health and wellness Word Searches

Coast Word Search 2025-08-01

16 Items: The movement of sedimentThe distance a wave has traveledAn area where the land meets the seaFine material is carried along in the waterThe dropping of material due to a loss of energyThe movement of water up a beach as a wave breaksThe covering of land with a large amount of waterLarge boulders and rocks are rolled along the sea bed...

Christmas 2025-11-30

7 Items: globestoppersWreathsStockingsand baublesNutcrackersand garlands

unit 6 A 2025-04-24

10 Items: 죽다건강심장규칙돌보다동물원기억하다먹이를 주다

Take a mental health break! 2022-08-23

15 Items: graftresinbridgeenameldenturesealantimpactedmandibleocclusalalignmentcompositetreatmentextractionodontogenicperiodontics

Dns Word Search 2025-06-20

15 Items: Converts web addresses to IPsProject management methodologiesOverall experience and usabilitySystem to track changes (e.g., Git)Designing for mobile before desktopCode that is free and shared publiclyImprove code without changing behaviorService that stores your website onlineVisual elements the user interacts with...

Lymphatic System Word Search 2026-05-26

9 Items: trains t-cells to help fight disease and infectionnoncancerous fluid-filled cysts in the lymphatic systeminterstitial fluid accumulates in tissues and leads to swellinggives nutrients to cells and tissues, gets rid of harmful intrudersstores helpful bacteria and harbors immune cells to be used in the future...

Ecology: Word Search 2025-10-03

41 Items: Eat plants.Eat other animals.Consume dead animals.Single living entitiesBoth organisms benefit.Living parts of an ecosystemEat both plants and animals.The variety of life in an area.Nonliving aspects of an ecosystemThe number of species in an area.Neither organism affects the other.Consume dead organic matter (detritus)....

Camp Tucker Week 8 - Relax and Recharge Week 2025-07-22

118 Items: SPAGELTUBSPASUNZENBATHBODYCALMCAMPCARECOMBCOOLCOVECOZYIRONEYESHAIRMASKROBESANDSKINCARESOAKSOAPSOFTTOESWARMWASHBROWSCLEANDETOXGRANDDRYERHAPPYHOTELMUSICBRUSHOASISPARTYRELAXA DUBSALONSAUNASTEAMTOWELWATERWRAPSBAMBOOBEAUTYCANDLEENERGYFACIALFLUFFYGENTLEHEALTHLASHESLIGHTSLOTIONLUXURYMAKEUPMIRRORPOLISHRESORTSERENESMELLSTICKLETUCKERWAXINGBALANCEBLANKET...

Spanish Vocabulary 2023-04-19

20 Items: catdogauntcamerafathermotherbrothercousinshusbandparentschildrendaughterdecorationsgrandfathergrandmothergrandparentscousin (male)aunts and unclecousin (female)brothers and sisters

The Crucible Vocabulary Review 2025-02-27

37 Items: bitliefbasinladlefactoagapegauntpoppetseededchristgibbetjoshuacleavelecheryprobitygullingandoveradamanthysteriaand abeldesolateclemencydenounceaffidavitcallouslybewitchedrepreievepenitencerescindedmagistrateand tobiaseffronteryproceedingsremorselessdisputationcondemnationconciliatory

ww4 u10 2024-06-07

14 Items: What _______ you?The knight ______ the dragon.What is the _________ of the lake?What are the ________ you are experiencing today?The dog _______ from the sound of the vacuum cleaner.It is kind to __________ your friend if they are sad.It is important to ______________ well in a friendship.The king decided to _________ the thief from the Kingdom....

The Secret of Kells 2025-09-26

18 Items: Writing tool made from a featherFierce raiders who destroy villagesA handwritten book decorated with artTreasure preserved in the Book of KellsPagan god of darkness defeated by BrendanIrish monastery famous for its manuscriptPrecious metal that makes the pages shineBlend of Christian faith and Celtic legendTheme showing belief in light and learning...

