health and wellness Word Searches

Where is Reese Going? 2022-12-15

4 Items: Your sister's nameName of a pop starA place your mom and dad visited recentlyOne of Jensen's best friends who has known you since you were a baby

Vocabulary Words: Unit 7 2022-11-16

12 Items: warlike in natureone who loves booksoccurring before a wargood-natured; cheerfulcalm and wise; reasonablea warlike mood or attitudefond of; feeling love towardnot bitter or hostile; friendlyto act hostile toward; to provokecharitable donation to public causesone who is hostile toward; one who opposesthe central character in a work of literature

Stage 25 Derivatives 2022-11-08

12 Items: lying hiddenfully and clearly explainedto give evidence as a witnessto trust someone with a secretto put someone forward by namea punishment for violating ruleswandering outside accepted normshaving charming or sweet demeanoran opening, especially in a camerasomething that happens unintentionallysomeone who holds a place of importance...

family and relationships vocabulary for IELTS (6) www.atomicielts.com 2024-08-19

13 Items: gapgenXgenZgenYolderboomermodernyoungerforwardgenalphathinkinggenerationtraditional

Unit 16 word search 2024-02-01

12 Items: rough likeness.to make hostile.to mimic, imitate.a fight or dispute.a change or modification.not able to be taken away.symbolic rather than literal.change in form, transformation.to conceal the truth, to deceive.a name that is not one’s true name.the process through which an organism changes.to go back and forth, change from one thing to

Metabolism Word Search 2024-02-06

12 Items: rough likeness.to make hostile.to mimic, imitate.a fight or dispute.a change or modification.not able to be taken away.symbolic rather than literal.change in form, transformation.to conceal the truth, to deceive.a name that is not one’s true name.the process through which an organism changesto go back and forth, change from one thing to

9331 God Is Omnipotent 2024-03-20

12 Items: Giant killed by DavidChosen people of God.Killed the giant GoliathEnemies of the Israelites.A fight between two armies.Winning or being successful.Being brave, even when scary.Some one who takes care of sheep.A very large and powerful person.Protective clothing worn in battle.Believing in something very strongly....

independent reading 2024-04-26

12 Items: being overly exciteddestroying somethingsomething see throughable to be fast and quicka talk about random thingswhen something is very loudto show something with your facesomeone who is unorderly or crazysomething that you do automaticallysomeone who is famous or well knownTo find evidence to find something out...

Definitions of Computer and Internet Terms 2016-07-01

8 Items: BIOSKofficeKerningHalftoneBandwidthEmulationHibernateDefragment

Parts of the day and Meals 2023-06-15

8 Items: nightlunchsnackdinnermorningeveningafternoonbreakfast

World Cup Champions 2023-09-23

12 Items: MVPBig brotherYounger brotherBorn in SlovakiaPlayed for UConn BasketballRising star of Anadolu EfesMainly played Handball growing upMother is a postmodernist painterCurrently plays for Indiana PacersScored 24 points against USA in Semi-FinalsAveraged 7.0 points and 4.3 rebounds at World Cup...

Geometry Puzzle 2022-09-09

13 Items: linearadjacentverticleperpendicularsupplementarycomplementaryan angle of 180°A 90° angle, usually a corner.The space between two intersecting lines.An angle that measures between 90° and 0°An angle that measures more than 90° but less than 180°.The center point of a line segment.( 𝑿𝑚, 𝒀𝑚)=(𝑥1+𝑥2÷2),(𝑦1+𝑦2÷2)...

