health and wellness Word Searches

Time and the Faraway Mountain Word Search 2024-07-14

10 Items: portersanxiousresolvewondroushypnoticdisguisedtechniqueexpeditioncoordinatordetermination

Paul, Called to Serve Together with Other Brothers and Sisters 2022-03-06

20 Items: paullukemarkhelpservesilaslearnworkedaquilajustussimeontimothywillingtogetherbarnabastychicusphilemonpriscillacoorperationepaphroditus

International Day of Sport for Development and Peace (April 6) 2023-11-13

20 Items: judorugbydefeatfutsalrowingsquasharcheryrefereesnookervictorychampionteamworkathleticsdecathlonendurancespectatorwrestlinggymnasticspentathloncompetition

Clarifying Who We are and What We Want to Achieve 2024-02-14

30 Items: coregoalsstoryfocusvalueschangeevolvedefinedependachievehistorydevelopdeliverresultsclaritystrategybrandingteamworkintranetextranetintegritycustomersstatementbehaviorsempowermentopportunitiescollaborationcommunicationsresponsibilitycharacteristics

The Phoenix's Fiery Rebirth: A Symbol of Renewal and PerseverancePhoenixRebirthLegendAshesNestFireStoryInspiredSymbolRenewal 2024-04-11

20 Items: toyartnestfirehopeashesstorylegendsymbolphoenixrebirthrenewalcomfortparentscultureinspiredincredibleliteratureperseverancetransformation

FRIENDSHIP by homer and aggelos. 2023-03-09

6 Items: catlionzebrahippoelephantMan's best friend

Regan's Waves Word Search 2022-11-28

8 Items: highest point on a wavelocations of maximum displacementmeasurement of maximum displacementdistance of one complete wave cyclewhich moves the medium parallel to wave motionwave which moves perpendicular to the wave motionthe more compressed and spread out the wave becomesin a longitudinal wave, areas of maximum displacement are known as

Disparate Word Search 2023-12-11

10 Items: Most noticeable or importantLasting for a very short timeLasting for a very short timeA very large or countless numberand cheerful readiness or eagernessA harsh, discordant mixture of soundsUsing or expressed in more words than are neededEssentially different in kind; not allowing comparisonEssentially different in kind; not allowing comparison...

Mystic Messages 2024-04-23

131 Items: joylawfuneyejobloveluckgifthelphomeideaflowresthopeglowgoalpastfameeasewishsafeworkmoneytrusthobbytreatdreampeacesharemediacareerspiritangelschangechancetravelfamilymagickbeautyhealthgrowthfuturemysticwisdommentorwealthswitchjusticehealingcleansepsychicsuccessromanceprojectloyaltymessagevictoryrebirthpresentsupportfortunebalanceharmonypurpose...

Application Management 2023-03-29

26 Items: You use this option to check and fix an applications files.This is the name of the application store for android devices.A program that installs applications, software, or drivers onto a system.This folder stores 64-bit files, while Program Files (x86) keeps 32-bit files....

Unit 3 Vocabulary Word Search 2023-10-04

14 Items: number of protons in the nucleus of an atomuncharged, subatomic particle located in the nucleusunit of mass equal to 1⁄12 of the mass of a 12C atomaverage mass of atoms of an element, expressed in amuthe lowest energy state of an atom or other particle.positively charged subatomic particle located in the nucleus...

Christmastree Word Search 2023-11-14

3 Items: thing you put on top od the treethe man who brings presents to kidsthe tree you decorate with lights and ornaments.

Pencilcase Word Search 2023-05-24

8 Items: Used to write.Used to play football.Used to erase any errors.Used to charge any type of device.Used to store any type of school material.Used to store books, notebooks or other things.Used to communicate and interact or at'e to work.They are suitable for anyone with any type of visual problem.

Plastic: Here to stay? 2022-10-10

9 Items: capable of being made newA place where trash is buried or placed on top of the groundTo make something new from something that has been used beforepolymers that are produced by or derived from living organismsnot capable of being broken down by the action of living organisms...

