health and wellness Word Searches

Mexico's Government 2024-10-09

8 Items: lasts six yearsdebates and makes lawsMexico has a _________ democracy.applies and makes sure laws are followedMexico's main authority is the __________.There is no _________ in Mexico's presidency.PAN, PRI, PT are examples of political __________.Mexico's main law, the ____________, was written in 1917.

G8 - Cells & Systems Vocab. 2022-11-14

38 Items: what something doesthe brain of the cellhow something is shapedmade up of only one cellstores water in the cellmade up of more than one cellan organ system that creates lifethere are 4 of these in your heartan organ system that helps you moveAll cells come from __________ cellskeeping a body's internal conditions stable...

Weathering, Erosion, and Deposition  2017-02-27

16 Items: icemovewindrockswaterbreakriverserosionchangesdepositcanyonsphysicalchemicalmountainsweatheringdeposition

Sports and Sporting Events 2020-10-16

16 Items: GolfTennisSoccerUSOpenFootballBaseballBasketballSuperBowelWimbeledonTheMastersHorseRacingKentuckyDerbyMLBAllStarGameNBAAllStarGamePGAChampionshipUSOpenChampionship

The months and seasons 2021-05-04

16 Items: MayJuneJulyMarchAprilAugustWinterSpringSummerAutumnJanuaryOctoberFebruaryNovemberDecemberSeptember

WORDSEARCH Lautaro and RAMIRO. 2022-09-28

16 Items: dogsmeatcokericefishcakemilkfruitsaladpizzachipsdairychessevegetableshamburguerwatermelon

MINERALS and IGNEOUS ROCKS 2022-10-13

16 Items: All rocks are made of m_____________Rubbing a mineral on a tile forms a s______The igneous rock that floats on water: p_______The igneous rock underlying the College: g______When lava solidifies it forms this rock: b______Igneous rocks formed from expelled lava: e___________Extrusive igneous rocks tend to have s______ crystals...

Genes, Inheritance and Evolution 2022-11-30

16 Items: genesbasesallelesquaregenomepunnettproteindominantgenotypeorganismrecessivephenotypesynthesisvariationevolutioninheritance

Ceramics, Polymers and Composites 2023-03-10

16 Items: hardcfrpwoolstiffsolidstrongcottonrubberbrittleceramicspolymerscompositesinsulatorscarbonfibrenaturalpolymerssyntheticpolymers

S and Z spelling 2023-02-21

16 Items: ownbaseslippondyardareaplantlunchfrontthumpwidthinchesbetweencountryformulacalculate

AAA And Lia Crossword 2023-03-31

16 Items: corePointforcebatterycircuitCurrenttransferengineerfilamentcomponentcriterionradiationconstraintinsulationelectromagnetelectromagnetism

AV1 - Food and Cooking 2015-09-08

16 Items: rawfreshfriedstalefrozentinnedcookedboiledcerealsteamedcustardsavourypleasantbarbecuedmicrowavedcontainers

prefix -ful and -less 2024-05-29

16 Items: usefuluselessfearfulharmfulcarefulhopefulpowerfulfearlessharmlesscarelesshopelesspowerlessmeaningfulthoughtfulmeaninglessthoughtless

Chapter 4 and 5 2025-02-03

16 Items: PowerGenderAgencyAnalysisEthnicityLeadershipExpressionStereotypeEthnographyDisabilitiesInequilitiesSocioeconomicSubdisciplineModernizationPostmodernismIntercollegiate

HEPATIC STEATOSIS AND DISLIPIDAEMIA 2025-04-11

16 Items: Inflammation of the liverElevated blood sugar levelsFat accumulation in the liverElevated blood insulin levelsTissue where laminitis occursHormone secreted under stressVisceral fat-rich immune siteFatty acid abbreviation in bloodHormone regulating glucose uptakeOxygen shortage in adipose tissueKey immune cells in adipose tissue...

Animal welfare and rights 2025-04-23

16 Items: lawfearharmabuseveganhungerinjurytradedwelfarecrueltyneglectadvocacysurvivaldiscomfortfacilitatesslaughtered

Mr and Mrs Jenkins 2025-04-27

16 Items: BenBronItalyErnieRugbyPartyWeddingMidwifeBouquetSerenityMrandMrsSeptemberMauritiusLemoncelloTheJenkinsPembrokeshire

ng and nk words 2025-06-02

16 Items: banglongrungsingbringchunkcrankplonkstinkstungthankshrinkshrunkstronghanginghonking

Rebecca and Sam's Wordsearch 2025-06-29

16 Items: SamSuitCakeBrideGroomDressRingsDublinRebeccaFreddieBanburyTeacherTenerifePharmacyLeicesterSunflower

Vocab terms of Civil War 2025-03-18

20 Items: the freeing of the slavesa complete end to slaveryVirginia's federal arsenalA person whose owned by another persona warship that's heavily armored with irona political party formed in the 1850s to stop the spread of slavery in the Westa Union victory in the Civil War that marked bloodiest single day battle in American history...

