health and wellness Word Searches

Millies camp word serch 2025-08-05

12 Items: andcliprockwallclimbdinnerarcherypegwingcholatebreafastclimbingpillipiland

• W O R D S E A R C H • 2025-08-30

12 Items: byeaJforandJARSEarthMEDANKLINIKProjectBirthdaynatureaJREBOISASI

Las Clases 2026-01-28

17 Items: artmathbandlunchofficechorushealthsciencehistoryEnglishSpanishlibrarycookingbathroomcafeteriagymnasiumcomputers

The Skeletal and Muscular Systems 2025-02-12

20 Items: A point where two or more bones meet.The type of muscle found only in the heart.The bones that protect the lungs and heart.The longest and strongest bone in the human body.The series of small bones that form the backbone.A connective tissue that attaches muscles to bones.The type of muscle that is voluntary and moves bones....

IBDP Language B Identities Vocabulary Word Search 2025-09-04

25 Items: Usual ways of behaving in a cultureFeeling accepted and part of a groupThe country a person legally belongs toPrinciples or beliefs that guide behaviorJudging others unfairly before knowing themA group of people born around the same timeMoving from one country or region to anotherShowing your thoughts, feelings, or identity...

Quaint Word Search 2025-11-17

13 Items: paths for bicyclesfull of life and energypaved with rounded stonesunwanted or harmful soundbusy and full of activityspace area for vehicles outsidebeautiful and visually charminggently sloping landscape featuresarea where only walkers are allowedparking facility below ground levelregular travel between home and work...

TC1 2016-08-31

30 Items: PALabPSCGPMPHAHighBHOPNeedsNurseDoctorDentalRespectPatientPatientSurgeryPharmacyRadiologySick-CallTechnicianSpecialistAccessibleCommunicateReliabilityTrusted-CareCo-therapistWomen-HealthHigh-QualityMaximize-ValueShared-DecisionPatient-Preference

UM Word Search April 2025 2025-03-20

28 Items: SNFNecSOPDMERFICardLTACHAcuteSofiaPeazyPivotB DrugHealthIntakeReviewMembersCentralPharmacyDelegateClinicalRolloverInpatientInjectionConcurrentGlucometerOperationsObservationCoordinator

Caught in a MOSH! 2025-09-05

38 Items: vendedsunamihealthpolaristriviumiprevailslipknotknotfestmegadethinflamesmissmayimetallicababymetalhatebreednorthlanespiritboxlornashoreroyalbloodironmaidenamonamarthtothegraveBadreligionmachineheadfearfactoryiceninekillsparkwaydriveourlastenemyinheartswakeknockedloosebodysnatcherwecameasromansamityafflictionkillswitchengagewithintemptation...

That's Nuts! 2026-02-09

38 Items: NutLugDryrawoilPineKolaSheaHullPiliWingcocosaltmeatburrAcornShellDrupedrupeTigerdoughPecansAlmondBrazilWalnutKernelLegumeHealthbutterCashewsHickoryCoconutCuticleMarconaNutellaPistachioMacadamiabotanical

On Purpose. We Choose Our Profession On Purpose. 2026-02-28

29 Items: roompaincarecarenurseobgynhealthurologysurgeryclinicsdiseaseservicesdialysispracticepodiatrypodiatrycertifiedemergencyinpatienteducationradiologynephrologymanagementpreventionpulmonologyorthopedicsdermatologyrheumatologyurogynecology

Final Cold War Word Searchizzle 2023-03-15

11 Items: USSR Economic ReformA conflict that went hotUSSR Political Freedom ReformRivalry between the US and the USSRNo private property and classless societythe government sets production and pricesUSA policy to stop the spread of communismindividuals determine production and pricesLeader who tried to save the USSR with new reforms...

What's in my sandwich 2025-11-04

11 Items: I add crunch and color.I wear armor from the sea.I glide smoothly on bread.I melt when things get hot.I’m saucy and full of flavor.I bring sweetness to the mix.I swim before I fill your sandwich.I make your sandwich strong and savory.I’m always on top and bottom of the stack.I’m sticky, sweet, and love peanut butter....