MSP Week Word Search - Hard 2023-11-09

36 Items: cosfppemcqancqanpdboppeboardjointrulesstaffactivealliedbylawshealthsourcemedicalprimaryqualitycourtesyemerituspoliciesgoverningphysicianspecialtystandardsambulatorycommissioncompetencyconsultingdelegationprivilegesaffiliativeregulationsprofessionalcertificationcredentialing

208 U2 2024-10-16

36 Items: PEendownclubhearsamecalltellpoorwhenbackjustfreeshowthinkwrongmagicrobotlearnteachstartcamerasoccerviolinhealthlessonfinishsciencesubjectChinesehistoryengineerfestivaldifficultinterestingmathematics

Fiber Word Search 2025-01-02

29 Items: RiskpainFiberTotalfruitwatersugargramstrackgrainsweighthealthsolublehealthyDiarrheabloatingBenefitsgel-likeDigestionInsolubledissolvesmovementsvegetablesregulationsupplementsConstipationinflammationinflammationfermentation

R U OK Word Search (Real Giving) 2025-09-10

36 Items: TimeCareHelpMoodSafeCheckListenFriendFamilySayingHealthMomentActionEnergySocialChangesSupportTalkingNoticedDevelopGenuineObserveConcernEmotionsTogetherServicesPreparedFeelingsReactionPersonalValidateCommunityEncourageConnectionMeaningfulConversation

Maslow's hierarchy of needs 2025-11-04

36 Items: AirFoodNeedsWaterSleepMaslowSafetyHealthFamilyStatusGrowthShelterRespectPurposeClothingSecurityStrengthMoralityHierarchyStabilityAffectionCommunityPotentialMotivationPsychologyProtectionEmploymentFriendshipConnectionConfidenceCreativityHomeostasisAchievementRecognitionFulfillmentRelationships

Gratitude & Appreciation 2025-11-25

36 Items: JOYPEACETRUSTTHANKSFAMILYHEALTHGROWTHSUPPORTRESPECTSUCCESSINSPIRETHANKFULKINDNESSLAUGHTERTEAMWORKGUIDANCEGRATITUDECOMMUNITYHAPPINESSGENEROSITYFRIENDSHIPCOLLEAGUESDEDICATIONINNOVATIONLEADERSHIPMENTORSHIPMOTIVATIONPOSITIVITYRESILIENCECONNECTIONACHIEVEMENTPARTNERSHIPRECOGNITIONAPPRECIATIONCOLLABORATIONENCOURAGEMENT

International Nurses Day 2026-05-10

35 Items: HOPEHEROCARELOVENURSELINACCTSIMSMILEHEARTHEALTHSAFETYSCRUBSVITALSCLINICEMPATHYHEALINGPATIENTSUPPORTCOMFORTTHERAPYRESPECTHYGIENEMONITORKINDNESSRECOVERYTEAMWORKSTRENGTHRadiationINJECTIONANESTHESIACOMPASSIONMEDICATIONSIMANDTREATSTETHOSCOPEBrachytherapy

Renaissance Word Search 2024-10-09

15 Items: Point of viewWrote the 95 thesesMajor branch of Protestantismrevival of art and literatureItalian painter and architectA republic in Southern EuropeKing of England from 1509 to 1547A fixed idea on a person or thingItalian artist, scientist, and inventorFrench theologian, pastor, and reformerItalian sculptor, painter, and architect...

#50 Puzzle 2024-09-02

50 Items: FITGYMRUNDIETWALKYOGARESTCALMMINDBODYSOULCARESLEEPWATERFRUITGREENCLEANFRESHRELAXHERBSDOCTORCLINICACTIVEENERGYIMMUNEMENTALSTRONGCARDIOINJURYMUSCLEOXYGENBALANCEBREATHECHECKUPHYGIENEORGANICTHERAPYAEROBICMASSAGEOBESITYEXERCISEMEDICINERECOVERYWELLNESSHOSPITALLONGEVITYNUTRITIONENDURANCELIFESTYLEFLEXIBILITY

Autumn Retirement Wordsearch 2025-10-07

50 Items: CozyHobbyPeaceBlissCrispAppleCiderGourdAmberTravelJoyfulCruiseUnwindAcornsLeavesColorsRustleChillyGoldenScenicHikingSpicesFreedomLeisureBalanceExploreHarvestBonfireSweaterEquinoxOrchardHayrideVacationSunshineWellnessSerenityCreativePumpkinsFestivalWoodlandAdventureDiscoveryReconnectCelebrateCornfieldRetirementRelaxationRecreationMindfulness...

