19

28 Items: a directory for Internet Protocolsa method of measuring print densityunprocessed pieces of digital informationa small circuit board containing RAM chips.collection of indexed information in a structured formatfunction that shows the date as a number in serial formatpre-selected option to assist in data entry or selection....

Ch. 12 Medical Terminology 2024-12-13

5 Items: Scraping of the skinBleeding under the skinEscape of fluid into a cavityA tear in the skin, usually with jagged edgesA sharp cut, like from a knife; wound edges are smooth

Falls Prevention 2023-09-12

16 Items: 3 or more medicationsfactors that can be changedfactors that cannot be changedsome carry their own fall risk_____ devices may help prevent fallscan be a multifactorial risk for fallsAdequate __ may prevent nighttime fallsthree or more __ indicate increased risk__shoes and socks may help prevent falls____ of falling increases risk for falls...

Rhetorical Analysis Verbs 2025-09-09

16 Items: Points out or names something specifically.States something in a detailed and exact way.Draws special attention to something important.Suggests something without stating it directly.Puts forward an idea or plan for consideration.Proves an argument or statement to be wrong or false.Refuses to accept or agree with something, disagrees....

George's Marvellous Medicine Recipe 2022-12-06

34 Items: gindipoilseedsaucepowderpowdergreaseremoverhairsetparaffinlipstickstoothpasteantifreezepeppercornsshaving soapnail varnishfloor polishdandruff cureplaster powderwashing powderpowder for dogstan shoe polishhot chilli sauceponking deodorantbrown gloss paintgloss hair shampooof turnips perfumeenriched face creamfalse teeth cleaner...

Vocab 2023-03-01

22 Items: to runto skito singto drawto swimto workto danceto skatealso,tooto skateboardto ride a biketo play sportsto go to schoolto write storiesto read magazinesto listen to musicto play the guitarto play video gamesto use the computerto watch telévisionto talk on the phoneto spend time with friends

Michael Jackson 2023-10-24

50 Items: itbadbenyouerajamabcgirltitojeanwalkjanetrandyis itdianarobinjackiejosephlatoyamarlonrebbiexscapeof popand memotownscreamnaturechicagoindianahistoryjacksonmichaelgrammysor whitejermaineme alonethe wallcriminaljacksonsthrillerwith youdangerousthe worldthe closetinvincibleyou feel itto be therejackson fivein the mirrorrock my world

Roblox Games Word Search 2024-02-26

30 Items: FPSTrainsR6 FPSMysteryFood SimSurvivalGraffiti... CreedBig HandsSpeed SimBig Hero 6Voice ChatRepetitionBad TeacherGun CampersRoblox MeccaStrength SimKill ZombiesFootball TeamClick to RaceTown Role-playUnlimited AmmoTable RouletteHere "Eye" ComeRoblox FortniteTown in WisconsinFairy Tale School25 Robux to AccessRoblox Phasmophobia...

June 10-16 Midweek Meeting 2024-02-24

93 Items: inofarejoyandsunhelpdrawideatactwithholysauljohnmarkgoodnewsrainheatcoldcloseteachabouttrainwatchhonorjesuslandspavedroadsthosefamilyfollowvideosjw.orgwarneddangersourcewealthrichespreachfilledspiritplacesefforttravelslowertiringdangerriversparentshistoryexampleworshipdiscussjehovahimitatekingdommessagecautionantiochfarawaywalkingthievesrobbers...

Fearless 2025-03-29

30 Items: lawsavedfearsfruitperfectevidencenot seensubstancehoped forimitatorssacrificeLord JesusGod is loveHoly Spiritdivine loveonly believedear childrendo not be afraidvaried expressionsjoy that overflowspeace that subdueskindness in actionstrength of spiritgrace through faithlife full of virtuefaith that prevailsgentleness of heartsweet smelling aroma...