ER Wait Times 2023-11-25

10 Items: Nursing __________ leads to lesser ED wait times.What is the most important aspect of interdisciplinary care?What is the system used for determining urgency of condition?What is the review process hospitals undergo through The Joint Commission?What is the abbreviated term for patients who leave the ED before being treated?...

Connecting Input and Output Devices To The Computer 2023-11-02

9 Items: Wireless communicationStands for Universal Serial BusUsed to connect peripherals to PCPeripheral component interconnectTo add more components to a computerPeripheral component interconnect expressUsed to connect devices to local area networksCan send and receive multiple bits of informationCan only send or receive one bit of information at a time

halloween 10 2023-10-08

10 Items: - The opposite of light- The time when the sun sets- What wizards and witches do- A magical creature with wings- A famous vampire in literature- Another word for spooky or creepy- A monster that likes to scare people- What happens to metal when it gets old- A gooey substance that's fun to play with- The opposite of good, often describes villains

Thermal Equilibrium 2023-11-08

10 Items: The sameslightly hotterslightly colderRelating to heatthe ability to do workmove from one place to anothera material thing that can be seen and toucheda particular kind of matter with uniform propertiesA state in which opposing forces or influences are balancedthe degree or intensity of heat present in a substance or object

Things in the Classroom 2024-03-20

10 Items: used for sittingused for cutting paperused to measure lengthused to sharpen pencilsused for write somethingused for writing on white boardused to write in front of the classused to see the location of an areaused to put things and place to writesmall world map depicting the shape of the earth

Kings year 6 week, 5, 6 and 7 focus words 2023-03-29

35 Items: adoptimageexistrecipeinsectaccessexceptacceptdecadehinderadviceadvisedesignguiltylistensectionsuccesscenturyresponddiamonddeliverincludelibertyenglishestimateevidenceemphasismedicinedaughterdefinitebuildinginnocentnecessaryinterpretcentimetre

BENJAMIN AND THE SILVER CUP GEN. 43:15 - 45:15 2023-05-22

24 Items: cupevilgoldgrainsacksmouthgiftsdawnedrepaidwickedcanaansilverjosephattackfatherstewardstewarddonkeystreasureslaughteroverpowerdivinationfrightenedresponsible

International Day of Sport for Development and Peace (April 6) 2023-12-07

20 Items: judorugbydefeatfutsalrowingsquasharcheryrefereesnookervictorychampionteamworkathleticsdecathlonendurancespectatorwrestlinggymnasticspentathloncompetition

Nuclear Power: A Cleaner, Reliable, and Fuel-Efficient Energy SolutionNuclearPowerEnergyElectricityCleanPollutionUraniumFuelReliableCoalOilGasConcernsWasteSafetyEnvironmentClimateResourceAccidents 2024-04-14

20 Items: oilgasfuelcoalpowercleanwasteenergysafetyfuturenuclearuraniumclimatereliableconcernsresourcepollutionaccidentselectricityenvironment

Air, Atmospheric Pressure, and Temperature 5/3/2021 2021-05-03

12 Items: GasWaterEnergyLiquidVolumeDensityDecreaseIncreaseCylinderMolecularGraduatedTemperature

Air and Space Travel K-2 Word search 2022-11-07

12 Items: flyskyairjetsoarwingsspacerocketairplanespaceshiphelicopterhotairballoon

Capitulo Ocho A - Preterite -ir and -er verbs 2023-04-03

12 Items: The verb "to learn"The verb "to go out"Salir conjugated in the "yo" formSalir conjugated in the "Tú" formAprender conjugated in the "yo" formAprender conjugated in the "Tú" formSalir conjugated in the "usted" formSalir conjugated in the "ustedes" formAprender conjugated in the "usted" formSalir conjugated in the "nosotros" form...