Schools Office Word Search 2026-05-12

50 Items: DataBudgetEquityGrowthCultureSuccessSupportBehaviorCalendarCoachingLearningPlanningStaffingStrategyStudentsWellnessAcademicsAlignmentClassroomCommunityDiversityEducationInclusionPrincipalAttendanceAssessmentComplianceCurriculumDisciplineEngagementEnrollmentExcellenceGraduationInnovationLeadershipMentorshipOperationsResilienceAchievementDevelopment...

Unit 3 Review 2023-01-29

16 Items: of low quality, or not acceptableenjoyable, pleasant, or interesting:the liquid that comes from fruit or vegetablesthe flesh of an animal when it is used for fooda drink made with the juice of lemons, water, and sugara sweet food made with a mixture of flour, eggs, fat, and sugar...

Friend Word Search 2026-02-06

10 Items: - to give or use things together- being nice and caring to others- doing something good for someone- a happy face shared with friends- showing love and concern for others- paying attention when a friend talks- someone you like, trust, and play with- having fun together with games or toys- being with friends and helping each other...

Hypothalamus Word Search 2026-05-04

10 Items: Controls blood sugar (insulin)Controls metabolism (energy use)Controls sleep cycle (melatonin)Controls breathing and heartbeatConnects left and right brain sidesReproductive glands (ovaries/testes)Controls thinking and decision-makingControls hormones and keeps body balanceMaster gland” that controls other glands...

ERROR-PREVENTION 2026-03-03

7 Items: ARCCHANDOFFAND RESOLVECOMMUNICATIONWHY AND COMPLYQUALIFY VALIDATE VERIFYSTOP THINK ACT AND REVIEW

SCHOOL 2022-10-23

39 Items: gottWORKknoxzayetreythirdfifthlexiaWORDSstoneschoolmartinmurrayraptorfourthDREAMSpiercehaywardpencilsenglishwritingsciencehistorytomlisonhomeworkphysicaldivisionadditionsandstoneIN SCHOOLcomputerseducationelementaryAND DONUTSvocabularyAND MUFFINSsubtractionkindergartenmultiplication

Find & Focus: Word Search Adventure 2024-11-29

30 Items: CarsFishPetsBirdsSpaceworldherbsFruitsSportscitiesanimalsFlowersSeasonsInsectsHolidaysof treesproductsutensilsFurnitureJewelleryMushroomsphenomenaVegetablesof cheesescharactersinstrumentsand planetsof the pastof transportand fortresses

Authors Word Search 2025-03-18

34 Items: IdeaFactOrderCluesCauseValidIndexPrintInformEffectPurposeSummaryOpinionof ViewSynonymAntonymOpinionCaptionHeadingDiagramItalicsEvidencePersuadeFeaturesGlossaryInferenceEntertainSummarizeParaphraseSubheadingDescriptionof Contentsand Contrastand Solution

Grohl Word Search 2023-12-11

10 Items: Known for his work with Nirvana and Foo Fighters.Renowned for his drumming with The White Stripes.Famous for his precision with Pearl Jam and Soundgarden.Known for his energetic drumming with Queens of the Stone Age.Drummer for The Killers, contributing to their distinctive sound.Percussionist for Arcade Fire, with a dynamic and eclectic style....