Matrimony 2025-03-11

4 Items: vowsa sign of love and fidelityagreement made between God and is peoplefaithfulness to a person, duties, responsibilities

Wellness 2025-04-14

1 Item: Wellness, Mindfulness, Nutrition, Exercise, Sleep, Hydration, Relaxation, Gratitude, Serenity, Fitness, Health, Balance, Meditation, Positivity, Stretch, Energy

Toes and Foot Word Search 2024-07-16

20 Items: For an AP foot, the central ray is angled ___ ___ degrees.What part of the 5th metatarsal is on profile on an oblique foot?When positioning for lateral toes the 1st-3rd toes require ___ ____.When positioning for lateral toes the 4th-5th toes require ___ ____.For all positions of the toes how much of the metatarsals in required?...

wood department 2025-01-23

30 Items: flooring comes from the bark of a treeto add a vintage or rustic look to woodis a type of glue used in some installations___________ flooring is always 100% waterproof________is our entry price pint vinyl flooringare a method for attaching wood to subflooringanother method of attaching wood to subflooring...

—🔎 Can You Solve It? 🔍— 2023-05-30

6 Items: to poke with somethingwith hesitation or doubta violent criminal or troublemakerintensely irritated and frustratedwithout respect; in a disdainful mannersomeone who gives orders and feels superior or more important than others

POSTIES 1216 COVER 2024-11-25

6 Items: easily annoyedopposite of "positive"tired and wanting to sleepto run very fast for a short distance"_____ hormones" help us grow bigger and taller.We should get at least _____ hours of sleep every night.

Sports Medicine 2024-11-08

8 Items: DrugPressureConclusionPost-injuryBone damageTendon overuseDiagnostic toolsMovement and flexibility

Oregon Trail 2025-05-13

18 Items: You cook in itYou shoot with itThe transport to the westYou can put rice or corn in itThey had to cross many ______.You use it to tie things togetherWhere the trip to the west endedWhere the trip to the west startedRachel almost died of this sickness.The settlers went ....... (not east....)They also had to go over many _____________....

Oregon Trail 2025-05-13

18 Items: You cook in itYou shoot with itThe transport to the westYou can put rice or corn in itThey had to cross many ______.You use it to tie things togetherWhere the trip to the west endedWhere the trip to the west startedRachel almost died of this sickness.The settlers went ....... (not east....)They also had to go over many _____________....

Coconut 2025-06-06

6 Items: fatrawrlargescratchblack and whiteMan's best friend

Genocide Key Terminology 2024-02-06

16 Items: meet in the middleon the outside or on the edgedoes an illegal or harmful actfanatical political or religious viewsused to promote a certain point of viewlimiting or restraining, often by forcea person who belongs to a targeted groupindirect word use to hide or soften the truthmass expulsion or killing of a specific group...

ww5 u5 2024-03-25

16 Items: to get the better ofthe act of defeatingthe highest part, topshort and to the pointunwisely bold or daringearlier, happening beforea heavy snowstorm with strong windsrunning straight up and down; uprightone who looks at things in a positive wayto block or defeat the plans or efforts ofto invite others to take part in a contest...

Greek and Rome Theater  2016-01-27

16 Items: RomeGreekMimesMasksThemesActingActorsTheaterComediesCostumesOrchestraTragediesCharactersPerformanceTheatherofPompeyTheatherofMarcellus

Bikes and Bike Safety 2016-07-26

16 Items: bikelaneriderwaterbrakechaingearswheelpedalmountbottlesafetyspokesrepairhelmethandlebar

KS2 Food and body 2019-04-10

16 Items: fatsfibrewaterbonesrelaxjointsproteinmusclesvitaminsmineralsskeletoncontractnutritionnutrientsvertebratecarbohydrate

The months and seasons 2021-05-04

16 Items: MayJuneJulyMarchAprilAugustWinterSpringSummerAutumnJanuaryOctoberFebruaryNovemberDecemberSeptember

Cellular respiration and Photosynthesis 2022-05-27

16 Items: atph2oco2waterglucosesunlightconsumerproducerautotrophrespirationchloroplastchlorophyllheterotrophmitochondriaphotosynthesiscarbon-dioxide