Golden Words 2014-03-19

12 Items: Iainisitoftobetheandwasthat

Jason Spelling 2014-08-28

12 Items: myittheandyouallbutonewiththisworkhave

Search 45 - Shakespearean Quotations 2019-05-09

13 Items: AndActTwoTwoWhatLightRomeoSceneYonderWindowBreaksJulietThrough

Puzzle 1 2022-09-07

12 Items: atallandeveraboutearlyenougheitheritselfinterestimportantinformation

Lesson 13 2023-01-17

12 Items: myyoutheandyeswithwhatcomebrownpurplemondaysunday

Word Search 2023-02-15

12 Items: atoftoinisithetheandcancatsit

Gold Words 2023-06-23

12 Items: iabeinisitoftoandthewasthat

43565465342 2024-01-02

12 Items: andwiththiswordbookyourrelaxgiantbrainunwindsearchchallange

Psalm 24:1 2024-09-19

15 Items: inittoTheandtheanditstheLordearthworldbelongeverythinginhabitants

For Word Search 2024-11-08

12 Items: forsheredonebignothisandbluejumpintosaid

m100 search 2025-05-22

13 Items: ofitisinwasandyouwhythatthatwhatwhenwhere

What is a Pal Word Search 2025-09-07

12 Items: amatbesatmatdadmanandyouhelpwithplay

Heart Word Hunt 2025-12-04

12 Items: todoofmebeheasistheseeandsaid

Dan Word Search 2026-01-30

12 Items: ONITDANMINMATSADMADANDTHESAMSATSIT

Transformational leadership 2023-10-09

7 Items: communicate a shared vision and gives meaningleader provides constructive review and adviceinspires creativity and innovation and a challengethe ability to inspire trust and devotion in followersfollowers are empowered to take on roles & responsibilitiesfollower effort is recognized and celebrated with incentives...

Mexico Word Search 2026-03-14

10 Items: - people who celebrate together- moving the body to music for fun- bright shades used in decorations- to enjoy a special day with others- being able to live and choose freely- a march with people, music, and flags- songs and sounds played at celebrations- a cloth with green, white, and red colors- a country where this holiday is celebrated...

Plate Tectonics: 4.01-4.02 Vocabulary 2022-11-18

12 Items: CAPABLE OF BEING MOLDEDCAPABLE OF BEING MOLDEDTHE OUTERMOST LAYER OF EARTHTHE UPPER PART OF EARTH'S MANTLEUPPER MANTLE JUST BELOW LITHOSPHERESOLID IRON AND NICKEL LAYER OF EARTHTYPE OF CRUST THAT IS DENSE AND THINLIQUID IRON AND NICKEL LAYER OF EARTHTYPE OF CRUST THAT IS THICK AND LIGHTPART OF EARTH BENEATH THE CRUST MADE UP OF ROCK...

Health Word Search 2023-08-24

4 Items: healthsciencehygienedifferentiate

Docuhealth Word Search 2025-10-09

4 Items: HINHealthPatientDocuhealth

Gas Laws and Mixtures 2024-01-11

13 Items: a perfect gasunit with symbol kPaunit with symbol atmforce put on somethingshows particles of a substancemixture with the same propertiesmixture with different propertiescollisions where energy is transferredrelationship between pressure and volumerelationship between temperature and volumetemperature unit used for gas law questions...

Chapter 2: Mental and Emotional Wellness 2025-09-08

4 Items: reinforceresilienceself-esteemself-concept

Factors that Influence Product Design (F.U.N. T.E.A.M.S.) 2026-04-01

9 Items: The purpose of a product that makes it fit-for-use for its intentMaterials, tools and processes used in product design and productionThe end consumers of the product for whom and which the product is intendedThe identification of the purpose of a product from research and development...

Belonging Hub Word Search 2026-02-19

12 Items: Humana’s in-house AI platform (HINT: "Team + Tech")Enterprise Belonging & __________ Hub (HINT: "go.humana.com/belonging")Humana’s 2026 Employee Assistance Program Administrator (HINT: "Partner Hub")Name of our Well-being Rewards Program; “Personify ________” (HINT: "Partner Hub”)...