Ocean friends 2026-06-02

10 Items: I have eight long arms to swim.I have a flat body and a long tail.I am the biggest animal in the ocean.I look like a tiny horse and swim upright.When I get scared, I puff up like a balloon!I am a small, orange pet that lives in a bowl.I have many sharp teeth and I am a fast swimmer.I am a smart and friendly animal that loves to jump....

ULTIMATE WORD SEARCH 2025-04-22

41 Items: Half girl, half fishThe king of the jungleHidden gold and jewelsA sneaky, fast fighterColorful arc after rainA spooky floating thingA colorful flying insectA tiny cake with frostingIt buzzes and makes honeyA slow animal with a shellA yellow fruit monkeys loveCold, sweet, and melts fastA horse with a magical hornA spiky plant in the desert...

osteichthyes 2025-04-30

23 Items: anemones.activities.fertilization.class of fish characterized by bony skeletons.Fish that migrate from freshwater to the ocean to spawn.Organs used by bony fish for extracting oxygen from water.An air-filled sac in many bony fish that helps control buoyancy.The tail fin, the main source of propulsion for forward movement....

First Aid Basics 2025-09-02

25 Items: Burns caused by heat exposurePain reliever and fever reducerBurn which damages the epidermisVaccine given to prevent tetanusAutomated external defibrillatorsBurns caused by friction on the skinInitial care given for an illness or injuryWhen a poisonous substance contacts the skinWhen a poisonous substance contacts the eyes...

GOOD HABITS DURING PANDEMIC 2023-02-19

31 Items: OFFsoapTHANsickHANDratewashneedhandscleanstepsavoidgermsWATERtimesaftergraphhabitsimpacthealthbeforepreventdrasticprotectrubbingneglectinfectedimportantspreadingbenefcialsignificant

Birthday Word Search 2024-06-01

30 Items: cryjoykidslayprayciaoliveloverestqueeniykyklaughpeacewomanflirtygrowthhealthwinningglamourbirthdaythrivingadultinggratefulit spicystabilityassurancecelebratecreativityomgimthirtyfantastical

addiction to social media: 2024-11-05

20 Items: TimeSpanMediaDetoxHealthAnxietyDopaminePatternsPressureAddictionIsolationDepressionDisruptionSelf-EsteemConsumptionProductivityGratificationCyberbullyingNotifications(Fear of Missing Out)

What's your 2025? 2024-12-23

35 Items: sadfunwowyesgivelovewarmrestrisekindhappypowertiredbravecleansmartenjoylaughtrustgreatquietnoisybetterhealthstrongwisdomfreedomforgivecreativehandsomegratefulpositiveprogressexcitingbeautiful

CEPH Accreditation 2025-10-15

35 Items: DataStaffPublicHealthSchoolDesignDegreePolicyAlumniFiscalCouncilFacultyServiceAccuracyResearchCriterionEducationReportingResourcesPersonnelVolunteersLeadershipComplianceCurriculumGovernanceAssessmentActivitiesGraduationTechnologyHospitalityEnvironmentRecruitmentIntroductionOrganizationAccreditation

Grocery Word Search 2025-11-24

35 Items: CakeCartCashSteakDairyMyersCheeseFloralHealthBeautyFrozenBakeryDirectBaggerOfficeDuggerKrinerGroceryProduceSeafoodChickenShopperCashierPricingElliottReceiverPharmacyLunchmeatAttendantBreakroomVegetablesTechnicianEmploymentDelicatessenReplenishment

Harmony 2026 2025-12-30

35 Items: PlayDarkheartGraceTrustLightHealthSafetyharmonyHealingServicePurposeUnknownBalanceDevotionSecuritycommunityExpansionAbundanceAwakeningAlignmentAwarenessAdventureWholenessGratitudeConnectionCocreationAcceptanceWorthinessDisciplineChannelingCelebrationSerendipityCollaborationSuperabundance

Unit 1 Key Terms 2025-05-30

22 Items: A person who designs any of a variety of things.An idea that produces a similar idea or an enhanced idea.A limit to a design process. ; A limitation or restriction.The ability to make or bring a new concept or idea into existenceA person using the services of a professional person or organization....