Fitness and Skill components 2022-10-13

16 Items: eyeforceheartlungspowerspeedmuscleagilitybalancestrengthreactionendurancecompositionflexibilitycoordinationcardiovascular

People and the Ocean 2023-02-06

16 Items: preyfewerindianarcticanimalsextinctspeciespacificevidenceatlanticsouthernecosystempredatoorsdecreasingincreasingoverpopulated

Word Search_court and litigation 2023-06-15

16 Items: juryoathjudgetrialappealverdictwitnessdamagesbailiffattorneyevidencesubpoenaplaintiffdefendantdepositioncross-examination

Spelliing and Vocab 20 2023-11-14

16 Items: ringwavetearyardpupiltrialbrandnovelcranecourtwatchbordertemplebatterlittercabinet

Of Dusk and Dawn 2024-03-12

16 Items: ruesulzarabriasethlenaleoranahlaroryntorbencephasrhennaaveragepelekaostruggletheodore

Fossils and its types 2024-10-03

16 Items: ResinProofFossilsEvidenceFootprintBitemarksExtinctionMoldFossilsCastFossilsmineralizedAmberFossilSedimentaryTraceFossilsFrozenFossiloriginalstateTrueBodyFossils

Unit 9 and 10 2024-10-16

16 Items: 구슬걸다공주마음순간대양쓰레기떨어져행운의머무르다불가사리사랑하는대답하다알록달록하게

Tricky Words and Brainrot 2025-02-27

16 Items: CoolCheesyJawlineFashionPer yearEvil toiletsUltimate rizzlerJawline BraggingA required amountBackside BrainrotBrain differencessymbolises thingsa musical instrumentlike butter but cheesyOne of the longest wordsThe ultimate skibidi mewing rizzler

Erosion, Deposition, and Landforms 2025-03-03

16 Items: CanyonFossilPlateauTsunamiAncientErosionMountainPreserveLandformSedimentDepositionWeatheringLithospherePrehistoricAbsoluteageSedimentaryrock

Healthy and unhealthy habits 2025-03-20

16 Items: foodWatchTVExerciseEatfruitsSleepwellDrinksodaSleeplatenofriendsDrinkwaterPlayoutsideEatbreakfastNotshoweringeatvegetablesWashyourhandsBrushyourteethPlayvideogames

Week 33 and 34 2025-04-04

16 Items: UnloadPropelRewindConcordTransferTransectConcludeOdorlessWitheringPromotionPennilessConsensusTranscribeReconsiderUncomfortableSimultaneously

Word Search and Dogs 2025-05-01

16 Items: petdownlazywordswalksfetchsearchpuzzlecollartreatsplayfuldiagonalbackwardsenergeticchallengingmansbestfriend

The carboniferous period 2023-10-05

10 Items: Lasted about 60 million yearsthe big land mass before pangeabefore it was called just oxyegeneplant from the carboniferous perioda supercontnant formed from gondwanaa sea animal during the carboniferous periodcorals One of the carboniferous periods animalsa reasource from the earth that is nonrenweable....

Human Flourishing 2024-12-11

10 Items: the understanding of who a person isan example of a virtue; related to truthour identity as Christians is given by ______a quality considered good and helpful for a personour _________ or values affect the way we see lifeour growth as humans involves the _______ of others.as Christians we believe we are _________ of the Creator....

Fun with Ian 2025-01-22

10 Items: A big smileA color like snow or cloudsA small river where water flowsTalking very softly, like a secretA big area full of trees and animalsTo go look around and find new things.A word we use to ask about something, like, “What is this?”A word we use to ask for a reason, like, “Why is the sky blue?”...

Conflict, Culture of Peace, and Plastic Disposal 2023-09-21

10 Items: a reflection of God's Kingdomis the best way to solve conflictis a strategy for solving disputesa physical struggle or a disagreement of some sortone benefit of separating waste is it reduces ______.is a disposition, a culture, a process, and an outcomeis the institution that developed the culture of peace...

Ruth Word Search 2024-11-10

10 Items: Who was Naomi's husband?Who was Ruth's first born son?Who did Boaz buy property from?Which daughter-in-law left with Naomi?Whose field did Ruth work in gathering grain?Where did Naomi go to live because of the famine?Who was Naomi's other daughter-in-law besides Ruth?Naomi told Ruth to uncover what on Boaz and lay down?...

Women's History Month 2025-03-17

14 Items: First American woman in space.Founder of the American Red Cross.First female Prime Minister of India.First female Prime Minister of the UK.Mexican artist known for her self-portraits.Queen of England during the Elizabethan era.First Lady of the U.S. and human rights advocate.Advocate for people with disabilities and author....

