health and wellness Word Searches

ON THE PULSE 2 - UNITS 1 - 2 AND 3 - WORDSEARCH 2023-11-22

18 Items: rockpianochoirriveroceansingersitcommountaingoforarunkeyboardschatonlineclimbwallswaterfallsrealityshowdocumentaryrideabmxbikeplaythedrumssurftheinternet

The lion and the mouse 2 2022-08-29

7 Items: pawchewlaughasleepstumbleswallowstruggle

Phoneme/ Sound: 'OR' AND Grapheme/ spelling: 'ore', 'aw', 'ough' 2022-08-28

15 Items: sawmoresorehawkclawsnoreprawnstrawoughtignoreboughtfoughtexplorethoughtbrought

Unit 1 week 2 and Unit 2 week 4 2023-09-28

15 Items: very valuable to you.it is in danger of being hurtto represent ideas or objectsbravery in a difficult situationyou remembered something from the pastto be stay alive after a dangerous eventthings that have been done for a long timeyou do something special for a day or eventis the number of people living in a certain place...

I am a magnet for positive experiences and people 2024-01-16

15 Items: affinitycharismamagnetismresonancewelcomingalignmentfrequencyvibrationattractionpositivityjoyfulnessbrightnessexuberanceenchantmentsynchronicity

TEST 1 AND 2 PART 1 2024-06-05

7 Items: fraudulentunable to be disputedaccept or admit the existence or truth oferode the base or foundation of (ex. a rock formation)the possibility or likelihood of some future event occurringgive (someone or something) the authority or means to do something.a measure, quantity, or frequency, typically one measured against some other quantity or measure

Advance Functions 2024-07-22

13 Items: To change the base, we used the:Statements that compare two expressionThe smallest repeating unit of the functionWhich is attached to the highest degree of “x”line that a curve approaches, as it heads toward infinityA set or group of functions that share common characteristicsA relation in which each x-value in the domain has a unique y-value...

Polareasterlies Word Search 2023-05-12

2 Items: They are cold winds that blow from east to west to east between latitude and 30 degrees latitudeare steady winds that flow from west to east between latitude 30 degrees latitude and 30 degrees latitude

Spencer's word search 2023-12-18

6 Items: study of zodiac singsis a person who travels in a spacecrafta group of stars also known as ursa majora ball of ice and dust that orbits the sunbranch of science that deals with space objectsa group of stars forming a recognizable pattern

I Am The Way the truth and the life 2023-02-12

14 Items: waylifejohnpathjacobjesusdreamangelsthomasheavenfatherladdermessiahsalvation

Fundamental Word Search 2023-11-18

20 Items: A type of suppressed demandTourism arrivals number refers to ____________ demand.___________demand is when geographical location of demand is changed.Tourism __________ are expenditures by international inbound visitors.Visitor arrivals into Singapore are also known as ___________ tourists....

Airtel Journey 2024-06-03

4 Items: One word for gaining knowledgeOne word for Practicing your knowledge at work.One word for Playing to earn scores, points and rewards.One word for taking advice from someone more experienced at work.

Cat Word Search 2023-11-08

3 Items: transfer of heat through moving moleculestransfer of heat through electric magnetic wavesthe transfer of heat through air being less dense and more dense

Chocolate Fever wordsearch ....by: Mia and Maggie 2015-10-15

10 Items: popmaccakeHenryfeversugarcookiechocolatechocolatedoctorFargo

ALADDIN AND THE WONDERFUL LAMP, PART 2 2024-09-06

9 Items: orarjoyabodacuevageniofrotarcasarseatrapadoservidor

Medieval Europe and the making of Christendom (2) 2024-04-16

11 Items: jewspopebibletithepreachchristpalestinedisciplesorphanagestabilizereformation

Welcome Back Word Search 2023-08-20

10 Items: Do your ____.Raise your ____._____ your hand.______ to your teacher.You use a ________ to take notes.Be ____. It's another word for nice.Work you do with a partner is called ____ work.Speak in a ______ voice. It's another word for nice.Work you do with three or four partners is called _____ work....