Mundane Word Search 2023-12-09

10 Items: To leave out or excludeExtremely large or extensiveCalm, peaceful, and untroubledHaving or showing tact; diplomaticLacking interest or excitement; dullTo think deeply or consider carefullyAttractively unusual or old-fashionedPresent, appearing, or found everywhereTo move back or away from a point or limit...

AT HOME AND PRONOUNS I, YOU HE, SHE 2016-02-12

12 Items: iheyoushehousegaragegardenkitchenbedroombathroomlivingroomdiningroom

Spelling Fun with d, dr, g and gr 2023-02-20

12 Items: gabgetgotdabdipdotgrabgrubdrabdripdropgrits

The Biometric Body and Biometric are Not Better 2024-01-29

13 Items: claimclaimthesiscentralaudiencecitationsreferencesprespositionargumentativeessayprespositionphraseinformationalarticleorganizationalpatternsobjectofthepreposition

Theme 1 ( The Brightest and Best) Vocabulary 11B 2024-02-18

12 Items: N: sportsmanADJ: honored / respectedADJ: attractive / gracefulADJ: astonishing / impressiveN: people who design building.best achievements in the world.known throughout many countries.The world's most famous sporting event.N: a fall of water usually from a great height.V: try to be better then others participating in a competition....

The best Word Search because Joseph made it 2022-11-28

10 Items: Lowest part of a waveThe highest part of a waveWhat frequency is measured inThe distance from crest to crestdistance between crest and troughMaximum displacement in a longitudinal waveMaximum displacement in a longitudinal waveWave motion that is parallel to wave directionNumber of waves or vibrations produced per second...

Latin America Word search 2023-01-06

9 Items: A canal was made herea country in South AmericaProduces more than demandedRica, An island in the Caribbeanthe largest country in South Americato change yourself to an environment.the most southern country in North AmericaThe second largest country in South Americaa group of 33 countries in North and South America

Chapter 15 Vocab Word Search 2024-03-21

11 Items: A solution of known concentrationA compound whose color is sensitive to pH.The point at which an indicator changes color.The pH range over which an indicator changes color.The negative of the common logarithm of the hydronium ion concentration.The negative of the common logarithm of the hydroxide ion concentration....

Leahs space themed word sherch 2023-12-18

10 Items: The start of springPeople that study spaceAlso known as Urisa minorAlso known as Urisa majourStars that make shapes in the skygive off, send forth,or dischargeThe reserch of eveything in the universeThe beliefs of the position of the starsmeans the sortist day of winter solsticeDust and ice particals that orbit the sun

Astronomy Word Search 2023-12-18

6 Items: study and belief in the zodiacspilots or works in a space crafta group of stars that make a shapethe study of everything in the universepasses gas when orbiting close to the sunlarge shape with seven stars of Ursa major

Music class 2024-02-21

4 Items: A street with 51 theaters on itA place where a play is performedAnnie, Rent, and Singing in the Rainis a play that is preformed 12,000 times

6th grade Unit 3 Week 1: Lizzie Bright and the Buckminster Boy 2024-01-31

8 Items: took an indirect coursestirred from sleep or resta very great size or extentin a manner lacking strengtha hard choice to make between two or more thingsto call upon for specific action; to ask to comecontinuing firmly and steadily despite challengesfall back under pressure or shock; moved away quickly

Biochem - Diabetic Nephropathy 2024-03-27

8 Items: ERK1/2, p38, JNKConverts ROS to waterType of receptors AT1R and AT2R areConverts angiotensinogen to angiotensin ICytosolic tyrosine kinases that activate STATForm dimers (SIS inducing factor complexes [SIF])Main protein used in the second process of ROS productionProtein normally found in blood, presence in urine indicates kidney problem

Unit 11 2022-11-28

12 Items: A minor official.Unbeatable, resilient.To swear off, renounce.Forcing others to obey.Breaking of a legal oath.Having to do with the law.Being most evident or apparent.To give credit or recognition to.Group of the most welthy and priveleged.To bring forth, especially through words.A government by a religiuos leader or figure....