Jesus and the Miraculous Catch of Fish 2015-04-06

10 Items: netfishlordboatjesuspeterthirdgalileedisciplebreakfast

WORDS WITH 'e-e' AND 'i-e'.  2020-01-24

10 Items: Eveliketimeminefivethesethemeshineeveningcomplete

FABLE: THE WIND AND THE SUN- VOCABULARY 2022-05-16

10 Items: sunhothatroadcoatwindblowcoldstrongtraveler

18 One and Only Ivan List 1 2023-05-20

10 Items: ivanvideoarcadedreamsbananapenniescrayonsapplegateterritorysilverback

WORDS WITH 'e-e' AND 'i-e' 2020-01-24

10 Items: Eveliketimeminefivethesethemeshineeveningcomplete

Words with o-e and u-e 2020-02-07

10 Items: usehomecubehugecutetunequeuestolethronebarbecue

human system and plant system word search 2024-05-23

10 Items: jaggedstomataparallelstraightmuscularskeletaldigestivechlorophyllcirculatoryrespiratory

Friendship by Emma Hammerer and Chiara Jenik 2024-07-11

10 Items: sweetfunnyhonesthelpfulsincereenviousnegativearrogantgossipingmanipulator

Spanish Greetings and Farewells for Simple Conversations 2018-09-04

10 Items: tuadiosustedQueTalsaludoComoEstasigualmenteBuenosDiasBuenasNochesQueGustoConocerte

Romans 8:1 and Galations 3:11 2023-04-05

10 Items: godlawlivethosejesusfaithchristjustifiedrighteouscondemnation

The Lion The Witch and The Wardrobe 2023-05-10

10 Items: asialucyWitchpetersusanlondonBeaveredmundS Lewiswardrobe

Important people of the Revolutions and Rebellion! 2023-10-12

10 Items: jamescharlesjacobinlouisxvinapoleontoussaintjeanjacquesrobespierresimonbolivarjosedesanmartin

PROBABILITY AND STATISTICS WEEK 1 DAY 1 2024-01-29

10 Items: datameanmodeanalyzedotplotmeadianstemplotvariableshistogramcategorical

The History and Legend of St. Patrick 2024-03-14

10 Items: greensnakesbishopparadecelticpatrickirelandshamrockchristianconversion

units 1, 3, and 4 vocabualry NCU 2024-03-31

10 Items: mixaunthaveknivetastyfrenchhusbandcarrotsinternetcellphone

WORDS WITH SAME SINGULAR AND PLURAL PLURAL 2024-04-16

10 Items: fishswinebisonmeansseriesspeciesgallowsaircraftbarracksoffspring

The Values and Principles of the UK 2024-06-11

10 Items: respectfreedomdemocracyruleoflawtolerancecommunitycitizenshipvolunteeringparticipationindividualliberty

Charlie and the Chocolate Factory 2017-05-19

6 Items: MikeVerucaCharlieAugustusGrandpaJoeWillyWonka

Work and Energy Word Bank 2023-02-18

6 Items: workjouleenergykineticpotentialmechanical

Math Vocabulary Word Search 2024-04-26

100 Items: rise over runa fixed numbera ratio out of 100a six sided figureeight-sided polygona five sided figureone output (y value)a three sided figurethe answer to a problemequal in value or amountthe perimeter of a circlea polygon with four sidesof, relating to statisticsthe slope of a vertical linethe top number of a fractiondistance a number is from zero...

base words + ed and ing 2024-02-01

6 Items: passjumpreachwaitingcrackeddressing

Definitions of Computer and Internet Terms 2016-07-01

8 Items: BIOSKofficeKerningHalftoneBandwidthEmulationHibernateDefragment

Inventions and Adaptations of the West 2013-06-03

8 Items: sodhouseswindmillsrailroadsbarbedwiresteelplowsdryfarmingwheatfarmingbeefcattleraising

Burnout Syndrome: Understanding the Differences Between Burnout and Depression  2020-11-29

17 Items: ruleeonscopestatedegreeturmoilchronicaversionepisodesdisorderindicatorchallengeddistressedinstitutionperiodicallyfightorflightsignificantly

Science vocabulary words 2023-11-08

5 Items: Heat Transfer by touchHeat Rises and Cold SinksHeat traveling through wavesWhen all substances have reached the same temperature.A repeated design/sequence that is able to be guessed or known in advance

Absence from Work Policy Terminology 2024-04-16

6 Items: Any form of absence from the workplaceFailure to submit a valid medical certificate when one is required is an example of _ absence.An employee leaving work earlier than the agreed end of the work/shift time refers to early _.When an employee is absent for more than 6 days over a 3 month period refers to frequent or _ absenteeism...

