health Word Searches

Microgravity Effects Word Search 2023-05-30

57 Items: masslossnasafloatspacebloodswellnerveheartcellsfluidsmuscleweakenshrinkstraincanalsorgansmotionhealthrhythmmakinggravityeffectsatrophybrittlecalciumbalancesensoryotolithelectricmagneticexposurepressureregulatemineralsmovementresponsescheduleradiationdestroyerdizzinessunbalanceisolationdemandingweightlessastronautsspacecraftatmospherevestibular...

Aerobic Word Search 2024-06-10

62 Items: copeplayfreeteamyogazestgoalshumorpowersleepwaterdoctorenergyfamilyfruitshabitshealthlimitsmusclesportsstairsaerobicathletebalancecouragediseasefreedommassagesupportvictorywalkingtrainingtrainingdementiadiabetesemotionsgeneticsmeditateovercomepositivestrengthvitaminschallengecoworkerseducationintensitylifestylenutritionunhealthymass indexdepression...

Epidemiology 2023-01-21

6 Items: Source of data: Q__________S________ software is used for data management and analysisWhat do public health laboratories do? T_______ and education.Descriptive epidemiology enables development of testable h__________.Descriptive epidemiology provide a s_________ method for characterizing a health problem....

I Am Thankful For… 2023-11-15

51 Items: momTeaJamlovefoodpetsbandworkgracehouseShowsmusicmoneyWaterWorldhealthsisterbabiesPepperLadiesSewellI LoveEngineSchooltalentparentsfriendsanimalsvehiclecoachesflowersbrothersTeachersStudentsconcertsweekendshappinesseducationcoworkersA BulldogprovisionAbilitieseverythingcustodiansAn AmericangrandbabiesforgivenessTransmissionopportunities...

APES Unit 8 2024-04-24

9 Items: Plastic is not _______burn garbage to generate electricityWhere would you see construction wastelandfill that exposes trash to wind, air, scavengersnot sorted, burns trash that will create dangerous air pollutiontoxic liquid created by rainfall leaching down through layers of trash...

AFYA Health in Times of Conflict 2024-05-21

8 Items: accesstraumasuppliesemergencydisruptionevacuationinsecuritymalnutrition

Lab Week Word Search!! 2014-04-10

68 Items: ERICUPKUARUPDHMCNICUSTATswabbloodclerkcobanDavislabornerdsquestrehabtubesurinehealthscrubsanalyzeclinicscourierlabcorplabweekmedicalneedlesnurseryreagentsciencesurgerytestingweecarebandaidsHospitaldeliverymedicinepatientsrecoverysendoutssurgicalvampiresbloodbankbodyfluidchemicalschemistryemergencygraveyardheelstickhistologytelemetrycentrifuge...

TEB 2.9C les professions 2023-05-02

25 Items: nursepilothealthsurgeonaviationresearcherconsultantagronomistfirefighterhair stylistweb designerveterinarianentertainmentrobot designerfinancial sectora male politicianpurchasing managerblue collar workernews correspondantautomotive designeradvertisement writerscience and technologyinformation technologysustainable development...

Nurses Week! 2024-04-29

70 Items: cnodaisyacutecaringordersvaluesfamilykiyokoassisthealthstatimnursinghuddlesmedicalsurgeryhealingadversetedhoseaphasiapurposestaffingmeditechchartingteamworkpoliciespatientspolicieselsevierambulateprovideradvocateadvancedsedationtopnotchhospitaltouchetteprotocolsintegritybiohazardemergencytelephoneeducationknowledgedischargechesttubeassertive...

Why is my mental health and decline? 2023-01-01

10 Items: traumaanxietynosleepmymotheroutofmedsalcoholismcomplexptsdmybankaccountanxiousattachmentcripplingdepression

Compliance Week Privacy Word Search Game 2022-10-24

10 Items: HIPAA _______ and security RulesWhat regulation provides protection for health data?In order to properly dispose of paper PHI you must _____ itWhat is the three-letter acronym for protected health information?What word do you put in the subject line to encrypt your confidential emails?...

ggi 2023-04-13

38 Items: catlawlionzebrahippoBooksBooksBooks& Mathtravel& Moneyhistoryromanceelephantcalendars& Fictionreferenceself-help& Teaching& OutdoorsbiographiesFood & WinePreparation& Technology& PhotographyBooks & BiblesHobbies & Home& Spirituality& Entertainment& Relationships& Graphic Novels& TransportationMan's best friendFitness & Dieting& Social Sciences...