Unit 15 Word Search 2023-02-03

12 Items: An answer, a reply.To give away, share.Accurate, indefinite.Prevent from happening.Unable to make choices.Having no basis or favor.To command, to urge; to forbid.Containing all, not keeping any out.Providing no clear answer or solution.An order which legally prevents something.A cut made in order to get inside something....

Perjury Word Search 2023-12-11

12 Items: a minor officialunbeatable, resilientto swear off, renounceforcing others to obeybreaking of a legal oathhaving to do with the lawbeing most evident or apparentto give credit or recognition toto bring forth, especially through wordsgroup of the most wealthy and privilegeda government by a religious leader or figure...

UNIT 16 2024-02-01

12 Items: rough likeness.to make hostile.to mimic, imitate.a fight or dispute.a change or modificationnot able to be taken away.symbolic rather than literalchange in form, transformation.to conceal the truth, to deceive.a name that is not one’s true nameto go back and forth, change from one thing to another....

Jacob's Word Search 2015-02-07

96 Items: AmAsAxBeGoIsItOhTvUpWeAndAntBagBeeBenCanCarCatDadDanDogFanFigFinForFoxHamHatHenLetMadManMomOffPotRugSadTabTheVanWonZooBedsCrowDirtDiveDuckEvenFastFishFlatFoodiPadLegoLionMadeRaceRockSackSandShipShowSledSnowSockThatWereWhenAppleBeastCraneEagleHandyMagicNeedsOceanPowerQuackQuestQuillQuiltSmileStickStingTruckWaterAlwaysBananaBusterElevenHeroesStrong...

Buenosdias Word Search 2023-09-10

37 Items: SirEyeArmLegMissgoodOkayHeadNoseHandFootZeroNineHelloMadamMouthPleaseFingerAnd youNothingSee youStomachGood byedelightedlike wiseThank youMy name isgoodmorninggoodeveningHow are youSee you tmrgoodafternoonSee you laterWhat's going onWhat's happeningwhat is your namepleased to meat you

How Well Do You Know Your Model A #3? 2023-12-29

20 Items: big truck55 ft.lb. 75 Nmwith cowl lightsmost common color___________ groundstation wagon bodytouring meal breakshift pattern centerhard side truck body.035 spark plug ______type of hinge in the hood4.3 _______________ ratio35 PSI tire _____________luggage for train and car1-2-4-3 firing ___________keeps the Model A running smoothly...

100 most common words 2024-03-30

100 Items: aiasatbebydogoheifinitmemynoofonorsotoupweallandbutcandayforgetherhimhishowitsmannewnotnowoneouroutsayseeshethetwousewaywhoyoualsocomeevenfindfromgivehavehereintojustknowlikelookmakemanymoreonlysometaketellthanthatthemthentheythistimeverywantwellwhatwhenwillwithyearyouraboutcouldfirstothertheirtherethesethingthinkthosewhichwouldpeoplebecause

Unit 11 2022-11-28

12 Items: A minor official.Unbeatable, resilient.To swear off, renounce.Forcing others to obey.Breaking of a legal oath.Having to do with the law.Being most evident or apparent.To give credit or recognition to.Group of the most welthy and priveleged.To bring forth, especially through words.A government by a religiuos leader or figure....

Unit 11 2022-11-28

12 Items: A minor official.Unbeatable, resilient.To swear off, renounce.Forcing others to obey.Breaking of a legal oath.Having to do with the law.Being most evident or apparent.To give credit or recognition to.Group of the most welthy and priveleged.To bring forth, especially through words.A government by a religiuos leader or figure....

Argumentative Texts 2024-01-03

11 Items: The sourceUsed to support the claimWho the writer is talking toAuthor's position on an topicMakes an emotional connectionAnother word for counterargumentHow the author feels about a subjectArgues against the author's main claimThe author's purpose of an argumentative textLogic, statistics, facts, it just makes sense...