Golden Words 2014-03-19

12 Items: Iainisitoftobetheandwasthat

Group 2: 3rd and 5th grade #2 2020-03-30

12 Items: BEWEHEANDSEEYOUARELOOKGIRLWANTHAVEWHERE

sight words 1 2021-03-17

12 Items: ofonatandtheoffputwasdidallsaidyour

GIDDY FEELINGS 2022-09-07

13 Items: tomymyyouseeeyeandareyoursightcaughtcolorsfavorite

high frequency words 2024-08-23

12 Items: amanbeallandbigcandayawaycomeaboutabove

Group C 2024-12-03

12 Items: ToInHeOfIsAtTheAndYouSheForThey

Grade 3 ELD- Unit 4, Week 1 2025-01-07

12 Items: noisonebighasforyouandplayjumpwithlittle

Differences Word Search 2025-02-11

12 Items: AreAndCodeYourThereMorseBetweenTappingMissionMessagesTranslateDifferences

Ice fishing 2025 2025-01-12

12 Items: AndCodeYourExistMorseBetweenTappingMissionMessagesTranslateDifferencesCommunication

Fry Sight Words (1st 100) 2025-02-22

12 Items: atifandfordowneachpartthatyourfirstwaterwhich

Hello Word Search 2025-05-13

13 Items: i1myisandtwoandnameeviehavebroshellosisters

Brojevni sustavi i logički sklopovi 2025-06-04

12 Items: ANDdvanulebazazapissustavbinarnidekadskinegacijapotencijakonjukcijaheksadekadski

The Word Search 2025-11-04

12 Items: aIbetoofinittheandforthathave

Genesis 1:31 2025-11-12

12 Items: HEITGODSAWALLHADANDWASTHATMADEVERYGOOD

List A, Group 1 2026-01-27

12 Items: andbackcomedownhavehelpherelikemakesaidthiswant

week 1-5 sight words 2026-02-28

12 Items: thegotseeandwithlikecomelookplayheresaidlittle

Construction Word Search 2022-12-13

15 Items: pleaclotboysClownfatherissuesPriestsocialworkersfixationexecutedthe Clowncrawlspacethe victimsthree victims

Vocabulary March 2025 2025-03-09

17 Items: To stop or endConflict or struggleState of being boredPeaceful, calm, and quietTo walk slowly and heavilyConfusion or disorientationWeak or lacking in strengthLasting for a very short timeExtremely tiring or demandingCalm, peaceful, and without troublesTo increase the risks or stakes in a situationAnxiety or fear about something that might happen...

Information Word Search 2024-12-02

52 Items: joyartdatarestBatesASISTtrustfondszinespanelDervinreaderpolicydesignthesisequitycoffeeposterpublicseekingChatmangroundsanxietyleisuremuseumslibraryBooleanarchivegalleryjusticefreedomeverydayoverloadcurationacademicresearchwellnesscriticalknowledgecataloguealgorithmabundancelightningmetatheorySavolanienprovenancethirdspaceconferenceinformation...

Parts of a Residential Structure 2026-02-09

11 Items: RoofBeamFloorStairsColumnFramingFoundationFloor SlabExterior WallsWindows and DoorsInterior Walls and Partitions

HAHA 2023-03-09

17 Items: me!he_is-eli&bro(and=read%like*eli'scute~hello@te-he#named)lennox$lennoxśbrother^amazing+

trs23 ie2 u3p2 2022-11-16

10 Items: Doesn't work.It has 2 wheels.It can fly. It has wings.It's big and has 4 wheels.It can fly. It doesn't have wings.It's very big and has 4 wheels. (Br)It's very big and has 4 wheels. (US)You can see it on a yo-yo and a kite.It is round. It is on a car and a bus.Two overlapping circles with things inside.

Palabras Compuestas 2025-10-07

15 Items: (Nerve)(Puzzle)(Ranger)(Runner)(Sleeper)(Frogman)(See-Saw)(Open lab)(Flip flop)(Long hand)(Bulletrain)(Chiaroscuro)(Nail Tripper)(Black and white)(Sweet and salty)

Stress 2021-05-24

38 Items: JobMindLossToughDeathAlarmStressIssuesHealthSourceInjuryCausesIncomeImpactCombatImmuneDemandBurnoutBalanceDemandsBreatheMusclesDivorceBurnoutPositiveWellBeingResponsesReactionsManagementIrritationSituationsResistanceExhaustionStrategiesLifeChangesConsequencesConcentrationFightOrFlight