Series 6 Review 2023-07-19

75 Items: accountA radio interview is a public _________Rule 147 is regarding _______ offeringsSelling group members are paid a selling ______A final prospectus is also known as a _______ prospectusThe firm in which must complete the transfer of an accountThe “A” under discretionary orders that describes buy or sell...

Principal Salem, Massachussets Landmarks 2024-05-13

7 Items: A haunted hose of witches.A famous bewitched statue.A museum with a lot of ouijas.A bewitchet tour after the dinner.Historical building in then downtownSalem’s oldest cemetery, founded in 1637.is a historic building within Salem Maritime National Historic Site.

Pandemic Word Search 2025-11-24

5 Items: A disease which has a large number of cases in a localized area, and is not spread globally (Martin et al., 2023).A disease which is widespread worldwide crossing international boundaries and is not localized (Martin et al., 2023)....

ww5 u1 and 2 2024-03-07

31 Items: to buya drinkequal toto use upto go to bedto help groweasily brokenbig and strongsomeone walkingto make familiarto move or shiftto push or shovea pleasant smella strong desire forto remove or take outto make known by namehot and moist climatewatchful or wide awaketo join or bring togethergetting along well togethera person in a doctor's care...

Photoshop Final Review 2025-05-05

23 Items: Selecting the oppositeFreehand selection toolBlack on levels is this:Fancy word for line spacingFancy word for letter spacingFonts with little tails on themRemove the color hue to grayscaleUse this menu if a panel is missingMost common color mode for JPG imagesMost common color mode for GIF imagesDecrease this to make brush less fuzzy...

Unit 2.1 Word Search - art, photography 2025-12-01

28 Items: a quick photoa public show of arta picture of a personlooking good in photosa very great work of arta book for quick drawingsa picture made with paintthe light used in a photoa small part of somethinga large painting on a wallthe border around a picturehow a surface feels or looksa photo you take of yourselfto make something look closer...

vocabulary 2024-11-21

5 Items: done without confidence; hesitantan aspect or feature of a situationact in accordance with a wish or commandfree (someone or something) from difficultyto intrude on (a person's territory, rights, personal life..)

the best best best best ultimate 67 with shep words 2025-09-04

10 Items: peneweramlambchoplambchopSheepsteaklivestock

Words with the Long /o/ sound: Ocean and Long /i/ sound: Ice 2024-10-21

12 Items: poetrymileagetonightlicensethrivingboastfulreplyingexerciserecognizelightningwholesomefrightening

The Moon 2025-10-28

9 Items: Plains on the moon.Vehicle used on the moon.the moon doesn't have this.Having to do with the moon.The color of the moon's sky.When something blocks the sun.The moon's gravity pulls this.Sliver shape the moon looks like.The shape where we see all of the moon.

Departments, Disputes, and Fee 2025-03-26

13 Items: Handles charged off debtsAny dispute needs this to be submittedTransfer here when the statement has 2 due dates.Late fees are % of your monthly mortgage payment.Transfer here when 3 or more months behind on paymentsTransfer here if they need help with an insurance policyTransfer here when lender placed insurance needs to be removed...

Plant Diversity 2025-11-11

13 Items: The part of a plant that makes foodThe part of a plant that holds the seedsplant A plant that does not produce flowersplant A plant that produces flowers and seedsThe part of a plant that can grow into a new plantA tall plant with a thick, woody stem called a trunkA tiny non-flowering plant that grows in damp places...

RPMS 2024-06-07

25 Items: I DON’T CAREI DON’T LIKEI DON’T BELIEVEADDRESS THE ISSUEI DON’T UNDERSTANDDETERMINE THE TYPE OF ISSUEEMPATHIZE WITH THE PROSPECTDISCOVER THE SOURCE OF THE ISSUEthe prospect’s commitment to join the Navythe prospect’s future plans and life pressureswill have oversight of the National Inspection Team (NIT)....