All things quality 2022-12-13

18 Items: a name of a QC xxxquality is a "xxxxx" not an actpeople representative for qualityquality can improve this "12 letters"a brand of chocolates "quality xxxxxx"one of Bede's values (POD - 6 letters)best place to work (company name "xxxx")a brand / manufacturer of quality cars (Swedish)quality can improve this with customers / clients...

Harry Potter and the Sorcerer's Stone Ch 4-6 2018-01-16

16 Items: ladenpewtercloutedswarthyspindlypliablegawkinginfernaldrawlingganglingburnishedminusculethrongingapothecarydisgruntledtransfiguration

Harry Potter and the Sorcerer's Stone Ch 11-13 2018-01-18

16 Items: eeriebiasedtureensfanaticconjuredwheedledtauntingluminoussinisterimmortalbroodingdiversionsuspendedpetrifiedbrandishedhalfheartedly

Leadership Values 2022-11-22

117 Items: funjoybackhomehopelovetimefaithgracehumororderpeacepowerpridetrusttruthbeautycareercaringethicsfamilygrowthhealthlegacynaturesafetythrifttravelvisionwealthwisdombalancecouragedignityfreedomharmonyhonestyjusticeleisureloyaltyrespect-takingservicesuccessaltruismambitionthe bestequalityfairnesshumilitysecuritykindnesslearningopennessoptimismpatience...

Things we make and sell in the coffee bar 2023-02-24

16 Items: souprollspaniniscookiesbrowniesflapjacksgingercakesandwichessaladbowlsfruitsconessausagerollscheesesconesbreadpuddingchocolatecakevictoriaspongejacketpotatoes

Long A and I Word Search 2022-09-07

8 Items: name ninemane Mikebike bikecape dategage gaterage ratetape timelife lite

Princess Isobel and the Music Box 2022-12-17

8 Items: melodyshrinkprisongalloptickleunicornlanternbreakfast

Review of Imagery and Figurative Language 2024-01-08

8 Items: simileimagerymetaphorhyperboleonomatopoeiasensorydetailspersonificationfigurativelanguage

Unit 6 Vocabulary Words Boone 2023-11-15

7 Items: to breathe into make larger or expandto put in a group or classto make larger or greater; add toto cause to happen by stirring emotionsto ask a question in order to receive informationto make a guess based on facts and observations; conclude

Percentage 2023-07-25

6 Items: entiregoods and services tax.a deduction from the usual cost of something.can refer to the monetary charge for borrowing money.relating to a system of numbers that is smaller than 1.a small or tiny part, amount, or proportion of something

Jesus and the Miraculous Catch of Fish 2015-04-06

10 Items: netfishlordboatjesuspeterthirdgalileedisciplebreakfast

Sciences of the World: Gmo's and Cells! 2016-02-21

10 Items: GRASGenomeGeneSplicingModificationBiotechnologyCrossBreedingrecombinantDNASelectivebreedingGeneticengineeringGeneticallyModifiedFood

Words with ch, sh,th and wh 2020-11-03

10 Items: shedwhipchimpbenchwhisklunchbrushshelfthinkcloth

Lesson 2: Caring for tools and paraphernalia 2017-09-16

10 Items: blenderairppotflatironcoffeemakerstethoscopethermometerfoodprocessorvacuumcleanerwashingmachineSpygmomanometer

Enhance your life with mindfulness and meditation 2024-03-02

10 Items: nowfocusenhancebreatheserenitymeditationexperiencemindfulnesstranquilityconsciousness

Dare to explore your dreams and aspirations 2024-03-04

10 Items: darewishhopegoalsdreamspursueexploreachieveambitionaspirations

LD New Claim 2023-09-25

18 Items: Where do you put the check amount in the Claim Detail box?In step #5, what do you have to click to link the new claim to IIM?In the greeting, we ask for the ______ ________ to search for the claim.If the caller does not have a loan #, what system can you use to find it?Where in the Module do you go to begin the process of opening a new claim?...