Yield Word Search 2023-09-13

37 Items: aidcarehomecaneyieldfraudcleanestatesupplyactionvisioninvestsectorseasonregionthrivesafetyhealthsummitmarketvaluesharvestfarmingqualityrespecteconomyemployeecommunitybehaviourworkplaceoperationsleadershipenterprisecommitmentconversationsustainabilityanticorruption

School 2025-08-29

37 Items: ELAHMSartmathcarspensworkdesklunchDoorspapertrackcolorschoolbussesHealthsciencereadingfriendshallwaySpanishclasseswalkingpencilsbackpackbathroomteachersroboticssoftballbaseballhomeworkstudentstechnologyvolleyballbasketballChromebookscheerleader

Focus on Greek Roots 2024-03-04

19 Items: Study of living organismsEarly sound-reproducing machinePerson trained for space travelA person's signature, often as a mementoA sudden event causing great damage or lossVisual representation of data or informationAn account of someone's life written by someone elseAn account of a person's life written by that person...

Legal Vocabulary for Health Reporting 2020-05-24

14 Items: HarmFairFOIALibelHIPAAFirstFaultMaliceCoveredProtectedIntrusionPublicationUnprotectedIdentification

Comet Word Search 2023-12-18

17 Items: Ursa majorUrsa minorchanging time and the seasonlight bouncing off an objectis a belief about personalitysomething that gives off lightsomeone that travels into spacesomething going around somethingstreak of light in our atmospheregalaxies including the solar systemhas the same amount of sunlight and darkness...

CDA Sept 20 2025-09-20

20 Items: atobetoisThetheandforonlylovefightGod'sLord'scomingworkerkingdomlast-hourrequirementrequirement

Fibres- fabrics 2023-05-09

16 Items: andallarespunintoyamsmakesilkformknownfibreslengthsproduceman-madefilamentscontinuous

December Safety 2025 2025-12-22

10 Items: Avoid hanging lights near any potential _____ hazard.Do not use outlets or cords that have exposed _______.Do not carry or lift up electrical equipment by the power ____.Risk of ________ shock is greater in areas that are wet or damp.Know where the panel and circuit _______ are located in case of an emergency....

Aging 2025-05-29

12 Items: ____ aging is a social constructInfluences 75% of biological agingThis organ ages quickly relative to other organsAging is a natural process and is not the same as thisWhich is NOT one of the 5 M’s of caring for older peopleProgressive decline in ability to maintain homeostasis under stress...

animals and summer and christmas 2013-12-10

44 Items: catdogbeeflyfoxcowhotsunbirdliongoatswimsandtigerkoalasheepbeachoceantowelspadeangleSantaelveslizardmonkeyrabbitpossumbreezebuckettinselfamilychickenfriendselephantladybirdkangaroosunshineumbrellabutterflydragonflysunscreenChristmassandcastledecorations

Lilo and Stitch and Science 2025-05-27

25 Items: LiloStarJumbaGantuOhanaAlienSpaceEarthLaserStitchGenomePlasmaScienceBiologyDensityPleakleyGeneticsMosquitoPreserveHumanoidDucklingMolecularExperimentHyperdriveEndangered

Spelling and Prefix and Suffix 2026-03-24

24 Items: reactunrollunloadrecallrewindunwindunsurereviewunhappyunknownrewritereplacemisleaddislikepreviewdisobeymisplacedisagreemisspelldisappeardishonestpreschoolunwillingreimagine

Cells 2025-09-25

23 Items: Organisms with a nucleus.Organisms without a nucleus.Image taken through a microscope.Double membrane that surrounds the nucleus.Organelles that digest and recycle cellular waste.DNA and proteins inside the nucleus in a loose form.Small sacs that transport materials within the cell.Proteins that speed up chemical reactions in the cell....

Comet Word Search 2023-12-18

17 Items: Ursa majorUrsa minorchanging time and the seasonlight bouncing off an objectis a belief about personalitysomething that gives off lightsomeone that travels into spacesomething going around somethingstreak of light in our atmospheregalaxies including the solar systemhas the same amount of sunlight and darkness...