I Am Thankful For… 2023-11-15

51 Items: momTeaJamlovefoodpetsbandworkgracehouseShowsmusicmoneyWaterWorldhealthsisterbabiesPepperLadiesSewellI LoveEngineSchooltalentbabiesparentsfriendsanimalsvehiclecoachesflowersbrothersTeachersStudentsconcertsweekendshappinesseducationcoworkersA BulldogprovisionAbilitieseverythingcustodiansAn AmericanforgivenessTransmissionopportunitiesrelationships...

Socioeconomic disparities 2023-11-30

8 Items: Nurses primary commitment is to the.What are nurses obligated to do for their patients?One way to bridge the gap associated with socioeconmic disparitiesType of technology that helps lessen the challenges of a language barrierThis helps improve patient outcomes and identify social determinants of health....

School 2022-12-15

71 Items: artgymlabmathbandpensfeesbookstestsdesksrulesnotesplaysnurserulerclubscheergradeshealthcodingcolorschairstypingexpellabsentfightsessaysshapessoccersciencebiologyreadingenglishhistoryquizzespencilsmarkerscrayonslockersclasseswritingtardieslibraryprojectcomputerhomeworkweildingroboticsteachersstudentsteacherspeprallyassemblytheatherpartnersfootball...

Body Image and Media 2024-04-06

70 Items: tvtvgymabshotbodyfacedietuglylovemediaflawsphonetrendimageshapeuniquementalhealthhauorasocialweightgenderskinnysexualenergytiktokfiltersfashionsocietyclothesmusclessurgerypositivenegativefeelingsthoughtsphysicalfeminineskincaremakeoversnapchatmagazinesinfluencephotoshopcognitivespiritualemotionalselfworthaestheticmasculinebeautifulwaistline...

Auténtico 2023-05-09

26 Items: badmeatfatspeasmanyoniondinnergrainsbutterto walkI agreelettuceto thinkhorriblepotatoesspaghettiice creamI think soto exercisegreen beansI think thatshould, mustI do not agreeto lift weightsI don't think sofor one's health

unit 13 2024-03-07

12 Items: enemyfightto keep safeto get ones ownto show clearlydull as a resultcloser to the enda discussion of reasonshaving to do with healthsomething done successfullyhappening in many places at oncethe cruel killing of many people

Activity and Me 2024-04-09

15 Items: You’re never too old to _____.High blood pressure is known as _____.Swelling of the legs is known as _____.Weight bearing exercises help prevent _____.A disease affecting how your body uses sugar.Meditation is good for ______ and relaxation.Matching games are a fun way to improve _______.Being ______ is good for both your body and mind....

Allied Health and Medicine word search 2023-12-04

7 Items: x-raysultrasoundcomputer-assistedmagneticresonancepositron-emissionspulmonary-monitoringobstetrical/neonatal

Can classical music boost your health? 2022-05-26

7 Items: whinydebunkhecticcuratelifehacktranquilitytherapeutic

End of Life 2024-05-01

13 Items: experience of losing a loved one by deathfear and apprehension of death; death _______________withdrawal of life-sustaining support: _______________ euthanasiaintense physical and psychological distress following the death of a loved onedocuments that mention a health care agent and living wills; advance _____________...

MOUNT BEULAH MB CHURCH 2024-05-07

36 Items: DRwmuAVEHALLLINEUNITHILLSCHOIRWIVESSTUDYBOARDPANTYBOARDCHORUSSCHOOLADULTSclerksWORKERSdeaconsACADEMYMINISTRYoutreachTO GLORYministrytrusteescommitteedeaconessministersDEPARTMENTLH BELL SRLADY GRACIEorientationTRANING UNIONBEULAH TERRACEB SHIELDS MANORREV DR EG SHIELDS SR

MADELEINE LEININGER'S TRANSCULTURAL MODEL AND NOLA PENDER'S HEALTH PROMOTION MODEL 2021-11-02

20 Items: careemiceticcareCulturecultureculturebarriersbenefitsdiversityperceivednegotiationsituationalethnohistoryethnonursingpreservationrestructuringself-efficacyinterpersonalsocio-cultural

ESSENTIAL NUTRIENTS FOR THE BODY 2014-12-14

75 Items: yamscornfatsoilseggsmilkmeatnutsfishpeasironcrabplumsugarflourbrownwhiteliverbonesteethbeansenergystarchcerealfruitsbutterhealthgrowthfruitsapplesorangerepairbananacheeseiodineonionsgarlicsardneavocadococonutcarrotspumpkinproteintissueschickenpeanutsmineralcalciumraisinsshrimpspotatoeoysterscaloriespotatoeseggplantvitaminsstrengthdiseasessoybeans...