FRIENDSHIP BY HECTOR AND PETER 2023-03-09

6 Items: kindcaringlovingsharesacceptslistener

Respiratory Word Search 2023-05-12

14 Items: Voice boxNo airflow#1 Instructor"Dang it _______"Difficulty swallowing#1 risk factor for COPDPH-7.25 PAC02-52 HCO3-24Measures the lungs air capacityInflammation of the pleural liningsPartial of complete collapse of the lungPosition you will typically see COPD patient in1st drug used for obstructive pulmonary diseases...

human system word search(chen jye) 2024-06-03

5 Items: digestion ends thereit softens your foodit plumps out blood for your bodysystem it is a system that helps you digest your foodit protects your brain and it is part of your skeletal system

Tasheel-ut-Tareekh: Building of the Kaabah and Young adult 2015-10-16

46 Items: ManWiseIdeaRichTripFloodFightBlackStoneSheetHappyWrongGoodsWomanMoneyKaabahMakkahTribesJannahSpreadCentreChiefsTribesHeightLiftedSolvedHonestProfitDamagedMorningProblemMannersFriendsKhadijaCaravanServantAccountPositionTogetherMayserahBusinessCompletedHajreAswadRasulullahSafekeepingTruthfullness

Week 3 - R Influenced Vowels - IR, UR, ER and OR 2023-05-03

20 Items: storycircusthirtypurpleplayerpersoneraserworthybeforethirstyfurtherhurtingcurtaincertainchapterwordingworkingbirthdaythirteenhomework

Word Search Day 3 - second lab on Flowers and Fruits 2023-06-30

31 Items: eggnutpomeseedberrycalyxdrupeovaryovulestyleantherembryoflowerlegumepetalspollensepalsstamenstigmazygoteantherscorollapedicelfolliclegynociumperianthendospermfilamentsandroeciummicrosporeplacentation

Rush Revere and the Brave Pilgrims: Ch. 1-4 Vocabulary 2024-01-07

20 Items: hard timesvery stormyvery confidentgreatly surpriseda strainer for foodnot clearly outlinedto bulge or swell outquestioning thoroughlyto act in a loving wayhappening in an instantto think over carefullyhaving or showing successa beginner with no experienceshowing doubt or unwillingnessfeeling or showing embarrassment...

From Orchard to Table: A Fruits and Vegetables Word Search 2024-03-28

25 Items: figkiwipearplumlimeapplegrapepeachmangolemonbananaorangecherrypapayaavocadococonutapricotpineappleblueberryraspberrywatermelonstrawberrygrapefruitcantaloupepassionfruit

Unveiling Solar Power: Harnessing Sunlight to Energize Homes and EnvironmentsSunlightPhotonsEnergyHarnessingParticlesSolarPanelsMaterials 2024-04-18

20 Items: solarenergypanelslightsexcessphotonsexcitedcurrentsunlightinverterparticlesmaterialselectronsharnessingappliancesefficientlyelectricityalternatingsustainableenvironmentally

Westward to the Pacific & New Settlers to California and Utah 2022-04-25

32 Items: SpainTrailYoungSmithOregonRussiaCayusePacificSpanishBritainmeaslesWhitmandoubledcitizenbalanceMormonsDeseretLandLawschoonerSaltLakegoldrushfortynineSouthPassrendezvousvigilantesmountainmenfortyninersCaliforniosminingcampsmissionariesManifestDestinyManifestDestiny