Dungeons and Dragons - Tess Martin 2024-02-07

15 Items: I RAGEMagic doctorInt. +3 Str -2Stealy stealy!Opposite of sci-fiOur group of playersHorns face backwardsImprov with an accentPrison, but old-timeyWhack whack with swordGrizzly and wise, DnD mascotThey're always off on a questYou cheer when you get one naturallyClassic fantasy race with pointy ears...

IT and computers 2015-02-23

11 Items: MouseSystemDisplayWindowsKeyboardHarddriveDiskdriveMotherboardgraphicscardLoudspeakersComputercable

Weathering and Erosion  2015-12-09

11 Items: rainfrostplantserosionanimalschemicalweatheringmechanicaldepositiondenudationtemperature

fruit and vegetables 2017-04-08

11 Items: plumpearapplebananagrapestomatopotatocarrotcucumberblueberrywatermelon

Landforms and adjectives 2018-04-18

11 Items: hotbigtallcoldoceanrocksheavyfrozenvolcanoglaciermountain

Abilities and Requests 2020-10-01

11 Items: sewskifixsingswimdrawcookknitdancedrivepaint

Forces and Fields 2021-01-21

11 Items: RepelProtonMagnetCurrentAttractCircuitElectronElectricFieldElectricForcesElectricChargeStaticElectricity

Tim and Gladys 2022-09-15

11 Items: robjanrodmarybilltyjagreggangiejalenjewelcherity

Weathering and Erosion  2021-02-05

11 Items: IceAcidRustWindWaterErosionSedimentWeatheringDepositionPhysicalWeatheringChemicalWeathering

21 and 22 2023-11-02

11 Items: wavyrosesightmarblegulpedgentlyearliermukluksdinosaurskeletonplayfully

Art and Creativity 2024-04-09

11 Items: easelsketchpalettemontagetextilescharcoalpaintnsiptechniquepuffnpaintspraypaintpaintballs

Uniform and Dril 2024-04-11

11 Items: uniformleftfacespinningblacktierightfaceaboutfaceattentionblacksocksrankinsigniapolishedshoesservicedressblues

MATERIALS AND FEATURES 2024-09-09

11 Items: woodsoftmetalclothpaperglassroughshinysmoothstickyplastic

Planets and Space 2024-11-13

11 Items: SunMarsMoonEarthVenusStarsOrbitCometSaturnGalaxyJupiter

me and janae 2025-01-04

11 Items: kiss?my fav snackwhat you aremy fav animalanother word for gayhow you make me feelanother word for lovewhat i call you (sweet)what we call each otheryou call me this adjectiveanother thing i call you (p)

Cost and profit 2025-01-21

11 Items: CostPriceProfitBreakevenFixedcostsValueAddedCostperunitSellingassetsVariablecostsSocialObjectiveEconomiesofScale

Art and media 2025-01-28

11 Items: djartbuskerconcertgallerymagazinepaintingnewspapersculptureexhibitionjournalist

Money and Banking 2025-02-12

11 Items: scamlossstockprofitdefrauddisguisecommodityinterestratecryptocurrencytradingplatformfinancialliteracy

Plants and Ecosystems 2025-04-04

11 Items: AirSunFungiWaterPlantsAnimalsShelterProducerBacteriaEcosystemPhotosynthesis

Terminology 2024-10-17

10 Items: – "Swifter than a bird flies."– "This is the end of the world."– "twisted steel and splintered woodwork."– "It would be difficult to imagine a nicer sort of railway accident."– "The Trans-Siberian Express train sprawled foolishly down the embankment."– "It had a defiant and naughty look; it was definitely conscious of indiscretion."...

Class communication 2024-07-22

13 Items: writerepeatcome-herecopy-this-listen-to-meread-the-textpay-attentionwork-in-pairsrice-your-handlisten-and-repeatopen-your-notebooklook-at-the-picturesanswer-the-questions

Tracking the Weather Book Vocabulary 2025-02-17

10 Items: _____________________ the mass of air that surrounds Earth._____________ a device that uses radio waves to find objects.___________________ an instrument for measuring air pressure.______ ________ an instrument that shows how much rain has fallen.___________________ instrument for measuring the speed of the wind....

Business Word Search 2025-02-18

10 Items: a type of businessnot able to be relied upon.extremely competent in a jobintended to mislead or cheat.not showing a proper sense of responsibility.A person's regular occupation, profession, or trade.having or showing intense and eager enjoyment, interest, or approval.a way of speaking or writing that is precise, elevated, and impersonal...