Body Image and the Media 2024-04-06

69 Items: tvgymhotabsbodyfacedietcareuglymediaflawsphonetrendimageshapeuniquetiktokmentalhealthhauorasocialweightgenderskinnysexualenergyfilters- WorthShamingfashionsocietyclothesmusclessurgery- EsteempositivenegativesnapchatfeelingsthoughtsphysicalDisorderfemininemakeovermagazinesinfluenceinstagramphotoshopaffectivecognitivespiritualemotionalaesthetic...

wave 0 week 5 morning 2023-12-11

80 Items: louavesnmetninacardfamejhonaangiehippaformssmiledentalmanualmemberlauriemarnieleshonmiriamsnoopyconlancalaimhealthhealthmolarssocialtarnotcountybrailemedicalmichelemelissarichardfortunadentistmanagedacronymwebsiteweekfiveproviderjenniferkimberlysamanthagainwellbenefitsdocumentsealantsreferrascareplansecuritypinkformpersonalspeciatybreakoutresources...

Spelling # 13 2024-03-06

10 Items: extremely smallto mix togetherhaving good healthbeing fun and joyfulhaving a lot of noisenot doing any activitywith a lot of things to doinsects with colorful wingswhat you do in your spare timeliking to be with other people

COVID19 SEARCH 2020-04-22

78 Items: PPEWHOCDCSICKTESTMASKACHEMILDPEAKCOVIDFEVERCOUGHNURSELYSOLCHINADEATHRAPIDVIRUSWORLDSNEEZEDOCTORINFECTBLEACHCLOSEDHUMANSVACINESPREADPHASESABATEDHEALTHDISEASEBREATHECLUSTERDROPLETCARRIERHYGIENEHOSPITALSTAYHOMEHOARDERSSANITIZEPANDEMICOUTBREAKHEADACHESYMPTOMSMODERATEDISINFECTRECESSIONAMBULANCEEMERGENCYTREATMENTCOMMUNITYVENTILATORQUARANTINEEXHAUSTION...

CD-MMIS 102 and 103 2023-12-13

80 Items: tardcceimsnamecodedenywhimclaimlinescrosscheckemptypausebreakmouseindexeditsdentalscreennumbercolumnnumbernoticecursorreviewpolicymanualtarnotglobalhealthauditorcontrolservicebillingmaximumhistoryrequestinhousemanagerroutingreplacewebsiteusernamepassworddocumentlinecodeproviderscheduleoverridereassignsurgicalpopulatedrecipienttreatmentscrolling...

Nursing Shortage 2023-12-01

17 Items: nursesafetyhealthsupplydemandshortageworkloadbedisidestaffingretentionenhancingsatisfactioncommunicationwhat is one way we can help support nurses in regards to staffing ratios?what is one reason new graduate nurses are leaving the workforce so quickly?what is one of the technology advancements that is helping to decrease nursing shortage?...

Cat Word Search 2023-12-01

17 Items: nursesafetyhealthsupplydemandbedsideshortageworkloadstaffingretentionenhancingsatisfactioncommunicationwhat is one way we can help support nurses in regards to staffing ratios?what is one reason new graduate nurses are leaving the workforce so quickly?what is one of the technology advancements that is helping to decrease nursing shortage?...

Spelling # 13 2024-03-06

10 Items: extremely smallto mix togetherhaving good healthbeing fun and joyfulhaving a lot of noisenot doing any activitywith a lot of things to doinsects with colorful wingswhat you do in your spare timeliking to be with other people

Health Careers Offered Through West Kentucky Community and Technical College 2014-06-06

14 Items: diagnosticmedicalcoderphlebotomistdentalassistantdentalhygienistregisterednursemedicalsecretarynursingassistantmedicalsonographerpharmacytechniciansurgicaltechnologistradiologictechnologistlicensedpracticalnursephysicaltherapyassistant

D&S WORD SEARCH 2023-03-07

25 Items: Brachialan artificial limbopposite of flexioncrippling arthritismedical term for fartfree from contaminationverbal threat to cause harma microbe that causes diseasethe side not affected by strokeviolence that occurs in the homeosteo is one form of this diseasea brain disorder that causes seizuresthis health care provides comfort care...