Netherlands 2022-10-31

10 Items: A famous painter.How they say goodbye.A special Dutch food.They love eating cheese.They are all over the Netherlands.Cow, This is where milk comes from.They are know as the national flower.The capital city of of the Netherlands.clogs, They are shoes woren while clog dancing....

trs23 ie2 u5p1 2023-01-12

10 Items: a small, glass ballput it with your keysa kind of scary animala small model of a personuse it to erase your writingput it on your clothes or baguse it to sharpen your penciluse it to colour in a drawingstick it on paper or on your thingsblow it up and it will float in the air

Keen Word Search 2023-12-09

10 Items: To leave out or excludeHaving a sharp edge or pointCalm, peaceful, and untroubledTo express sorrow or grief audiblyHaving or showing tact; diplomatic.Lacking interest or excitement; dullTo think deeply or consider carefullyAttractively unusual or old-fashionedTo move back or away from a point or limitA beginner or someone new to a field or activity

loomad 2022-12-13

6 Items: Man's best friendWomen's best friendElephants are known to develop strongZebras have very different temperaments to horsesLions can be humans best friend if treated correctlyThe hippopotamus is a very aggressive wild creature and is the deadliest large land mammal on the planet

Intro to Physics and Matter & Interactions 2023-06-15

7 Items: Career related to Physics.Any quality or characteristic.Physics studies the ________ world.Everything around us is made of _______.Is used in Physics to model observations and make predictions.An example of a chemical property of matter. Related to how dangerous a substance can be....

CHARACTERISTICS, PROCESSES, AND ETHICS IN RESEARCH 2024-07-11

7 Items: originalempiricalobjectivesystematiccontrolledhypothesisanalytical

Sound Word Search 2022-12-13

11 Items: moving back and forththe absence of matterthe way a wave travelshow high or low a sound iswhat sound waves travel throughwave the type of wave a sound isalso known as longitudinal wavesthe ability for something to do workwhen air particles are furthest apartwhen air particles are close togethervibrations create this so you can hear it

Science Word Search 2023-05-25

25 Items: The ability to dissolveThe harmful rays that come from the sunAn animal that hunts and eats other animalsA scale that shows the acidity of substancesThe SI base unit of thermodynamic temperatureThe type of cloud that tells you a storm is comingWhen different species work together, BOTH benefitThe layer of the atmosphere where weather occurs in...

Year 8 Plant and Animal Cells Wordsearch 2023-11-23

9 Items: cellplantanimalnucleusvacuolecellwallcytoplasmcellmembranechloroplasts

5B-02 2024-01-09

15 Items: Really sorry we’re late. We got _________in traffic for over an hour.If you didn’t drive so fast, I could see the road _____ and we wouldn’t be lost.While you are down town, can you drop into the _________ and get me some headache medication?Do you have any red or green _________? I want to hang the Christmas decorations on the tree....

Poetry Vocabulary 2024-02-27

10 Items: A regular repeated pattern of sounds or movements.A feeling or an idea that a word makes you think ofWhen words have the same last vowel and consonant sound.Words or phrases that are meaningful, but not literally true.A row of words in a poem. They are arranged for many different reasons....

Defense Mechanisms in Addiction #1 2023-09-12

10 Items: Making others the responsible party for our drinking and drugging.Distorting the truth, or omitting key details to change a narrative.Keeping someone on the offense by using fear tactics, forcing complicity or else.Making light out of a dark situation by turning it into a joke whenever possible....

Maya and Simrin go to India! You are SOOO lucky. :) 2024-01-30

17 Items: funyaybyeslaydogscatsmimisisinonozozocoldindiahellodubaifamilybestiesbasketball

Junior Jumbles 2024-04-09

10 Items: RedrumWhat was inside the skull ?Criminals will be punished.The 2nd way to say "Mafia".What you are doing currently.The overused weapon to murder.Numbers and Numbers, You must think.I=III IV=VII VIII=V VI=II V=II IX=IIjust someone who for some reason got involvedPAPYRUS NEEDS HELP WITH THIS JUNIOR JUMBLES !! (indice : la premier ligne)

ww4 u3 2024-03-07

15 Items: to stopvery hungryto go closer totired or sleepyto make smallerstrict or harshto see or noticeto sleep for winterto make or get readycausing harm or damageto settle down comfortablyto dare to do, to say, to goa hole or tunnel dug into somethingto move from one country or region to anotherto figure out and say what will happen before it takes place

BTGHS Section 2: CH 4-7 Vocab 2024-04-30

15 Items: covered in tarloyal, reliableabout to happenextremely unpleasantrepetition and routinefemale spirit who criesunpleasantly cold or wetpale orange tropical fruitlose or lack vitality, weakof a distant foreign countryspun thread used for knittingleave, unable to move through lack of winddistance of a place north or south of equator...