HUMAN BODY SYSTEM 2025-12-02

38 Items: Tissues that enable movement.Another word for a nerve cell.Organs where blood gets oxygen.A muscular sac that stores urine.The strong muscle that pumps blood.The watery fluid part of the blood.The red fluid pumped throughout the body.The windpipe that carries air to the lungs.The main control center of the nervous system....

w WORDS 2023-11-18

50 Items: winwildwisewellwarmwagewavewayswillwishwinkwheewhizwhoawilywinewhimwittywaivewatchwaterwholewhoopworthywantedwinnerwanderwhollyworldlywealthywelcomewaggingwakefulwarriorwarrantweddingwelfarewhipperwhisperwhittlewhopperwillingwillowywellnesswindfallwhimsicalwholesomewonderfulworthwhilewallflower

Welding Word Search 2025-06-09

50 Items: DNAHEXNHXNLXOILHAASIMTSRAILANGLEBLUCOBOOTSCOBOTOKUMAUFORMBAMBOOCLAMPSPCBOLTTOGGLEWRENCHZOMBIEBUSHINGCONSOLECULTUREFABTECHGERMANYMODULARWELDINGACCURACYASSEMBLYBENEFITSBLUPRINTDEMMELERHARDENEDWELLNESSDODGEBALLFIXTURINGHAPPYHOURMACHININGPRECISIONPROTOTYPEREFERRALSTOLERANCEINNOVATIONINSPECTIONENGINEERINGFABRICATIONMANIPULATORWORKSTATIONMAKEITBETTER...

MR.RENNER'S WORD SEARCH 2025-12-01

50 Items: DRCBusAEDMarcGRITRulesRennaSafetyEquityCoffeeGrowthLockerWalkieRespectSupportDigitalGodboutEmpathyHallwayCaffeineSecurityPositiveWellnessTeamworkHomeroomAdvisoryIntegrityMr.RennerAwarenessBelongingCommunityClassroomCafeteriaDismissalProceduresLeadershipTransitionHeadphonesConsistencyDailySplashRestorativeExpectationsConsequencesPreparedness...

Safety Word Search 2026-03-09

50 Items: CareHopeTrustSafetyListenFamilyRespectSupportProtectCourageEmpathyHealingNurtureKindnessStrengthGuidanceAdvocacyWellnessPatienceSecuritySafeHomeAwarenessBelongingPreventionProtectionCompassionConfidenceFriendshipSafeSpacesLovingCareChildSafetyCaringAdultsUnderstandingEncouragementSafeChildhoodFamilySupportSafeCommunityResponsibilityStrongFamilies...

Brianna Hart Ch.17 Vocab 2025-05-01

10 Items: Different molecular structures of the same element.Elements in groups 3 through 12 of the periodic table.Property of metals and alloys that allows them to be drawn into wires.Element that shares some properties with metals and some with nonmetals.Element, such as radium, whose nucleus breaks down and emits particles and energy....

Zora Neale Hurston 2026-04-14

10 Items: The last name of the authorThe implementation of social reform or new, liberal ideasLegalized system where people were bought and treated like propertyThe neighborhood that was the birthplace of a new wave of African American literatureCity where Hurston was born, and featured in many of her famed novels, such as this essay...

Topic 1 - Introduction to Geography 2025-10-07

10 Items: County that Telford is located inRegion that Telford is located in______ jobs provide services e.g. teacher______ jobs collect raw materials e.g. farmerMade up of 3 nations: England, Wales and ScotlandStudy of the Earth's surface, environments and people_______ geography is the study of people and manmade features...

Chapter 1 - The First Americans - myWorld Social Studies 2023-01-26

14 Items: to movethe system of growing crops for foodto change in order to live in a new placea group or family member who lived in the pasta large animal that once roamed the Great Plainssomeone who hunts animals and collects wild plants for fooda person who travels from place to place in order to survive...