Success Coach Terminology 2023-08-30

85 Items: addtsipossapfticpeakdropfallflexcoredeanbasecleppivottermsmajorcoachauditaleksemailbucketdegreespringsummercampuslecroyhealthyammercreditreadmitcatalogpaymentsuccessnursingecampusclassesoverloadcaseloadsemesternavigateadvisingtransferstudentsassignedrichlandelcentroemeritusguidanceeconnectplanningcognizantallegedlydismissalfinancialeastfield...

Unit 13 2024-03-06

12 Items: to keep safeto show clearlydull as a resultdone successfullycloser to the endto get as ones ownto lie or to sit downa discussion of reasonshaving to do with healthhappening in many placesone who hates or tries to harmthe cruel killing of many people or animals

Word Revision 単語復習 2023-02-06

22 Items: 深い健康仕事騒音警察規則記号腹痛伝える危険な落とす乾いた看護師事務所年上の単純な決心する想像する約束する幅が広い値段が高い

Essential Guide: Mastering Wound Care for the Elderly's Health and Well-beingWoundCareElderlyAgingInjuriesPreventionFirst AidCleanAntibioticChronicDiabetesPressureSignsInfectionSwollenFeverImportanceComplicationsOptimal 2024-04-25

20 Items: Aidcarewoundagingcleansignsfeverelderlychronicswollenoptimalinjuriesdiabetespressureinfectionpreventionantibioticimportanceprofessionalcomplications

chapter 6 2023-05-22

40 Items: sadcalmlazycoldpainhappyangrytiredfevercoughpulsenurseenergypolitehealthstressdoctorannoyednervousconductmannersdynamicpatientto openbehaviorpancientstubbornpleasantheadachedepressedenergeticinpatiententhusiasmpersonalityopen-mindedsore throuthard-workingin a bad moodstomache achedoctors office

Lesson D Reading Word Search 2023-11-15

16 Items: the action or practice of meditating.the accomplishment of an aim or purpose.a feeling of worry, nervousness, or unease.the state of being free from injury or illness.the state of being comfortable, healthy, or happy.focus a persons attention on a particular activity.to have optimistic, affirmative, and good feelings....

CMHA 2024 Word Search 2024-04-26

102 Items: joycalmcarefawnfearlifemindangerbrainfightgriefguilthappyissuemusicpowershamesleeptiredwaterworryafraidenergyfamilyflightfreezehealthmentalnaturephobiaregretscaredserenestigmaanxiousbalancebenefitburnoutcomfortcontentexcitedfriendsillnessnervouspleasedproblemreadingrelaxedrespectroutinesadnesssuccesssupporttalkingtherapywalkingattitudecapacity...

ANTONYMS 2014-12-14

103 Items: buywetlowfarnewrawnonedullidlecoldwesteasydeadcomegoodsoftthinfindshowmissrudesoftrichfalltamechildawakebeginworsecursewhitedirtynightearlyemptyenemyhappyfreshfirstnevergiantfrontdepththerewaterleastoutersobernoisyroughurbanfalselearnsmileabsentrejectactivedepartattackbeforerevealsafetylatterfuturehealthvalleyexhalesorrowseniordivideliquorborrow...

Stage 20 Culture Review 2023-05-11

23 Items: nikenikenikepseudo-sciencefather of medicinecenter of learninggreat griffin golfergreat griffin runnermade first water-clockAlexandrian astronomermade first steam turbinewrote a geometry textbookmeasured the circumferencefamous 20th century doctorfamous 20th century authorRoman contribution to healthtitle of first geometry textbook...

Sabah Oxygen - P1TA18 2024-07-08

102 Items: tophoseventtesttripzeroworkareadownlevelicingtopupnightshiftinertentryvalveplantspacesmokephonespeedlimitalarmcraneshoesupdateonlinebypassliquidbottomweightdialogvacuumoxygenhealthsafetyleaderpermitenergyheightsourcemobileglovesofflineisotankstandbymorningpurgingreactorstartupprocessdrivingvehicleprojecttoolboxliftingcoolingglassesleathernitrogen...

World Literacy Day 2022 2022-09-01

12 Items: PE is an exampleMath is an exampleMusic is an exampleThe sciences are examplesEconomics & Business are examplesPsychology and Islamic are examplesEnglish and world languages are examplesJournalism and Film Studies are examplesCreative Writing and English are examplesthe ability to communicate in varying contexts...