Quarter 3 Vocab Review Part 2 2025-03-13

10 Items: extremely tiring and demandingto move or act slowly; to delayconfused and slightly worried; puzzleda large or excessive amount of somethingto match or surpass; typically by imitationto gather information or material bit by bitto give new energy to or restore back to a former conditionto move toward the same point and come closer together or meet...

Word Roots from Latin and Greek (Advanced) 2025-04-14

10 Items: THERMAL : Related to heat or temperature.CREDIBLE : Capable of being believed or trusted.AQUATIC : Relating to water; living or growing in water.THERMOMETER : An instrument used to measure temperature.CHRONOLOGY : The study of time and the sequence of events.BIOLOGY : The scientific study of life and living organisms....

Earth Day Review 2025-05-06

10 Items: reduce, reuse, and _________month where we celebrate Earth Daythese cover more than 70% of our planetcountry where the first Earth Day was celebratedthe largest civic celebration to protect our planetinstead of buy water bottles you should use a _________one of our main problems are air, water, and ground _______...

History 2025-02-03

20 Items: Austrian neurologistGerman philosopher essayistseries of domestic programshe dictator of Nazi Germanya philosophy of human naturea far-right form of governmentled by Adolf Hitler in Germanyby Albert Einstein between 1907-1915gov. which several parties cooperateAmerican aviator and military officerEmperor of Japan during World War II....

Colours and Pirates 2016-09-02

11 Items: redbluegreypinkblackwhitebrowngreenbeardColoursPirates

Foods and Drinks 2021-01-19

11 Items: foodmeatmilksodafruitbreadjuicecheesecoffeeyogurtvegetables

Potter and Clay 2023-07-10

11 Items: mangodboygirlclaymakewomanwheelpottermotherfather

Ben and Me  2014-04-09

11 Items: pleaaffrayhorridsingedembassyconversefirebrandmanifestodowntroddenaquaintancesuspiciously

Dave and Yuni 2017-04-27

12 Items: BATCANDOGFOXHITJAMCANKENGOATKIWINOSEJEEP

Uniform and Dril 2024-04-11

11 Items: uniformleftfacespinningblacktierightfaceaboutfaceattentionblacksocksrankinsigniapolishedshoesservicedressblues

countries and languages 2024-04-25

11 Items: japanindiahindipolandarabicgermanrussiacanadaspanishthialandaustralia

Bobby and Kyle 2024-05-08

11 Items: kylearmsbobbypukeswakingupgetsangryworstdreamcaliforniafenceshakinggetbettersoonkylesintrouble

STYLES AND PATTERNS 2024-07-22

11 Items: plainbaggysmarttightstylesfloralcasualcheckedspottedstripedpatterns

Chance and Abigail 2024-11-07

11 Items: TruckTacosAugustMoviesMuffinTractorTeacherVirginiaAirForceSoulmatesBestFriend

Countries and Nationalities 2024-11-10

11 Items: swissspainfrenchgermanrussiagreecebritishalbaniaenglanditalianportuguese

Mindfulness and Coaching 2025-01-16

11 Items: HealCalmCoachFocusAwareRelaxResetGrowthBreathMindsetJournal

Hobbies and Interests 2025-02-01

11 Items: sodukoorigamifrisbeeparkouryodelingknittingkayakingembossingcalligraphyglassblowingscrapbooking

TRAINING AND RECUITMENT 2025-02-04

11 Items: who here has an iphoneextertnal recruitment methodsadvantage of internal recuitmentadvanatage of off the job trainingdisadvantage of on the job trainingemployer looks for candidates within the organizationthe process of finding an hiring the best qualified candiatelearning the task away from the job, either at the workplace or exteranlly...

Cain and Abel 2025-04-29

11 Items: EVESINCAINABELADAMANGRYFARMERGENESISBROTHEROFFERINGSHEPHERD

Asena and serene 2025-05-06

11 Items: yieldgrievepiercereliefshielddieselmischiefretrievehullabalooachievementhandkerchief

Biology final review 2022-12-15

24 Items: Center of cellBasic unit of lifeNegatively charged ionsolute is dissolved inIndividual living thingconcentration of H ionsProduces hydroxide ionsSubstance that dissolvedforms H ions in solutioncontains one type of atomDiffer in number of neutronsEvenly distributed componentsSmallest functional unit of lifeElectrons are shared between atoms...

TOP 10 HORSE BREEDS 2024-01-18

10 Items: Are cold blooded, heavy horses known for doing work pulling heavy loads.An exceptionally cooperative breed with an eagerness to please its human.A horse that's fully grown at 14.2 hands (57 inches) or less is considered a pony.A category of horses that have been selectively bred for a smooth ride or ambling gait....