Balloon alternatives - think of paper and reusable materials 2023-05-12

11 Items: archreusepompombuntingbannerspostersorigamibubbleslanternupcyclecollages

Give people more than they expect and do it cheerfully 2018-03-27

17 Items: LoveAwareTrustLeaderWarmthRespectHelpfulUnknownkindnessGratefulGooddeedPatienceAttentionHappinessMotivationAbove&BeyondUnderstanding

/r/ Initial Sentences 2024-09-08

10 Items: The "roof" is red.The "ram" is really soft.The "Range" Rover is an SUV.The sun "rises" in the east."Rope" climbing is really fun.The man "wrote" and read a book."Red" is the color of most apples.Turn "right" at the red stop sign.The classroom "rule" is to be kind.The bell is ready to "ring" at noon.

15 2023-02-06

12 Items: An answer, a reply.To give away, share.Accurate, indefinite.Unable to make choices.Having no basis or favor.To prevent from happening.Containing all, not keeping any out.1. To command, to urge. 2. To forbid.Providing no clear answer or solution.An order which legally prevents something.A cut made in order to get inside something....

colors 12-word search 2023-03-15

12 Items: the color of nightthe color of grapesthe color of tangerinesthe color of a dandelionthe color of a snowflakethe color of strawberriesthe color of a tree's trunkthe color of lips of a babythe color of the Mediterranean Seathe color of a cloud during a stormthe color of the sky in good weatherthe color of leaves in spring and summer

Unit 3 2023-09-16

12 Items: Filled up withTo use up; wasteTo confuse and frustrateTo put into action; executeTo get in the way of, hinderTo not do something; refrainStubbornly persistent; determinedA group that attends an important personTo stop one from doing something; preventTo support for an extended period of timeTo fill up from within; to spread throughout...

The Respiratory System 2024-04-24

12 Items: What we breath outHas 12 paired bonesThe smallest airwayOften called the windwipeWhere you breath in and outAllowes our cells to breath.Major muscle of respiratory systemSomething at the end of bronchiolesA large airway leading from windwipeSomething that always you too breathBlood vessels that exist through out your body...

South America Vocabulary 2022-11-13

15 Items: synonym soaklow-lying areascomplete controlsynonym for plantssynonym for modifycarefully uncoveringWorlds largest waterfallDriest desert in South Americapeople who move from place to placeobjects left behind by past culturesthe variety of species in an ecosystemwide open areas used for grazing and cropssmall rivers that drain into a larger river...

Harry Potter and the Goblet of Fire Word Search 2024-03-04

14 Items: ronharrygoblethermionehogwartsvoldemorttriwizardslytherinravenclawdumbledoredurmstranggryffindorhufflepuffbeauxbatons

Week 3 Spelling Word Search 2022-09-08

10 Items: Dark, dirty, gloomySatisfy one's thirstElaborate or luxuriousattractive or alluringUnwilling or unable to believe somethingFailing to take proper care in doing somethingCare for and encourage the growth of another personA feeling of pensive sadness with no obvious reasonFamous or well known typically for some bad quality...

This is Delaney's, I guess 2022-11-28

10 Items: maximum displacement up.maximum displacement down.and wavelength is measured in meters.wave, moves medium parallel to wave motion.wave, moves medium perpendicular to wave motion.is the distance between one complete wave cycle.number of waves or vibrations produced per second.areas of maximum displacement in a longitudinal wave....

Gov Project 2023-05-09

9 Items: Head of Agriculture.A trained law professional.Money given to Congress with regulations.There are 9 of these on the Supreme Court.The ___________ Branch that makes the laws.Implementing state laws and overseeing the operation.Title given to the heads of most cabinet departments.The branch that determines if laws are constitutional....