Shannonstrange Word Search 2023-06-22

99 Items: msgfdaalt317326319frmsosprdled3859botoxjapanbadgeindiadonuthippaswirlbatchbmramrigidcrackemptymrnobuauditssnacksinvertliquidopaquealtheaclienthybridjobaiddefectbrokenhealthjohnleegermanykimtechproductlowfillsareptalockersplacardsshutdownnewhiresperiodicatypicalmedicinemeltbackhazardousrejectboxdropgaugeclearanceprojectidbiopharmasteeltoeshazardous...

Vocab 10 2023-10-23

11 Items: footto sharpengreat sufferingcause of unhappinesscome together as one unita total or humiliating defeatto defraud or swindle; to cheatinjurious to health or morals; poisonousto increase the severity of; to aggravateone who is intolerant especially in matters of religion, race, or politics; racist...

Heidi 2024-06-10

12 Items: to like: __________being bad: __________the lowest part: __________having good health: __________to go into a place: __________a large, grand house: __________not being able to see: __________a chair for people who can't walk: __________Peter pushed the wheelchair down the __________.Heidi's grandfather had two __________ that gave him milk....

Unit 17 Word Search 2024-03-05

12 Items: causing damage, harmful.cheerful and full of life.supporting one another’s life.in a dying or death like state.to preserve in the memory foreverable to be broken down naturally.harmful to physical or moral health.causing the death of living organismsto cause the extreme embarrassment to.the act or process of bring back to life....

EXPLORING THE ALLIED HEALTH COMPETENCY MODEL 2023-08-21

4 Items: recordkeepingindustrycompetency

Translucent Word Search 2023-03-14

100 Items: translucentunderservedsuitabilityinquisitiveegalitarianorchestratecombinationinsensitivetwo-bedroomstand-aloneculminationcontentiousuncertaintyappointmentincrementalgrasshopperbelligerentdemocratizesalespeopleforeseeableconsecutiveinformationinstitutionawkwardnessfluctuationproliferatenervousnessattitudinalrespirationsubordinatememorabilia...

Open Enrollment 2022-10-03

11 Items: dental plan providerRetirement departmentvision plan provider abbreviationHealth Savings Account Abbreviationoptional benefits like pet insuranceThe new medical plan provider for 2023Flexible Spending Account AbbreviationDiscount provider for wellness discountsWhere you log in to review/change your benefits...

SAGE Diversion 2016-04-20

110 Items: ArtMathLabsTextDeskSageLateBandFireNounVerbPoemsPaperLunchFieldTripsChairBenchTardystartDanceChoirdrillStudyFlashcardsclaimSimileSocialHealthSchoolBreaksSportsLockerBussesIdiomsGradesClaimsAdverbTestingReadingScienceWritingStoriesQuizzesHistoryStudiesPencilsGrammarFriendsLibraryCoachesJanitorFacultyCarpoolCounterLanguageMetaphorPrefixesSuffixes...

Mysteries and Investigations 2022-10-19

24 Items: lowlyaboutsectionsomewhatrecordedpanickedcompletepresent daylooking afterpeople in chargelet out blood fromarea under controlhung in one positionstayed close togetherin direct contact withperson serving militaryone-celled living thingstowns without people leftspoke without making sensesubstance that kills germswidespread attack of a disease...

AH Word Search #1 2023-05-11

2 Items: What is the abbreviation for Online Health?What phone status should be less than 5 minutes?

CPPI Team Building June 2023 2023-06-27

12 Items: (USDA Innovation Hub)(Diabetes Prevention Program)(One of IPHI’s 3 centers of work)(One of IPHI’s 3 centers of work)(One of IPHI’s 3 centers of work)(Illinois Public Health Institute)(Building Resilient and Inclusive Communities)(State Physical Activity and Nutrition program)(Coalition founded, managed and staffed by IPHI with a new name)...

Unit 18 2024-03-05

12 Items: causing damage, harmfulcheerful and full of lifein a dying or death like stateable to be broken down naturallyto preserve in the memory foreverharmful to physical or moral healthto cause the extreme embarrassment tothe act or process of bring back to lifetaking an unhealthy interest in unpleasant things...

Epidemiology - Topic 4 2023-01-27

8 Items: Type of observational study designDoes it has comparison group? (T/F)A type of observational study designUsed to identify the c_____ of diseaseInvolving designing a study to test one or more h____Any factor that might influence the risk of disease (E____)Analytical epidemiology addresses "w___" a health problem occurs...

