health and wellness Word Searches

EHS Week 2022 Word Search 2022-08-19

36 Items: elonechowastelakinpartsmyehssalesteslaveoliaaustinsafetyhealthbatteryhotlineservicebatteryoneteamfremontcoolantaerosolsecurityforkliftshanghairoadsterelectricdeliverylogisticsworkplacerecyclingcybertruckinterstatesharepointtakechargeenvironmentpreparednesssustainability

What 2023 has in store for you... 2022-12-22

38 Items: loveloverestcalmfamemoneypeacequietcheerblisspeacegracehealthwealthtravelenergyfamilypraisesuccesspassioncouragesupportinsightlaughterapprovallaughteradventurefriendshiprelaxationpositivityconfidenceacceptancerecognitiontranquilityinspirationfulfillmentappreciationopportunities

WELCOME BACK CALCIUM! 2023-08-22

35 Items: artgymprekspedbocesmflacmusicgrowthhealthnursesrecesscalciumlibrarylearningsnowdaysstudentswarriorsadventurebidsheetscafeteriacustodialattendancefirstgradefriendshipthirdgradeindianriverourownstorysecondgradeamazingaidesconstructionkindergartennewyearnewyouadministrationbestofficestaffterrificteachers

It Takes A Village to Raise A Child 2024-09-18

35 Items: mythcarehomeyouthlocalclubswatchsafetyhealthgroupsSportsproverbAfricanvillagesecurityprogramschildrenCommunityeducationwellbeingresourcescontributerecreationupbringingactivitiesvolunteersenvironmentafterschoolperspectivesneighborhoodinstitutionssupportsystemmoralguidanceorganizationsextracurricular

CAPE 2025-08-05

36 Items: gasRobbJaneAnneLeahNolanurseMeganadbandoctorCanadatoxicsAnjaliSkylarKarinaKiemiaReykiaDakotaSkylarhealthjusticeclimateSabrinaTynetteNatalieLoujainsuccessactivistMichelleRhiannonPatriciacommitteeenvironmentfossilfuelssuperheroeshealthprofessional

Esmerelda Word Search 2025-10-23

36 Items: lizamysixtorimikedawnleahcaremindyeetyoloamiraericatessayouthadultunitspsychskirtsevenbrianajustinandrearachelmentalhealthvanessafrancisanaliciarashaynechildrenesmereldacontrabandchristopherpsychiatricmedications

Mr. Stanger's Last Day Word Search 2025-11-20

35 Items: DogsAuraCubsLamarMollySixthFifthSigmaMusicDarwinHealthEighthHipHopStephenStangerCharlieAbigailPontiacChicagoScienceHistoryEnglishSeventhTeacherStoriesGoodbyeKendrickSixSevenDietCokeChampaignThomasboroSubstitutePrideBucksMariosPizzaNameofMyFavoriteStudent

Documentation Word Search 2026-03-02

31 Items: ClearScopeFactsCourtRecordPolicyhealthquotesActionsOutcomeActionsContextNeutralbehaviorlanguageTimelineSpecificPatternsstandardsLiabilityObjectiveTimelinessStatementsCredibilityConsistencyInterventionCompletenessProfessionalNotificationsDocumentationCommunication

Medical Marijuana Word Search 2024-12-02

7 Items: Another term for marijuanaA type of Schedule 1 controlled substanceThe action of working together for a common goalEnsuring patients are cared for, their needs are met and heardA set of principles and standards that nurses follow to provide optimal care...

Epidemiology- Word Search 2025-05-03

5 Items: study of serum.The study of how disease spreads and can be controlled.are often collected for the diagnosis of bacterial pneumonia.is a preferred method for manual cleansing in health care when hands are not dirty....