Giraffe Word Search 2023-05-19

7 Items: an animal who is fat, gray and small.an animal who have big neck and is yellow.an animal fast, yellow or orange and violent.an animal who is Black and white, and have strips.an animal who is small, Black and walk underground.an animal who have a trank, if fat and live in forest.an animal who belongs to the tiger family and has a very loud roar.

Mental and Emotional Well-being 2025-04-14

10 Items: MOTIVATION : The internal drive to take action or achieve a goal.SELFESTEEM : Confidence and belief in one’s own worth or abilities.GRATITUDE : The feeling or expression of thankfulness and appreciation.INTROSPECT : To look inward and examine one's own thoughts and feelings....

Critical Words! 2023-01-07

21 Items: A missionBold and hardypopular DnD showWhere it all beginsScholarly magic userGoing on an adventure!Master of martial artsPriest of the old faithSurvive by avoiding noticeSpellcaster with inherent magicHoly warrior bound by sacred oathMagical people of otherworldly graceInspiring magician with musical powerWielder of magic derived from a bargain...

French Hierarchy Word Search 2025-03-27

10 Items: a form of government with a monarch at the heada division of a society based on social and economic statusthis war ended with Catholicism being the national religionprotected civilization from harm by raising a military servicehighest class, highly respected, cared for souls, and oversaw and ran religious events...

New Word Search 2024-12-30

15 Items: YearGoalPartyToastDreamCheersGrowthVisionFamilySparkleJanuaryStreamerCountdownHappinessProsperity

WORD SEARCH UNITS 1 & 2 2026-02-10

24 Items: happyworriedin good shapenot decoratedwilling to helpbroken or harmedtelling the truthnew completely newnot ordinary or usualhelping you do thingsrelaxed and not worriedexisting in large numberscaring only about yourselfold and not useful anymorequiet and doesn't laugh a lotable to be trusted or believednot helpful; doesn't work well...

Spanish 2026-04-21

31 Items: gesricefatsmeatfishpeasi dograpesgrainsbutteronionsyou docarrotschickenlettuceto walktomatoespastriespotatoesspaghettiice creambeefsteakIm hungryIm thirstygreen beansto exerciseto lift weightsfor ones healthbevera lacena dinnerprefiero i prefermantenerlasalud to maintain ones health

Democracy & Mexico's Government 2024-10-01

9 Items: govlasts six yearsdebates and makes lawsare composed of judgesit's composed of deputies and senatorsapplies and makes sure laws are followedform of government that depends on the will of the peopleone _________ is to preserve and promote the dignity of the individualMexico's government _________ are the Presidency, the Congress, and the Courts

ADJECTIVES ENDING IN -ED & -ING 2024-05-14

18 Items: Causing anxiety or concern.Causing astonishment or shock.Feeling great surprise or wonder.Feeling in need of rest or sleep.Causing great surprise or wonder.Feeling calm and free from stress.Causing someone to need rest or sleep.Causing curiosity or holding attention.Feeling very enthusiastic or very happy.Causing enthusiasm and extreme happiness....

9y nouns 2023-03-21

13 Items: WarMoneyHealthHungerRacismePovertyCrueltyBullyingHappinessInjusticeFriendshipInequalityThe pandemic

Summer safety 2026-01-29

11 Items: sweatingdizzinesssunglassespubliclibrarychronicconditionsUse a broad-spectrum sunscreen to protect your skin. Reapply at least every two hours—more often if you're swimming or sweating.Wear protective clothing, a wide-brimmed hat and sunglasses to further protect against sun exposure and skin cancer and eye damage....

Culture Word Search 2026-03-18

10 Items: - songs and sounds people enjoy- moving the body to music for fun- to enjoy a special time together- stories about people from the past- people living and helping together- pictures, crafts, and creative work- words people use to talk to each other- the way people live, eat, and celebrate- people who love and care for each other...

Healthy Word Search 2026-05-07

10 Items: - picking what you will do- not in danger and protected- a place to learn and stay safe- looking after yourself and others- saying you will do the right thing- a guide that helps keep people safe- feeling good and strong in your body- support from trusted adults or friends- a word used to stop or refuse something...