Infection Control 2022-11-02

20 Items: To dispose ofSafety Data SheetAn item that is reusableAn item that is disposableAmount of time to disinfectQuaternary Ammonium CompoundsThe ability to produce resultsEnvironmental Protection AgencyThe transfer of harmful bacteriaCaused by streptococcus bacteriaCan be used again and disinfectedKills certain pathogens on surfaces...

Elderly Athletes 2022-10-17

10 Items: the limit does notAssessment tool for all agestype of exercise to do post THAreduced 30-35% with physical activitydeclines with age due to age-related changesinherited abilities and resistance to injuriesan easy way to measure physical activity levelfactor that includes having a strong mentalityaging adults were told to "act their age" aka be...

Unit 17- Word Search 2023-02-21

12 Items: Causing damage, harmfulCheerful and full of lifeIn a dying or death like stateAble to be broken down naturallyTo preserve in the memory foreverHarmful to physical or moral healthTo cause the extreme embarrassment toThe act or process of bring back to lifeTaking an unhealthy interest in unpleasant things...

Unit 17 2023-02-23

12 Items: Causing damage, harmfulCheerful and full of lifeIn a dying or death like stateTo cause extreme embarresment toAble to be broken down naturallyTo preserve in the memory foreverHarmful to physical or moral healthTaking an unhealthy intrest in unpleasent thingsMutualy beneficial, supporting one anothers life...

Health Related Components and Skill-Related in Physical Fitness 2023-09-12

6 Items: catlionzebrahippoelephantMan's best friend

AmeriHealth Word Search #1 2023-06-03

25 Items: What does CE stand for?What LOB do you transfer?What LOB is Keystone First?What is the UCCF form called?What info can you find in Davis?What info can you find in Skygen?Where do you go to request a 1:1?What is the PA State System called?What call status should be under 5 mins?What system do you use to verify a member?...

PhT 100 Word Search 1 (Spring 2024) 2024-05-09

17 Items: To grind to a smooth substance with moisture.The basic unit of weight in the apothecary system.The dating of any medication that has a short shelf life.The liquid in which another substance is being dissolved.The determination of the covererage an insured is entitled.Complete destruction of organisms after they leave the body....

Insurance and Mail facilities 2023-09-03

10 Items: Direct advertisingRemittance of moneyA range of delightful cardsSafeguard against rising medical costProvide measure of financial support to farmersEffective vehicle for indian corporate to advertise brandReliable delivery ensuring your packages reach destination quicklySum of money is secured to the assured in even of death of bulls cows...

Cyber Security Awareness Month 2022-09-22

10 Items: The law that protects PHIAlways keep this a secretProtected Health InformationAlways ____ before you ____.Never download any unapproved __________.______ error is the most exploited by criminalsAlways report these devices to your supervisor or IT departmentAn attempt by criminals to get you to click a link or attachment in an email...

Executive Departments Word Search 2023-01-26

15 Items: farms and food safetythe U.S. armed forcesthe nation's public landsworkers and workplace safetycollecting taxes printing moneyrelationships with other countriestrade and helping promote businessesfuel and electricity; nuclear weaponshighway safety and air, rail, and sea travelpublic security and safety in the U.S. homeland...

Leadership Values 2022-11-22

117 Items: funjoybackhomehopelovetimefaithgracehumororderpeacepowerpridetrusttruthbeautycareercaringethicsfamilygrowthhealthlegacynaturesafetythrifttravelvisionwealthwisdombalancecouragedignityfreedomharmonyhonestyjusticeleisureloyaltyrespect-takingservicesuccessaltruismambitionthe bestequalityfairnesshumilitysecuritykindnesslearningopennessoptimismpatience...

ww4 u10 2024-06-10

22 Items: comfortvery steepto get backin poor healthto kill violentlybad luck, troublea sign of somethingpleasing, agreeablean illness; a diseasea very high and steep cliffto make less sad; to comfortto shrink from, as if in fearto wish for, to want very mucha child whose parents are deadthe means of supporting oneselfwilling to speak; eager to talk...

Mystic Messages 2024-04-23

131 Items: joylawfuneyejobloveluckgifthelphomeideaflowresthopeglowgoalpastfameeasewishsafeworkmoneytrusthobbytreatdreampeacesharemediacareerspiritangelschangechancetravelfamilymagickbeautyhealthgrowthfuturemysticwisdommentorwealthswitchjusticehealingcleansepsychicsuccessromanceprojectloyaltymessagevictoryrebirthpresentsupportfortunebalanceharmonypurpose...