Chapter 6 Chemistry Review 2023-01-10

10 Items: 6.022·10^23The mass in grams of 1 mol of the substance.A small unit of mass equal to 1.66·10^-24 grams.Which has more mass, 1 mol of silver or 1 mol of lead?The number equal to the number of carbon atoms in 12.01g of carbon.The weighted average of the masses of all the isotopes of an element....

trs 3b w17 pt1 2022-06-01

11 Items: adj. not farn. a baby animaln. brother or sistern. a very smart personv. make something move upn. a person who makes musicv. lift up and move somethingadj. very good at doing somethingn. a big, white bird that lives on waterv. make a sound with a musical instrumentn. small sea creature that looks like it has wings

All About Reads by the River 2023-09-12

11 Items: Owner/curator at RBTRThe river next to our shopThe month we opened in 2021Your favorite local bookstoreThe city where we are locatedThe street where we are locatedCreative people we love to highlightOwner and guy who can build anythingThe unique item hanging in our storeEveryone's favorite moveable item in our store...

AN ETHIOPIAN HEARD THE GOSPEL 2023-04-04

2 Items: romansHOW CAN THEY CALL ON HIM TO SAVE THEM INLESS THEY BELIEVE IN HIM AND HOW CAN THEY BELIEVE IN HIM IF THEY HAVE NEVER HEARD ABOUT HIM AND HOW CAN THEY HEAR ABOUT HIM UNLESS SOMEONE TELLS THEM

Lender Placed 2023-10-25

12 Items: Who is the insured on an LP Policy?LP insurance covers protection for what?The Level numbers help us identify the ______ on the loanIf the coverage for LP shows WO that means it's for what risk?What's the acronym of the agency that regulates LP requirements?The status of the LP when there's no current preferred coverage on file...

Medieval Europe and the making of Christendom (2) 2024-04-16

11 Items: jewspopebibletithepreachchristpalestinedisciplesorphanagestabilizereformation

The way of the truth, and the life 2024-04-27

11 Items: lovelifehopetruthpeacefaithprinceprayerbelievethelightholyspirit

The way of the truth, and the life 2024-04-27

11 Items: lovelifehopetruthpeacefaithprinceprayerbelievethelightholyspirit

Unit 5, Week 3 - Spelling Pattern: ue and oo 2023-02-13

14 Items: glueblueprooftoothcluesbloomboothuntrueraccoontuesdaybedroomluckiersaddestmoonlight

Developing Confidence 2024-06-29

10 Items: Dress up. We tend to feel more ______ when we know we look good.There are _____ common methods for reducing public speaking apprehension._________ phase the surge of anxiety you feel as you begin delivering your speech._________ is learning by observing and then imitating those you admire or are close to....

Floriography Word Search 2024-09-01

18 Items: Charity (Moss)Protection (Eucalyptus)Forever; good taste (Dahlia)Energy in adversity (Chamomile)Thirst for adventure (Eryngium)Thoughtfulness; humility (Ruscus)Luck; loyalty; devotion (Lavender)Modesty; order and harmony (Cosmos)Simplicity; cheer; patience (Daisy)Power to overcome; healing (Achillea)Big-hearted; fun; levity (Delphinium)...

Creative and Critical Thinking 2020-01-30

4 Items: factualdivergentconvergentevaluative

Energy Word Search 2024-01-08

8 Items: The ability to do work.The energy of a moving object.The energy of an object at height.The energy stored in chemical bonds.A ... is an object or group of objects.What is the standard measure of energy?Baking in an oven is an example of ... energy.Magnetic, kinetic and elastic potential are all examples of...

Unit 3 Vocabulary 2023-09-18

12 Items: Filled up withTo use up; wasteTo confuse and frustrateTo put into action; executeTo get in the way of, hinderTo not do something; RefrainStubbornly persistent; DeterminedA group that attends an important personTo stop one from doing something; preventTo support for an extended period of timeTo fill up from within; To spread throughout...