Artists of the 40’s, 50’s and 60’s 2023-05-21

35 Items: thewhobbkingsantanabobdylanthedoorsbenekingdominoestomjonespeggyleedorisdaybingcrosbychuckberryroyorbisonthebeatlesjamesbrownraycharlesmarvingayethemonkeestheanimalstinaturnertheholliesfatsdominonatkingcolethesupremesledzeppelinjanisjoplinvanmorrisonfranksinatraelvispresleythebeachboyssteviewondermillsbrothersarethafranklinthejacksonfive...

SPELLING WORD SEARCH - WORDS WITH SOFT C AND SOFT G  2017-11-29

20 Items: oncescenespiceouncegermsbadgewedgecentercircuscementpoliceglancebridgeorangegingerspongecertainstrangearrangevillage

The mouse and The motorcycle by:Brennan McCoy,Dylan Wilde 2015-10-14

15 Items: boyholeRalphKeithhotelmouseenginevacuumfamilysearchaspirinanxioustrashcanadventuremotorcycle

Spelling: Boy Tales of CHildhood and A defenseless creature 2015-11-09

15 Items: goutclenchrublesswoonscauldronpetitionelaborateloathsomemalignantcomposurerackinglyapoplecticflourishingprovocationincapacitated

Protists and Fungi/Chapter 8, Page 262/Mr. Elmore 2017-04-26

15 Items: algaeciliaascusdiatomamoebahyphaelichenprotistmyceliumbasidiumprotozoanpseudopodparameciummycorrhizaezygosporangia

The chaotic world of words 2024-06-29

8 Items: பாவ விமோசனம்எந்நேரமும் ஒரு கைதி காணும் கனவுநோயாளிகளுக்கு இது தானே சொர்க்கம்zoo விலங்குகள் ஏங்கி ஏங்கி கேட்பதுபிள்ளைகளுக்கு பெற்றோர் தரவேண்டிய சிறந்த பரிசுஇந்த நகர முடியாத சிலை சுதந்திரம் பத்தி பேசுதாம்உண்பது உறங்குவது உரவாடுவது உரையாடுவது ஊர் வலம் வருவது உணர்வது...

Dog Word Search 2024-08-19

3 Items: an animal that goes woofa small feral animal that rhymes with hata yummy food that is cold and rhymes with dream

FRAM 2023-02-03

5 Items: military forbearanceCan take _______ if they want to pay_______ duty, veterans, and all military person may applyalways _______ to military department unless they have already spoke to themtreat as a _______ call, if they have previously talked to military department

Drama 2023-04-06

1 Item: character and relationships, situation, voice, movement, space and time, language and texts, symbol and metaphor, mood and atmosphere, audience and dramatic tension.

God Is One: Father, Son, and Holy Spirit 2021-03-11

12 Items: filialheresysacredtrinitymessiahcovenantdoctrinebeatitudeparacletetheotokosphilosophyincarnation

Drama 2023-04-06

1 Item: character and relationships, situation, voice, movement, space and time, language and texts, symbol and metaphor, mood and atmosphere, audience and dramatic tension.

BBW Word Search #4.2 2023-01-31

50 Items: You are your own?This is your own what?What can calls generate?If not the correct address?What browser do you not use?What do you open Epiphany in?Where do you submit invoices?You do not have a manager or?What is the opposite of logon?What do you submit in Zendesk?Candles come in one and three?What is paying no taxes called?...

BBW Word Search #4.1 2023-01-31

50 Items: You are your own?This is your own what?What can calls generate?If not the correct address?What browser do you not use?What do you open Epiphany in?Where do you submit invoices?You do not have a manager or?What is the opposite of logon?What do you submit in Zendesk?Candles come in one and three?What is paying no taxes called?...