Chapter 7 Econ 2025-03-13

19 Items: Market structure characterized by a single producerGroup of firms producing similar or identical productsIllegal agreement by firms to charge a uniform price for a productPhilosphy that government should not interfere with business activityReal or imagined differences between competing products in the same industry...

Year 9 Personal Development 2023-24 2024-07-12

36 Items: safelifecarelawssharefaithlegalonlinehealthschoolrightsdebategenderofflinerespectempathyexploresupportcareersillegalconsentteamworkequalitywellbeingdiversitytolerancelisteningdiscussioncelebratingstereotypesregulationsimplicationsrelationshipsunderstandingcontraceptionresponsibilities

Word Search Wednesday 2025-01-09

32 Items: OMCPTSDMINORHEALTHNAUSEACANCERPATIENTCABINETID-CARDLICENSEREFERRALKENTUCKYEPILEPSYKYMEDCANDIAGNOSISMEDICINALCONDITIONCAREGIVERTELEHEALTHCARDHOLDERSPASTICITYREGISTEREDDISPENSARYCHRONICPAINAPPLICATIONPRACTITIONERCOMMONWEALTHNOTARYPUBLICOUT-OF-STATECERTIFICATIONMEDICALCANNABISLAW-ENFORCEMENT

Exercise 2025-08-20

36 Items: gymjogcorehikejumpmoveskipstepswimwalkyogaclimbcyclelungesitupsportsquatactivecrunchhealthtaichiwarmupbalancefitnessmusclespilatesstretchweightsworkoutaerobicsexertionvigoroustrampolinecirculationflexibilitycardiovascular

NIIO Bring Your Kid To Work Day 2026 2026-04-17

33 Items: NIIOFOODTOYSEMMAENTRYCOURTSTATEEMILYFAMILYPARENTHEALTHFUTURENEVAEHEVERLYDANIELSUPPORTPAYMENTARREARSOBLIGEEOBLIGORRONALDOEMPLOYERISABELLAMARLEYNEASSESMENTFINANCIALSINTERSTATEOBLIGATIONEVANGELINEENFORCEMENTMODIFICATIONJURISDICTIONESTABLISHMENT

drug word search 2026-04-28

35 Items: LSDusepotweedmethhighbraindrugssmokepillsthinkabusedeathopiodsdealere-cigshealthmemoryheroinalcoholcocaineadictionoverdosewithdrawunstableinhalantsspacedoutexpensivestimulantsdependancydepressantspeerpresurecannabinoidsimmunesystemhallucinogens

The Effects of Unionized Nursing on Patient Outcomes 2024-12-02

10 Items: SafetyBenefitsAdvocacyRetentionWhich act defines scope of practice and governs nursing unionization?Unionization provides reduced burnout and improved job satisfaction for this population.Unionization provides safer environments and consistent care standards for this population....

King Word Search 2025-12-15

10 Items: - being nice and caring to others.- a hopeful idea about a better future.- treating everyone the same and being just.- a person who helps guide and teach others.- the right to live, speak, and learn equally.- a talk given to share ideas with many people.- showing care and good behavior toward others....

Lesson D Reading Word Search 2023-11-15

16 Items: the action or practice of meditating.the accomplishment of an aim or purpose.a feeling of worry, nervousness, or unease.the state of being free from injury or illness.the state of being comfortable, healthy, or happy.focus a persons attention on a particular activity.to have optimistic, affirmative, and good feelings....

sj word search  2013-11-21

16 Items: andfiredbarredmarredsoaredstoredstirredstarredlearnedslurredburppedmonitersquirmedmerimackappomattoxindustrialized

Math 2014-10-21

16 Items: sumandprimeanglesproductdivisionadditiondivisiorequalityexponentsfractionscompositecalculatorsubtractionWordProblmesMultiplication