Term 3 - Week 8 - Prefixes - 'un', 're', 'up', and 'mid' 2023-07-12

20 Items: uponuntieupsetunablereturnrepeatrecallremakemiddayunhappyunusualuncleanreplacerecycleuprightupgrademidyearmidweekmidnightmidmorning

Números en Inglés y Español - Numbers in English and Spanish 2024-01-30

20 Items: onetwosixtenfourfiveninethreeseveneighteleventwelvetwentyfifteensixteenthirteenfourteeneighteennineteenseventeen

8th Grade Forces and Energy Chapter 4 Vocab 2024-01-04

13 Items: lawenergyelasticnuclearchemicalmechanicalelectricalconservationkineticenergygravitationaltransformationpotentialenergyelectromagnetic

8th Grade Forces and Energy Chapter 4 Hints 2024-01-04

13 Items: scientific ruleenergy of electric chargesability to do work or cause changeenergy of stretched or compressed objectsenergy that an object has due to its motionpotential energy stored in the nucleus of an atompotential energy that depends on the height of an objectform of potential energy that is stored in chemical bonds between atoms...

technology and innovation vocabulary for IELTS (4) www.atomicielts.com 2024-09-01

13 Items: twinblockchainsmartgreenhomescitiesdigitalemergingfuturistictechnologytechnologiestelemedicine

Shopping Vocab 2023-05-23

14 Items: when an item is on sale for some timehaving an illness or some other problemwhen you don't have anymore of somethinghow much something costs in a store or onlinemoney given back to you when you pay too muchhaving enough money to buy something you wantgive the money to someone that you borrowed from...

Ario's Word Search 2023-12-18

7 Items: and phenomenameans going around in a circlemeans to send to give out lighta group of planets orbiting the sunis a rock in space that is hitting Earthis a natural science that studies celestialAstronaut is a person who walks on the Moon

Online Trading 2022-05-27

6 Items: Hello,Regards,Gabriel.Consultant.Charlotte Gabriel, An online trading Coash. I want you to know that online trading (Crypto, Forex and Binary option) is a good thing if you have a good trading strategy, I use to lose a lot of funds in online trading before I got to where I am today. If y...

Dig the sand and find the treasure! 2021-11-03

10 Items: poolmaskcrabboatzebrayaughtturtlebikinidolphinwatermelon

5.4 common injuries and disorders of muscles 2022-11-17

10 Items: herniagradeiiicontusionshinsplinttendinitistendinosismusclecrampsmusclestrainmusculardystrophymyositisossificans

Conflict, Culture of Peace, and Plastic Disposal 2023-10-05

10 Items: peaceacceptlistenrecycleplasticrespectconflictnegotiationdisagreementcultureofpeace

Prioritize rest and relaxation for well-being. 2024-03-02

10 Items: restcalmsleeppeacequietunwindbreatheserenityrechargerelaxation

Chase your dreams and set your goals 2024-03-02

10 Items: setaimchasewishesfutureaspireachievesuccessambitionobjectives

jacob and the Angel of the Lord 2024-05-29

10 Items: godhiplordjacobangelisaacisraelcanaanfigurewrestled

Harry Potter and the Sorcerer's Stone Ch 7-10 2018-01-17

16 Items: keenburlyspitedronedfrantichobbledjavelinjostledberserkambitioninfusionlumberedensnaringgloatinglytriumphanttransparent

Myasthenia gravis signs and symptoms 2022-10-12

6 Items: chewingdiplopiaspeakingswallowingin eyelidsin facial expression

The earth and its atmosphere 2022-11-22

6 Items: catlionzebrahippoelephantMan's best friend

Roots and the Middle Passage 2022-12-19

6 Items: catlionzebrahippoelephantMan's best friend

Spelling list 2022-08-07

10 Items: a place to keep fishto make a place cleana tool to sweep the floora place for eating picnicsthe written words of a playa plastic or glass containeran area where you buy presentssomething that stores chemical energypaper and other garbabe on the grounda letter containing messages of good wishes