Astronomy Word Search 2023-12-18

6 Items: study and belief in the zodiacspilots or works in a space crafta group of stars that make a shapethe study of everything in the universepasses gas when orbiting close to the sunlarge shape with seven stars of Ursa major

Lesson 14: The Constitution Vocabulary Words 2024-02-21

11 Items: The branch that makes laws.The branch that carries out, or executes, lawsThe document that describes how the U.S. government works.An agreement in which each side gives up some of what it wants.The branch that interprets laws and settles disagreements about them....

Hebrew school Class 2022-2023 Tzedakah 2023-03-15

23 Items: EtiAlexEllaLakeLiamRemiMolliElizaCalebChloeGemmaHebrewGeorgeAnnabelleCharity: Give to charity, TzedakahVisit: Visit the sick, Bikur CholimPeace: Peace in the home, Shalom BayitCourage: Courage of the heart, Ometz levEarth: Take care of the earth, Bal tashchitReturn: Retun lost objects, Hashavat aveidahRespect: Have respect and honor others, Kavod...

Unit 11 2022-12-01

12 Items: a minor officialforcing others to obeyunbeatable or resilientbreaking of a legal oathto swear off or renouncehaving to do with the lawbeing most evident or apparentto give credit or recognize toavailable only to a special fewto bring forth especially through wordsgroup of the most wealthy and privilegeda government by a religious figure or leader

Unit 11 2023-09-04

12 Items: a minor official.unbeatable, resilient.to swear off, renounce.forcing others to obey.breaking of a legal oath.having to do with the law.being most evident or apparent.to give credit or recognition to.to bring forth, especially through words.group of the most wealthy and privileged.a government by a religious leader or figure....

A Word Search 2023-05-30

100 Items: aibyheisitmynotoupamanasatgoifinofonsowebedoorallbutheritsoutthetwowhoandcanforhimhishownotnowseeusewasaredaydidgethadoneshewayyoumayhasbeendowneachfindhavemorepartthatwhencomefromlikelonglooksaidthemthenwillwithmademakemanysometheythiswereintothantimewhatyouraboutothertheirwhichfirsttherewaterwordscouldthesewouldwritecallednumberpeople

PE 1 2023-09-13

35 Items: sironetwomisswellokayzerofourfivehellomadamthreepleaseand younothinggoodbyesee youlikewiseits…timedelightedthank youhalf pastmy name ishow are youhow are yougood morninggood eveningquarter pastsee you laterits one oćlockwhats happeningwhat time is itsee you tomorrowwhat is your namepleased to meet you

Reese Dismukes 2024-02-14

20 Items: carefullyin the wayserene, calmout of sortsto make appearTo seek revengethreatening wayto squirm in painwarped out of shapeto attack violentlyto destroy completelyTo keep within a boundaryCuriosity, mystery, secrethaving very good judgementfull and appealing in formOf little worth or importancenot aware of what is happening...

Bee Diseases & Pests Word Search 2023-09-06

13 Items: ropes 2cmBee diarrhearopes less than 2cmcannibalizing broodinternal parasitic miteMummies at the front doorprepupae have a "shrunken head"Small bug that slimes honey framesFeces in the cell of a colony with PMSMost prevalent virus in honey bee coloniesLarvae have Make silken web tunnels in combMicrosporidian infecting the midgut and hindgut...

FNL WORD SEARCH 2024-03-01

14 Items: Man's best friendIs patient and kinddealing with the mindIntended to be marriedNot a child or an adultchosen profession or occupationMay denote either husband or wifeA lot of different groups singingA serious disagreement or argumentThe largest planet in our solar systemAble to exist together without conflictrelating to society or its organization...

Unit 11 2022-11-28

12 Items: A minor official.Unbeatable, resilient.To swear off, renounce.Forcing others to obey.Breaking of a legal oath.Having to do with the law.Being most evident or apparent.To give credit or recognition to.Group of the most welthy and priveleged.To bring forth, especially through words.A government by a religiuos leader or figure....

Ajar Word Search 2024-04-26

12 Items: a large white birdlimated of somethinggoing down in numbersa foot like treatmentsomething that's stickydecline of a unexpected thingsomething that only open a littlegoing somewhere and not coming backsomething or realed to something elseto exandout out ward were your body canta strong dislike to something or someone...