What'S Word Search 2024-05-27

13 Items: 食べ物…と~…がほしいチーム,組米,稲,ご飯what isカレー(料理)(…を)する,行う…することができる…に加わる,参加するおどる,ダンスをする…を好む、…が好きである健康で、元気で、よい、じょうずに,うまく,よく

Scientific Method 2023-10-10

12 Items: unit for massWhat is testedwhat is measuredscale measure massCylinder measures volumeused with the digital scaleused to measure and heat liquidswhat you get for a perfect lab clean upwhat you cannot do during class starterswhat you must do in order to leave the roomwhat you are if you find all of these words...

Unit 15 2024-02-06

12 Items: AN ANSWER, A REPLY.TO GIVE AWAY, SHARE.Accurate, indifferentprevent from happening.unable to make choices.HAVING NO BASIS OR FAVOR.TO COMMAND, TO URGE. OR TO FORBID.CONTAINING ALL, NOT KEEPING ANY OUT.PROVIDING NO CLEAR ANSWER OR SOLUTION.AN ORDER WHICH LEGALLY PREVENTS SOMETHING.a cut made in order to get inside something....

trs23 ver3 u1 2023-02-16

8 Items: Not pretty.Pick something up.Go from one place to another place.A scary, not real animal or person.A room in a house with a TV and sofa.What you give when somebody asks you a question.Animals have these. Some are long, some are short.Where two sides meet. A square has 4. A triangle has 3.

Grade 5 Unit 4 Week 1: Rosa 2024-02-07

8 Items: not the same; unevenhonest or open; frank in speechtried to find; went in search ofset apart for a person or purposegave a claim or right to; qualifiedto resist boldly and openly; to refuse to obeythe act of looking forward to something; expectationnot taking or belonging to either side in a conflict

A Dog of Flanders pgs. 12-16 2023-07-10

12 Items: What is the boy's name?What is the dog's name?Where was the village near?Patrasche was a _____ once.Patrasche was a dog of ______.The grandfather was now _______.What is Nello's grandfather's name?What did the grandfather do before?What was in the center of the village?What kind of sound did the clock make?Patrasche wasn't _____ to stop and drink....

Unit Three 2023-09-17

12 Items: filled up withto use up; wasteto confuse and frustrateto put into action; executeto get in the way of, hinderto not do something; refrainstubbornly persistent; determineda group that attends an important personto stop one from doing something; preventto support for an extended period of timeto fill up from within; to spread throughout...

Chemistry: State Changes 2024-01-25

14 Items: A solid, liquid or gas (5)Going from solid to gas (11)Going from gas to solid (10)Going from gas to liquid (10)Going from liquid to solid (8)Going from solid to liquid (7)How easily something reacts (10)How tightly packed particles are (7)How harmful something is to our health (8)A white solid that goes from solid to gas (6)...

Biodiversity and Food Word Search 5/17/2021 2021-05-16

11 Items: fungimammalsprotistkingdomgeneticsConifersdiversitycommunityeubacteriavertebratesinvertebrates

The way of the truth, and the life 2024-04-27

11 Items: lovelifehopetruthpeacefaithprinceprayerbelievethelightholyspirit

technology and innovation vocabulary for IELTS (1) www.atomicielts.com 2024-09-01

11 Items: shiftcommontowardsgrowingenhanceinterestwearabletransformtechnologyincreasinglydigitisation

Government 2024-08-13

8 Items: What were local elected leaders in the American colonies called?What did Charles 2nd sign in order to gain the throne of England?How did colonies get around restriction on trade placed upon them by England?Who fought against King Charles 1st and the House of lords in the English civil war?...