Every Summer After Vocab 2 Word Search 2023-06-02

10 Items: By reasonable assumptionNot disputed or challengedTo give a false appearance ofTo wind or twist into circlesMarked by kindness and courtesyStanding out or readily noticeableTo rise or roll in waves or surgesMaking someone annoyed or irritatedTo fail or slowly end after a startMarked by lack of plan, order, or direction

Vocabulary Builder 2023-12-08

10 Items: To leave out or excludeHaving a sharp edge or pointLacking interest or excitementCalm, peaceful, and untroubledTo express sorrow or grief audiblyHaving or showing tact; diplomaticTo think deeply or consider carefullyAttractively unusual or old fashionedTo move back or away from a point or limitA beginner or someone new to a field or activity

Leahs space themed word sherch 2023-12-18

10 Items: The start of springPeople that study spaceAlso known as Urisa minorAlso known as Urisa majourStars that make shapes in the skygive off, send forth,or dischargeThe reserch of eveything in the universeThe beliefs of the position of the starsmeans the sortist day of winter solsticeDust and ice particals that orbit the sun

Tangerine Vocab Set 1 Word Search 2023-01-24

10 Items: steadilyopposite of beliefsynonym for restlesswork jointly toward the same enda word to describe a wild animalyou usually do this before sportssounds like a government/political wordmake full use of and derive benefit fromWhen the old lady crossed the street, I stopped _____go or move back or further away from a previous position

Charlotte's Web Chapters 21-22 2023-06-27

10 Items: a serious promisea flow of cool airto welcome someoneextremely upset and unhappyto bring or get something backto take a long time to do somethingsomething that you do to help someoneneeding or wanting something very muchto bite something with a lot of small biteseverything that is around or near somebody/something

STD word search 2023-11-02

10 Items: Bacterial stdBest way to avoid any STDIf untreated syphilis can becomeInfection of the reproductive tractcauses painful blisters on the skinSTD that is caused by tiny parasitesCan cause bladder and urethral infectionsgonorrhea can attack the joints leading tomen may have a thick, pale yellow dischargeIncurable STD that sometimes resolves itself

Spelling 6 2024-03-27

10 Items: opposite of shortthe opposite of pushanother word for nicethe solid form of waterthe eighth month of the yearused to make windows and cupspart of an animals foot, especially catsa mineral used in jewelry, like a diamonda small round piece of metal used for moneyparts of the body muscles connect to (plural)

5.2 Adjectives that Describe Emotions and Conditions 2018-05-16

10 Items: suciosalegreenojadoocupadoseguroscansadoenamoradoconfundidapreocupadosavergonzadas

anime names and hero names of anime 2021-05-04

10 Items: eridekumomoshototitanhawksallmightgrapeboymyheroacdemiaattackontitan

A Man Called Ove Words and Characters 2023-01-03

10 Items: ovesaabsonjapatricksuicideparvanehisolationinjusticedepressionwillingness

Words with 'are' and 'ear' as /air/ 2021-04-22

10 Items: bearpearweartearbarecaresharesparestarescared

Live in harmony with yourself and others. 2024-03-02

10 Items: loveliveunitypeaceshareharmonybalancerespectcoexisttogether

Reconnect with nature for healing and peace. 2024-03-03

10 Items: lifepeaceearthgreennaturehealingharmonyserenityreconnectenvironment

Rise above adversity with hope and courage 2024-03-04

10 Items: risehopeabovecouragetriumphovercomestrengthadversitypersevereresilience

Letters of the Week - H and G 2024-05-15

10 Items: hathandgoathousehorseheartgrapesglovesguitargiraffe

Time and the Faraway Mountain Word Search 2024-07-14

10 Items: portersanxiousresolvewondroushypnoticdisguisedtechniqueexpeditioncoordinatordetermination