I am confident in expressing my needs and desires 2024-01-16

15 Items: boldopenclearvocalhonestdirectdecisiveresoluteassertiveexpressivearticulatepersuasivetransparentcommunicateselfadvocating

1 2022-02-20

96 Items: ofohoractagoandbadbagbedbutbuyendgasherhitlaylownornotoiloneouroutredtenthewayyetableareaawaybabybackballbankbasebeatbestbillcallfallgameheadlongmostonceaboutaboveadmitadultafteragainagentagreeaheadalonealongamongapplyargueavoidboardleastmediaotheracceptacrossactionaffectagencyalmostalwaysamountanimalansweranyoneappeararoundarriveartistassumeattack...

Fry's 1st sight words 2023-02-21

100 Items: aiamanasatbebydogoheifinisitmynoofonorsotoupweallandarebutcandaydidforgethadhasherhimhishowitsmaynotnowoneoutseeshethetwousewaswaywhoyoubeencomedowneachfindfromhaveintolikelonglookmademakemanymorepartsaidsomethanthatthemthentheythistimewerewhatwhenwillwithyouraboutcouldfirstothertheirtherethesewaterwhichwordswouldwritecallednumberpeople

You Word Search 2024-08-29

36 Items: OnJargymOutSlidtreeGoalBallFistPoolmuchCoolDatesaid:imagesaid:said:creamSwingwingsunderSeesawSpiralBasketCoffeeChatGPTFrisbeeWhere'sSaffronArmbandsicecreamPistachiochocolateStrawberryI gave you some words can you makee a board game like this?...

American Revolution Vocabulary 2022-11-15

3 Items: treatythe act of attempting to overthrow one's governmenta person who believed the colonies should remain part of britain and ruled by the british

AT HOME AND PRONOUNS I, YOU HE, SHE 2016-02-12

12 Items: iheyoushehousegaragegardenkitchenbedroombathroomlivingroomdiningroom

Goldilocks and the Three Bears pgs. 14-19 2023-09-15

12 Items: Who was in Baby Bear's bed?Is this your _____? I'm sorry.How did they feel after their walk?What happened to Baby Bear's chair?What did Mother Bear make some more of?Where did the three bears go for a walk?What did they want to eat after their walk?What was somebody doing in Baby Bear's bed?What did Baby Bear do when he saw his chair?...

Amity's word search 2023-12-18

7 Items: like leopeople in spacelike a spoon in skya shape make of starsa group or cluster of related thingsthe project is expected to represent a giant leap forward in astronomyfrozen leftovers from the formation of the solar system composed of dust, rock, and ices

ELA Word Search 2024-01-08

26 Items: Time orderExtreme exaggerationThe problem of a storyPerson telling the storyGood guy or hero of a storyOpposition's claim/argumentTo restate in your own wordsSequence of events in a storyBad guy or villain of a storyA word with a similar meaningThe time and place of a storyConversation between charactersMain idea of a text (two words)...

Find your starting word for Part. 3 2024-07-26

3 Items: largest prime number under 1024 options for this in the crosswordsimplified version of C to F is: Multiply by 2 and add __?

Lab Final Review - Word Search 2022-11-29

20 Items: Type of data that is numeric.The ______ Exchange Ratio (RER).The first phase of VO2 kinetics.The study of the speed of a response.MAP is _______ during dynamic exercise.Release of this hormone lowers blood glucose.COPD is an example of an ________ lung disease.We measure systolic and ______ blood pressures....

Amor Word Search 2023-04-19

30 Items: What is ____.____+adjectivetenernumberañosBasically netflixbasically an ipadbasically an alexawhat you call 7 daysyou say how old you are.how you describe somethingall of the object in a groupa disk used to record videossomebody you take a class withsomethingyou watch in a theatersomething you say when surpriseda devise that runs on electricity...