General anesthesia and monitoring 2025-02-05

34 Items: flatlineonly measure SAPmeasures SAP, DAP, and MAPthe number of ET tube sizes to choosepressure remaining during resting phaseaverage pressure during the cardiac cycleET tube: largest possible but not to tightdoppler needs a cuff attached to a _________partially collapsed alveoli due to shallower breaths...

Respiratory System 2024-10-18

26 Items: The exchange of gases between the blood and cells within the body.The process of gas exchange between the external environment and the blood.A principle that states the pressure of a gas is inversely related to its volume.The complete absence of oxygen in tissues leading to severe cellular damage or death....

visible invisible 2022-06-02

41 Items: boxnearbathwholepeacepuzzleorigindesertchannelhumanityotheringrememberpreserveuniversedecisionstarburstnostalgiaconditionalternatecontrolledimpossiblereductionsbig enoughconnectionas archiveas limitedassimilaterecognitionrestrictionretributionremembrancepreservationand macrocosmbehind the starsand out and beyondteamwork directionplace but different...

Enfadado Word Search 2023-03-01

20 Items: hurthandeyesa dogits proudits a cara studentblack colorwhen you are busythe opposite of sadlo contrario de felizthe opposite of happycerca de la depresiónthe opposite of blackAvergonzada o culpablelo contrario de cómodolo contrario de valientesomething you write withquerer algo mucho, típicamente con una sensación...

Michael Jackson 2023-10-24

50 Items: itbadbenyouerajamabcgirltitojeanwalkjanetrandyis itdianajackiejosephlatoyamarlonrebbiexscapeof popand memotownscreamnaturechicagoindianahistoryjacksonmichaelgrammysor whitejermaineme alonethe wallcriminaljacksonsthrillerwith youdangerousthe worldthe closetinvincibleyou feel itto be thererockinrobinjackson fivein the mirrorrock my world

Minecraft Biomes (Unfinished) 2024-09-29

36 Items: GroveOceanJungleMeadowColdOceanDeepOceanTheNetherWarmOceanSnowyTaigaStonyPeaksBirchForestFrozenOceanFrozenPeaksJaggedPeaksSnowySlopesBambooJungleFlowerForestSparseJungleLukewarmOceanMushroomFieldsThePaleGardensWindsweptHillsDeepFrozenOceanWindsweptForestOldGrowthPineTaigaOldGrowthBirchForestOldGrowthSpruceTaigaWindsweptGravellyHills...

Berlin Vocab Quiz 2025-01-28

26 Items: riverthickfamouspancakewoodruffto occupyto remindtotal areato possesswell-knowngreen space(one's) owncupola, donesimilar, alikesimultaneouslymash, pulp, mushsmoked pork chopremains, remnantsfree standing wallarea of settlementoutskirts of a citysurrounded (no von)to subdivide (no etwas)then, at that time, formerbesides, furthermore, aside from that...

Deutsch III Quiz 1.1/2 2025-08-28

25 Items: traitloyalhonestsupportfinallycuriousto trustgenerousreliableto grow upfunny, wittyunderstandingto spend (time)in fact, actuallycircle of friendsto perform, appearto accompany, go withto shine, appear, seemresiding, stay, sojournperformance, appearanceto be valid, to count asresponsible, conscientiousto rely on, count on, trust...

Karen y Fortuna 2025-12-01

32 Items: butlazyfarmwithfastshorthorseto gohouses/he isbecauseto readlibraryit's hots/he hasto learnmountainsit's colda problemdangeroushardworkers/he likess/he wantsreally tallcountrysidebest friendthere is/ares/he is froms/he goes tos/he lives ins/he is namedfavorite class

Surrender Word Search 2025-12-03

30 Items: FlowGiveShedHealLetGoAllowClearPurgeTrustAlignAcceptSoftenDetachReleaseObserveUpgradeUpgradeSurrenderDeclutterBalance (karmic balance)Dream (prophetic dreams)Unfold (allowing changes)Face (as in facing shadow)Rise (into higher chakras)Burn (symbolic fire energy)Notice (positivity journal)Disconnect (from old cycles)...