Galen Faculty Word Search 2024-06-28

14 Items: Dean of FAST.The newest dean.Dean of Business.Email him if you can't access Moodle.Very knowledgeable on indigenous rights.Environmental science students know her well.She has a long history and experience in tourism.He's another tourism teacher with vast experience.He's criminal justice students' favorite lecturer....

Disinfection Word Search 2023-01-14

20 Items: the action of making something clean.a chemical liquid that destroys bacteria.intended or suitable for more than once use.(staph) a bacterium with antibiotic resistance.smooth and sealed so liquid and air cannot move.get rid of something as no longer useful or desirable.designed to be used once and then disposed of or destroyed....

POSTIES 0115 COVER 2023-12-15

6 Items: how hot or cold something isa place that protects you from bad weather or dangerheat, energy, etc. that is sent out in the form of raysa substance that consists of very small fine grains of rockcausing damage or injury to someone, especially to their health...

Chemistry: State Changes 2024-01-25

14 Items: A solid, liquid or gas (5)Going from solid to gas (11)Going from gas to solid (10)Going from gas to liquid (10)Going from liquid to solid (8)Going from solid to liquid (7)How easily something reacts (10)How tightly packed particles are (7)How harmful something is to our health (8)A white solid that goes from solid to gas (6)...

Pollution 2024-05-24

11 Items: C---- means not dirty. _________The l--- is an area of ground. _______A-- is a gas living things breathe. ________The g----- is the surface of the earth. __________T---- are unwanted things to be thrown away. ________To make a d-------- is to make a choice. _____________W---- is a clear liquid that all living things need. ________...

WW5 U12 2024-07-08

20 Items: a limitto piercestormy, wildnot often; rarelyto make more activeto make angry or annoyto give orders; to commandto keep within certain limitsto set aside for a certain purposefighting against another's controldeserving of attention; outstandingcoming later than expected or neededopen opposition to another's control...

Networking Chapter 13 Terminology 2023-05-15

31 Items: Using more than one method to authenticate users.Updates for other Microsoft products like Office.Use this command on a linux system to create a user account.This authentication type uses the unique way you do something.Non-Microsoft driver updates that are applicable to users' devices....

Culture, Word Search 2022-11-04

1 Item: health, diverse, beliefs, tradition, music, celebrate, language, values, harmony

The Messy Birthday Gift 2024-01-22

20 Items: - missing amongst the masses- iruppadhai koduppadhe idhuve- most wanted from todays rough youth- are you always calm and __________ ?- Touch me not plants show this nature- just keep trying till you pass it off- rarely found in social media forwards- this passion is more humane than any other- you will love the final outcome of this act...

Lifescan Meter Review 2022-10-05

7 Items: What is a product still in production called?The FTDI cable is used by what family of meter?How many batteries are need for the Ultra 2 meter?What type of Battery is used for the Verio Flex and Verio Reflect?The Ultra Smart, no longer in production, is classified as what type of product?...

ww4 u10 2024-06-07

14 Items: What _______ you?The knight ______ the dragon.What is the _________ of the lake?What are the ________ you are experiencing today?The dog _______ from the sound of the vacuum cleaner.It is kind to __________ your friend if they are sad.It is important to ______________ well in a friendship.The king decided to _________ the thief from the Kingdom....

unit 11 2024-05-01

16 Items: best measure for water quality87% of freshwater is located herestage of treatment that separates solidsstage of treatment that removes nutrientsdischarge pollution from a specific locationan area that can hold water in soil particlesalong coastlines saltwater can move into aquifersUnderground tank contains wastewater from the house...

Vocab 13 2024-03-19

12 Items: every morning I __ and go to school.Playing soccer is _____ on my health.If one person wins a raffle they have ____.Twins are ____ because they're the same age.From my _____ the man was guilty for his crime.After i got my gum stuck in my hair it was _____.After i brush my teeth I _______ take a shower afterwards....

Vocab 13 2024-03-19

12 Items: every morning I __ and go to school.Playing soccer is _____ on my health.If one person wins a raffle they have ____.Twins are ____ because they're the same age.From my _____ the man was guilty for his crime.After i got my gum stuck in my hair it was _____.After i brush my teeth I _______ take a shower afterwards....