CHAPTER 13 LESSON 2 THE SOUTH AND SLAVERY 2024-04-09

7 Items: a leader of a slave revoltA big farm that grows cottona leader in the fight against slaverya secret network to help slaves escapethis machine increased the demand for slavesa famous conductor of the Underground Railroada former slave who fought and spoke out against slavery

BBW Word Search #4 2022-09-24

50 Items: You are your own?This is your own what?What is not a gift or sale?If not the correct address?What browser do you not use?What do you open Epiphany in?What is the opposite of logon?What do you submit in Zendesk?Candles come in one and three?You are an IC for what company?What can too many calls create?What is paying no taxes called?...

BBW Word Search #4.1 2023-01-31

50 Items: You are your own?This is your own what?What can calls generate?If not the correct address?What browser do you not use?What do you open Epiphany in?Where do you submit invoices?You do not have a manager or?What is the opposite of logon?What do you submit in Zendesk?Candles come in one and three?What is paying no taxes called?...

T09 - Word Search #1 2024-04-12

22 Items: Andrew...the doughboyaka spicy SpanishLiz doesn't like this fruit...used to track lender match callsthis was our trainer earlier this weekwhat did leigh have for lunch yesterdayDOB can be updated her after verificationissues will arise if the source is this...used to retrieve a copy of your EIDL LCD'sthis person doordashed chinese food last week...

Magazine Word Search 2022-12-09

16 Items: My Last NameMy First HusbandMy Third HusbandMy Second HusbandMy Fourth HusbandMy Daughters NameMy Dads First NameWhat Did I Die FromWhat I Loved To ReadMy Fifth And Last HusbandThe Month I Was ConvictedMy Highest Grade Of EducationWhere I Got Injured As A ChildWhat I Used To Poison My VictimsHow Many People I Admitted To Killing...

I forgive myself and let go of past mistakes 2023-09-05

15 Items: healmendrenewredeemsootheupliftrestorerebuildcomfortnourishreassurereconcilerejuvenatetranquilizeselfcompassion

I forgive myself and let go of past mistakes 2024-01-15

15 Items: pastgracefutureforgivehealingforwardcleansingselfmercysurrenderredemptionovercomingresilienceunburdeningrestorationreconciliation

July 11 Word Search -- Driving Related and Other Words 2024-07-05

15 Items: honkhornroadsignpasstruckbridgedriverminimumunusualgasolinepassengermotorcyclewindshieldappropriate

May words 2022-06-06

33 Items: Of or pertaining to a year.The using up of a resource.Stick fast to a surface or substance.In spite of the fact that; even though.Craving or consuming large quantities of food.Rigorously binding or exacting; strict; severe:A union or association formed for mutual benefit.A group or system of interconnected people or things....

Sea Creatures Unveiled: Discovering Nest-Builders Beyond Birds and Squirrelsseaanimalsbirdssquirrelsnestscreaturesoceanoctopuspufferfishdenburrowshermitcrabsshellsotterkelpforestraft 2024-04-11

19 Items: seadenkelpraftbirdsnestsoceancrabsotterhermitshellsforestanimalsoctopusburrowssquirrelscreaturespufferfishnest-building

unit 7-10 word search 2024-05-07

14 Items: - racial violence- american journalist- member of democratic- first black millionaire- former Govenor in Georgia- former mayor from 1962-1970- lead populist party in Georgia- 3 political Leaders in Georgia- abandon its long distance economy- found guilty and sentenced to death- a fix sum on every liable Individual...

ON THE PULSE 2 - UNITS 1 - 2 AND 3 - WORDSEARCH 2023-11-22

18 Items: rockpianochoirriveroceansingersitcommountaingoforarunkeyboardschatonlineclimbwallswaterfallsrealityshowdocumentaryrideabmxbikeplaythedrumssurftheinternet

The lion and the mouse 2 2022-08-29

7 Items: pawchewlaughasleepstumbleswallowstruggle