Gold M100W 2018-02-15

16 Items: itinoftobetheandwasthatMondayFridaySundayTuesdayThursdaySaturdayWednesday

Mac and Cheese  2019-05-23

16 Items: andpotdryforkwashwaterspoonplatecheesenapkindishesboilingcleanupmacaronistirringutensils

The Word Search 2024-11-29

16 Items: BeMeIfUsTheAndCanGotSheDidNotSeeLookBookLikeBecause

Word Search Large Print for Adults: 4000+ 2025-04-02

18 Items: ofonofandtheandCalmEasyEyesFullEnjoyHoursBrainGamesMentalVarietyRelaxingStimulation

High Frequency Word Search 2025-05-06

17 Items: bywhoouryouwasandhassaidfromwhatfromwouldcouldwhereothernumberanother

The Word Search 2025-06-23

19 Items: ISTHEANDANDTHEHARDUPONTHINGBEINGTHATISREALLYREALLYGIVINGWORKOFAMAZINGPERFECTBECOMINGYOURSELFBEGINNING

My Word Search 2025-07-27

18 Items: IamyismyisofatandlotbestnamehavefriendFarizaschoolFarishafriends

Millie's camp word saerch 2025-08-06

16 Items: andfoxbigclipfoodfreetimeflingswingsleepclimebdinnerlslandcabinesphillipbreakfast

The Lord is like a father to his children, tender and compassionate to those who fear him 2026-02-06

17 Items: aistotothehisandwhohimLordlikefearthosefathertenderchildrencompassionate

Proverbs 22:1 2026-02-08

19 Items: AISTOBEANDANDGOODNAMETHANTHANGOLDGREATFAVORRATHERCHOSENRICHESLOVINGRATHERSILVER

Cat Word Search 2026-04-21

16 Items: catdogtheandsatsadcarfogbatcanverythenfindplaylikeagain

26-27 Season Word Search 2026-05-26

12 Items: Holiday warmth wrapped in Irish music and dance.Four original Jersey Boys bring 60s hits to life.Passion, drama and the unmistakable rhythm of Argentina.Magic, mystery, and mind bending tricks from David Caserta.Dorothy’s journey reimagined with skating, sparkle and magic.A tribute packed with glitter, harmony, and Swedish pop perfection....

Birthday 2014-02-28

17 Items: 12345678910111213andnowyouare

Photosynthesis and Cellular Respiration 2021-11-01

17 Items: RawandfungiplantsglucosearchaeaanimalsProductsbacteriaprotistsmaterialsProducersConsumersAutographsRespirationHeterotrophsPhotosynthesis

Sports 2021-11-13

17 Items: andjudopolotrackfieldboxingridingrowingtennisarcherybowlingsailinglacrossehandballhorsebacktaekwandowrestling

sight words 2023-10-29

17 Items: iwemyitdoamgoheyouthecanseesheandlikehaveplay

Senior Adult Ministry - February 21, 2024 2024-02-21

17 Items: theandovermadeblackjesuscrosspublicpowershavinghistorydisarmedspectaclecolossianstriumphingauthoritiesmorningstar

Step 1 High Frequency Words 2024-05-24

17 Items: theandwashisyouarehasforoneintodoesyourwanttheyhavefromshall

Level A Week 1 2024-09-09

17 Items: aasadandcanmanaskhadhaswasaddplanhandthanthatlaststand

UFLI Review 2025-07-30

17 Items: ifinatistipnapfitsitpattintapfatmatpittheandsaid

Power Words Level 1 2025-10-14

17 Items: atifinitonupandbutcandidgethadhimitsnotjustwill

Zion words 2025-11-13

17 Items: PalPaySobCobBobJobTheDidAndMobPotHotSellGlobThisSaidOver

Sight Words 1 2025-12-18

17 Items: incarseeandboytheboxputballfishgirlhorsegreenyellowlittlechickenairplane

Conjunctions 2026-02-04

17 Items: ifasorsoforandbutnoryetwhensinceafterwhileuntilbeforebecausealthough