December Word Search 2022-12-11

11 Items: februariusThis emperor created the Julian calendar.Most New Year’s festivities begin on _______ 31.This is the popular song for ringing in the new year.Bang on these kitchen items to make noise at midnight!square Thousands gather here in New York to watch the ball drop.Make this vow to improve yourself and stay positive in the new year!...

Word Search (Health) 2022-07-16

1 Item: hair, menarche, fallopian, uterus, ovary, period, reproductive, exercise, cramps

TERMS TO KNOW WHEN BUYING A HORSE 2024-01-18

11 Items: Horse is not yet trained to be ridden.Injury that affects the horse’s movement or health.Horse runs off suddenly and will not respond to aids.Standard measurement unit of height (1 hand = 4 inches).No injuries that prevent the horse from regular performance.Horse equipment used to ride, drive, or care for your animal....

Today's Vocabulary 2022-11-23

8 Items: A particular smell.Sore, red, and swollen from disease, injury, etc.A stitch or a series of stitches used to close a cut or wound.An injury that is caused when a knife, bullet, etc., cuts or breaks the skin.A serious disease that is passed from one person to another in dirty food or water....

Health and PE 2023-12-01

1 Item: Fitness, Active, Lifestyle, Diet, Energy, Stamina, Motivation, Discipline, Sports, Recreation, Leisure, Aerobics, Anaerobic, Wellness, Hygiene, Stress, Relaxation, Mindfulness, Meditation, Psychology, Performance, Goal-setting, Achievement, Health

Fever 1793 2023-03-23

20 Items: The cat's nameThe author's last nameGrandfather's mouth parrotMattie's partner at the coffeehouseMattie dreams of visiting here some day.He organized the society from question 18.Stephen ___ turns Bush Hill into a safe hospital.It kills off the mosquitoes and the yellow fever.Eliza's brother who lost his wife to yellow fever....

NMSI World Environment Day 2024 2024-06-04

10 Items: The process by which fertile land becomes desert.This country is aiming to plant 20 million trees annually.These events are responsible for 60% of worldwide crop loss.The multi-national body who have led world environment day since 1974.Soil fertility has reduced by 60% due to land degradation in this country....

Epidemiology Topic 3 2023-01-28

12 Items: S____ maps show locations of individual cases.Descriptive epidemiology enables development of testable h__________.Cross-sectional allows measure of the p________ of something(e.g. a disease).Descriptive epidemiology provides information useful for a_________ of resources....

NMSI World Environment Day 2024 2024-05-09

10 Items: The process by which fertile land becomes desert.This country is aiming to plant 20 million trees annually.These events are responsible for 60% of worldwide crop loss.The multi-national body who have led world environment day since 1974.Soil fertility has reduced by 60% due to land degradation in this country....

PTE STANDARD ONE 2023-03-30

1 Item: Governance, Interprofessional, interview, hiring, voice, together, ethical, concern, community, health, technology, teammate, peach, pathway, excellence, standards, Nursing, Practice, involvement

Food Groups 2022-10-01

1 Item: Carbohydrates Carrot diet Eggs Fats Food Fruits Health Legumes Malnutrition Meal Menu Nutrients Nutrition Nuts Oils Orange Protein Staples Vegetables

Paraprofessional Team Building 2022-11-29

14 Items: code for a medical emergency (BLUE)the female external catheter (VERSETTE)common name for the urinary catheter (FOLEY)acronym used to identify signs of a STROKE (BEFAST)the type of bath that is secondary to regular bath (CHG)machine used to help prevent blood clots in a patient's legs (SCD)...

Brain Health Word Search 2024-03-21

1 Item: Cortex, Macromolecules, Neurotransmitters, Cerebellum, Temporal Lobe, Hippocampus, Occipital Lobe, Biomolecules, Parietal Lobe, Frontal Lobe, Neurons, Cognitive, Fatty Acids, Vitamin D, Vitamin B, Amino Acid, Amygdala, Anatomy, Omega, Protein, Lutein, Mem

Core Values 2023-08-04

222 Items: funjoycalmworkhopeloveriskclearsensedrivefocusgracehonorlogicorderpeacepoisepowerrigorskillsmarttrusttruthunityvalorvigorbeautycandorcleverenergyfamilyfamousgeniusgivinggrowthhealthlawfulreasonspiritstatustalentvisionwealthwisdomwonderbalancebraverycapablecarefulcharitycomfortcontrolcouragedignityempathyempowerethicalfreedomharmonyhonestyjustice...