Spelling: The War of the Wall and Rikki-Tikki-Tavi 2015-10-22

17 Items: drawlepoxycowerschemebeckonreviveverandascuttlebungalowpurchasecunninglyliberationcantonmentcultivatedprovidenceinscriptionconsolation

Super Smash Brothers Melee's Enemies and Adventure Mode's Optinal Battles 2021-01-20

17 Items: TopiKoopaLuigiGoombaShyGuyReDreadOctorokLikeLikePolarBearCrazyHandParatroopaGiantKirbyMetalMarioMasterHandGigaBowserMetalBrothersFightingWireFrames

Maya and Simrin go to India! You are SOOO lucky. :) 2024-01-30

17 Items: funyaybyeslaydogscatsmimisisinonozozocoldindiahellodubaifamilybestiesbasketball

ge-hardware and software 2022-01-11

4 Items: bitonebytezero

16.The 1950s were marked by significant social and cultural changes, including the Civil Rights Movement and the emergence of youth culture. 2023-03-04

19 Items: sockhopsrosaparksjazzmusicjamesdeanteenidolsjamesbondbeatpoetrythewildonepinupgirlsrockandrollmarlonbrandomarilynmonroelittlerockninedriveintheaterspresleymovementsfonzieandgreasersmartinlutherkingjrrebelwithoutacausemontgomerybusboycott

pillow and blanket 2018-10-13

3 Items: bedpillowblanket

k-12 songs (melanie martinez) 2024-09-09

13 Items: puppetPEDOPHILIAfruit juicefake friendspuff puff and pass itpink slip of permissionbraids were used as a weapontypical theater kid experiencei will rip ur f'ing face apartprincipal sneaky greedy money seekingif u talk to much in class u could get ____going outside to play during school is called ____...

happy saturday 2024-08-17

14 Items: champagne brutrocca delle maciemarques de caceresstill bottled waterbanquet space on 9th floorexecutive chef of tre rivaliprickly pear, lime, ginger beerchariman and ceo of first pathwayarborio rice, bolognese, nonna's saucewest coast ipa + mango dragonfruit sourfire roasted eggplant, tahini, roasted pepper...

Gabby's word search 2023-12-18

6 Items: gruop of stars that connectthe curved path of a celestial objecta ball of gas or rocks that orbit the suna broad of luminous irreguar band of lighta person who explores space and travels in spacea body of matter that enters the earth's atmosphere

Holy Week - Last Supper and Washing of the Feet Word Search 2016-03-17

39 Items: ateNewlastfeetbodywinemealJohnJewsMarklastbreadbloodJesussaveddustygreatservetowelteachsupperChristwashingsandalsCovenantrealisedbelievedbarefootcleaninghumilitydisciplescommunionrepugnantsacrificenecessityspiritualrepresentsremembranceCorinthians

SPRINGLE 2014 FAMILY REUNION FIRST NAME AND NICK NAME SEARCH GAME 2014-07-07

20 Items: EDTOTLENAJOELBUBBATOMMYHURLEYSYLVIAGEORGEEDDIEDANDREWHAYWOODSMAMIELEEEVERLENASPRINGLESJOSEPHINEMATTIEMAEANNIEBELLBARBARAANNJAMESEDWARD

le and el words 2019-02-13

4 Items: cameltunnellittleturtle

Mid Advanced- Find mixed Vocabulary words and then give its definition 2016-07-09

21 Items: Avoidclaimexpectamountensurebureaugathergarbagecommuteoutcomesurfacesaccuratesuitableswitchedpackagingshorelineguidelineupheavelssweetheartincreasingprocedures

Week 5 - Plurals - no change and mid or end word change 2023-05-02

20 Items: menfishdirtdeersnowfeetdicemicesheepmoosebreadwomenteethgeesefungiseriespeopleaircrafthomeworkchildren

ANATOMY OF A HORSE 2024-01-18

15 Items: A horse’s front foot.The left-hand side of a horse.The right-hand side of a horse.The ridge between the shoulder blades.The topline of a horse’s hindquarters.The ridge between the shoulder blades.The hair that grows from a horse’s neck.This is the bone located inside the hoof.The joint above the pastern functions like an ankle....

Ch. 24 Medical Terminology 2024-05-06

5 Items: Involuntary, uncontrollable movementsweakness or slight muscular paralysisQuick, involuntary jerking of a muscle; muscle twitchThe loss of muscle mass, strength, and function that come with agingA band of fibrous tissue that holds structures together abnormally, usually form after injury or surgery

Week 13 Words 2023-05-15

7 Items: You can put this on your food. __________When you move your body to music. ___________This is something you can eat. ______________When you say the words to a song. ____________When you think of something to do. ___________If you don't cook something, it is this. _____________When you do something over and over to get better. _______

NLHS Uniform and Drill reams19 2024-04-11

8 Items: facefacefaceleftholtrightmarchon deck

The One And The Something 2023-11-25

5 Items: firtoplookplacegeese

fetertre 2023-08-24

7 Items: Legally recognised partnersAny transaction or occurrence that results in a tax consequence.It is specifically excluded from the definitions of ‘goods’ and ‘services’.Permanent transfer or disposal of business assets where input tax credit has been availed on such assets....