kindergarten word search 2025-12-11

92 Items: Iameamitistomygonoinweupbehedoatonsocantheyouredyesandonetwoshebutseefordidoutrunbignotwastooareallgetsayatenowranoursaweatnewwholikebluefourlookwillhaveintojumpplaywhatsaidcomewithmustthiswentgoodmakethatdownherecamewanthelpfindwelltheysoonawayrideblackbrownwhitethreetherewhereunderfunnylittleyellowprettyplease

A puzzling gift 2022-12-24

13 Items: Not dadA type of fallSomeone specialA place to stayA very wide roadSaturday to SundayThe opposite of oldLike "fork", with a whyThe first month of the yearA place where things are madeThe opposite of black and whiteThe number between Five and SevenSaving the Manor, or Nailed It, or similar

WOUND INFECTION: Be on the look out WORD SEARCH_004 - TALKING WOUNDS® with Wendy White 2025-06-20

20 Items: HeatPainFungiOedemaSepticMalodorCultureBacteriaPathogenErythemaPurulentSystemicInfectionEndotoxinResistanceAntibioticSensitivityInflammationMicroorganismAntimicrobial

Unit 20 2023-03-09

10 Items: TinyA very large cityTo make smaller, lessenExtremely small, insignificantDone with attention to small detailsAn important powerful person in businessgreatness of size, strength or importanceA small model of a larger pattern or placeA brief statement that conveys the general truthOne who believes him or herself all powerful or indestructible

UNIT 20 2024-03-19

10 Items: tinya very large city.to make smaller, lessenextremely small, insignificant.done with attention to small details.an important powerful person in business.greatness of size, strength, or importance.a small model of a larger pattern or place.a brief statement that conveys a general truthone who believes him or herself all powerful or indestructible.

Europe/ Eurasian Geography 2025-11-13

10 Items: TaxesEnemies entering by force.An old decayed plant materialMeaning little or no rainfallSupporting or advertising somethingDefined territory with its own governmentA forest area that provides valuable resourcesA chemical that kill harmful insects and weedsA country in the Eastern Europe and North Asia....

Can you answer this? 2025-04-20

8 Items: The colour of lemons?Partner of Dec or an insect?Which soap has Albert Square?The number of wheels on a car?You may use this when it rains?You use this to unlock your door?What is greener on the other side?Kids programme with George Zippy and Bungle?

Find the jobs people do below - words ending in ist 2025-09-30

8 Items: someone who paintssomeone who plays the pianosomeone who plays the violinsomeone who writes long storybookssomeone who looks after other people's teetha shop or person that sells certain productssomeone who works with medicines and chemicalssomeone who finds out news and tells it to people

Week 14 Hard 2023-12-16

25 Items: occurred1,000,000very goodspread outto suggestfascinatingto understandmake bigger or morethe time yet to comedifference of opinionunable to be comfortedinappropriate behaviorproperly made and completedpaper with a record of a purchasebrilliant; giving off heat or lightnever stopping, going on all the timeblocked path; dilemma with no solution...

Week 6 Vocabulary List 2024-12-12

20 Items: Dull, bleak, and lifelessVery small drop of a liquid.Lasting only for a short timeDo hard, menial, or dull work.Capable of working successfullyImpossible to deny or disprove.Likely to do or to be something.Shorten the duration or extent of.Open to discussion or modification.Light rain falling in very fine drops....

NYE Happenings at Mohegan Sun 2024-12-21

23 Items: _________ bandArena Tribute ArtistLounge 9pm – DJ Cream_________ 10pm – DJ Eazy_________ 9pm - DJ ChizzleVenue hosting Mike _________Host of Novelle's NYE celebrationTriple status point days exclusionGreat _________ Celebration at Novelle_________ Mohegan Sun’s NYE celebrationMike _________, performing at 6pm & 8pm...