Naturalworld Word Search 2023-06-02

34 Items: SI for timeSI for distanceSI unit of forceEnergy of motion.SI unit for energy.Speed plus directionThe change of velocityThe ability to do work.Characteristic or qualityEnergy that will run out.Change of position in timeMercury, Venus, Earth, MarsEnergy of position or stored.Example of a renewable energyJupiter, Saturn, Uranus, Neptune...

alibaba.com-1 2023-02-07

4 Items: greathealthwealthsuccess

Velez Health Broker 2024-09-27

4 Items: Youneedhealthinsurance

Beauty Word Search 2026-03-10

4 Items: BeautyHealthHolidayCottage

Cat words 2023-03-26

17 Items: youcanandyoucanthenfilelistshareimagecheckpuzzledependwithinthroughfinalizeyourself

SCAVENGER HUNT 2023-01-10

11 Items: theandforfindmainlookcluewheresecondbusinesshappened

Common Words 2023-01-26

11 Items: orasaretheandmumdadbiffchipfloppykipper

Chicken 2023-06-04

11 Items: meweyouanddatewhenmeethavelunchfriedchicken

Sweet Word Search 2024-02-09

11 Items: theandourjoysoulwithsweetheartsawakensrefreshesfriendship

WORD SEARCH 2024-10-23

11 Items: carseeandboytheballfishgirlhorseyellowairplane

Fall Sight Words 2025-04-15

11 Items: metoisatitinmytheandseelike

Psalm 119:105 2025-05-14

14 Items: aaismymyandYourwordlampuntofeetuntopathlight

1st Grade Super Words 2025-09-07

12 Items: todotheandbutnotherseebutwasthatthey

Sight Words 2025-10-29

11 Items: Imeweonisseetheyoucanandyes

Mr. Z's Sight-Word Word Search 2025-11-05

11 Items: HATSATRATBATCATSEETHECANANDLIKEPLAY

sught words 2025-11-12

11 Items: AandbigcanforawayblueComedownfindfunny

We Word Search 2025-12-13

11 Items: wetoinareseeandJulygoingLondoncruiseNorway

David and London 2025-12-29

10 Items: A type of kissKiss in SpanishFiancé in SpanishLondon and David's songDavid's Nickname for London?London's Nickname for David?The place David and London metWhat can London not sleep without?The month London and David will tie the knotWhat is David and London's favorite late night snack?

Biology Vocab 2 2024-08-22

12 Items: Monomer that makes up proteinsSpecific reactant acted on by an enzymeA simple sugar that is the monomer of a carbohydrateSpecialized proteins that speed up chemical reactionsLarge compound formed by combining many monomers togetherA substance that speeds up the rate of a chemical reaction...

Tracksuit Word Search 2024-11-21

11 Items: A subject that includes algebra, geometry, and calculus.Garments worn to cover your feet and ankles, often in pairs.A large piece of cloth or fabric that covers part of the floor.A sweatshirt with a hood, often worn for casual or sporty looks.A sweatshirt with a hood, often worn for casual or sporty looks....

Nutrition 2024-11-25

22 Items: mythadditivelife theatening reactionpeople who eat only plant based foodproduced from the fermation of beetscows milk, eggs, peanuts, wheat and soya stimulant found in coffee, tea, and cocoaan enzyme that is neccesary to digest lactose2 main religious groups that maintain vegetarianpeople who eat meat occasionally, but not red meat...

Trolls Health Word Search 2025-11-17

10 Items: JoyHugsFriendsDancingRespectSingingKindnessBullyingTeamworkCommunity

Ariel Word Search 2025-05-28

17 Items: MaxGusmoreArielBilalChloeIssacRowanMakaiSofiaCorvinSahiraJoquinSydneyAtticusValientEemeran

Ariel Word Search 2025-05-28

17 Items: MaxGusmoreArielBilalChloeIssacRowanMakaiSofiaCorvinSahiraJoquinSydneyAtticusValientEemeran

Community Outreach Program 2023-04-16

30 Items: fbsAidPlanPlanVisitHealthsurveyGivingTypingserviceMissionfoodcomprogramfinanceoutreachclintestassemblycommunityfecalysislogisticscreativesurinalysishematocritsimulationcanvassingAssessmentsustainablesecretariattransformativetransportation

Brewer Word Search 2023-08-02

38 Items: peartpenbusmathstembandtapegluegreenlunchrulerbookspaperrulesbrewertaylorhaynesschoolhealthhomeecpencilscienceplannerschedulenotebookscissorshomeworkcomputersclassroombreakfastclassworkprincipalsixthgradeagriculturehighlighterlanguageartssocialstudies