Christian Prayer 2024-01-09

3 Items: a set of beads used to praywater blessed by a priest or holy personwhen something is important to a religion and is treated with respect

Christmas Word Search 2022-12-22

17 Items: frozen rainSanta's carChristmas Grandpathe sound of bellssomething for a fireanother word for giftan old word for happywhat we do to the treeput the gifts under thiswhat month is Christmas?another place to put giftskids want these from Santaa treat we leave for santathey carry Santa in the skythey help Santa make the gifts...

worc 2024-05-24

14 Items: catlionzebrahippo"Save"elephantMan's best friendto Make a Word SearchSearch Generator Featuresno registration is required.your wordsearch, with or without the answers.the form to build your word search. A preview is generated for you automatically.the word search grid to a PNG (or SVG or text) to embed within your own document or worksheet....

Site words 1 2023-01-13

113 Items: hegoinismetoitmyweonatasofifambedonousuporcanyouseegetnotanddidrunforwasareallbigboybutcardayeatfunhadhasherhimhishownewnowoffoldoutransawshewhywhooneusetwoanysaidhavelikeawaybestcomedownfromgirlgivegoodherelookmademakeoverplaysometellthatthemtheythisthemwantwhenwhatwentwillwithyourweregirleachbeenwordmanyintodoesafteraboutcan’thousetherethingwould...

Monthly Challenge A-B 2023-03-08

109 Items: addagoairallandantanyarmartaskbadbagbatbedbigbooboybusbutbuybyeablealsoareaauntawaybabybackballbarkbearbeatbeesbeepbellbikebirdblowblueboatbodyboneboombothbowlbusyaboutaboveafteragainagreeallowalonealongaloudangryapplebeachbelowblackboardbooksboxesbreadbreakbringbrownbrushbuildacrossactingactionafraidalmostalwaysanimalansweranyonearoundarriveartist...

insert 2023-10-20

108 Items: rubwaylayranrunandendturfhurtpourkindnulllumpturnfindfaceliarlaceidlywavydeepgrabpullhourlordlovedogssofthardvealrearrareravesaveinertservepursehorselurchterseroughworseperchporchhoundplaceworsttreadlathefunnyivorypoundmincegrindshootbreakshakewincepinchsmacktoothforcepowerouncehoarddodgeheaveheartfalsestartscoffwatchchasesavorinsertswervesearch...

Edible things 2023-12-04

30 Items: Dr.JoyGUACPsychMaizeBranchpaste.surgeryHot SoupDiet foodzuckerbergLarge fruitCheese ChipsLarge fruit?lime but notlemon but notFor ice creamraises eyebrowChips no Cheesemedieval stocksslurp sluuuuurpThe odd one outpotato but orangeInstead of runningBroccoli but worseuseful to show scaledie like ___ on wateryou glad I didn't say...

A Tale of Two Cities 2024-05-10

26 Items: trotspilllumberrelishburiedinformshatterimaginedeliverentertainconstituteThe Shoemakerthe Golden Threadverbs found in ATOTCOwner of the wine shopthe mysterious messengerBanker from Tellson's BankTom's guard on the mail coachRecalled to this______________London and Paris are 2 of thesethe destination of the mail coach...

Spelling List 15 REVIEW- Word Search 2023-01-24

25 Items: DirtyFancySquabbleTrue FactBy AccentNot WantedNot WorkingEnter AegeanEasy to FoolMakes ThingsEmbarrassingNot ImportantNot ResistiblePhilly _______Put Back TogetherAll Around the WordCredit with a Suffix6 is _________ by 3.Think About it AegeanWOW! I am in _________!Same Weight on Either SideCan Play Music (Well at It)...