Medi-Cal 2014-10-31

33 Items: LowTARxrayLongTermCareCardPlansneedyMentalHealthCountyIncomeDoctorsMedicalBenefitsHospitalCoverageMedi-calSuppliesMaternityEmergencyPediatricScreeningEquipmentMedicallyProceduresLaboratoryCaliforniaEligibilityPrescriptionsCategoricallyRehabilitation

First Three Words For New Year's 2024 2023-12-27

34 Items: joylovehopeplangracepeacefocuswisdomhealthgrowthcreatecharityservicebalancerespectpatiencekindnesshumilitygoodnesssimplifyorganizelearningexercisecuriositycommitmentcompassiongentlenessdisciplineprioritizeforgivenessstewardshipfaithfulnessthankfulnessencouragement

Welcome to Integrity 2024-08-20

34 Items: GymArtMathBandWaiteLunchMusicNeagleCivicsRecessChorusSkillsHealthOConnorTessmerTauroneDohertyAlgebraScienceLockersTissuesIntegrityBackpacksOrchestraMontgomeryConnectionFieldTripsAssembliesEighthGradeAgendaBooksEngineeringLanguageArtsDigitalLiteracyComputerScience

Lifetime Sports 2025-04-07

30 Items: crewgolfropegolfartsyogadancetennishockeyhealthreliefskiinghikingwalkingcyclingstaminafrisbeearcherymarathonbaseballfootballswimmingstrengthwrestlingbadmintonpickleballbasketballvolleyballcheerleadingweightlifting

TBC 2025-11-30

34 Items: LGDLaraHugoBellKempHASSAdelePoppyHenryRickyJesseMasonLoganIrwinAleeahMarcusMaddieClarkeWatsonHealthJasmineCollierVanstanNanangoEnglishScienceRhiannonFranklinMcCarthyPatricksMcDonaldReligionTechnologyMathematics

HEART STOPPER LORE 2026-03-05

30 Items: BENNICKLGBTELLETORITARAALICENOVELPARISSARAHRUGBYLOVERSHEALTHBRIGHTSCHOOLLONDONSERIESCHARLIEFRIENDSGRAPHICTEENAGERDRAININGMEETS BOYHEARTFELTTEARJERKERDEPRESSIONCHALLENGESCOMPLICATEDRELATIONSHIPHEARTSTOPPERS

Scrum Glossary 2023-07-21

34 Items: 10, See "Product Backlog __________"5-4, A self-managing team consisting of one Scrum Master, one Product Owner, and Developers.8, The selection of items from the Product Backlog Developers deems feasible for implementation in a Sprint....

British and Irish Dogs 2025-08-05

20 Items: Scent hound, used primarily to hunt hareA large, black and tan gundog from ScotlandPembroke and Cardigan are both types of what?What word goes in front of 'beagle' and 'blue'?Pepper and which other colour can Dandie Dinmont Terriers be?A terrier was associated with this city long before Noel and Liam...

Afro Word Search 2025-11-19

43 Items: Study of past eventsMovement to end slaveryTime that is yet to comeAfrican-Brazilian religionFamily descent and lineageFair treatment and behaviorAct of setting someone freeMusical bow used in capoeiraLegal and moral entitlementsProcess of receiving knowledgePolitical activist and academicLeader of Quilombo dos Palmares...

Jobs in health care 2024-03-21

11 Items: nursedentistorderlydieticiantherapistoptometristcardiologistpractitionerlabtechniciandermatologistxraytechnician

Exercise Word Search 2025-05-11

50 Items: ArtYogaFilmMindMovieGamesGenreSpaceMusicHobbyFlavorNatureSportsPlanetAuthorDesignJourneyScienceHistoryCultureAnimalsTourismCuisineWritingAthleteFashionTextileFinanceExerciseDiscoverBusinessWellnessComputerPaintingActivityWildlifeCommerceDeliciousEconomicsAdventureNutritionAlgorithmTechnologyLiteratureInstrumentPsychologyEnvironmentArchaeology...

The One Pager and more 2025-05-06

11 Items: We trust our peopleThe best experienceRetention and engagementQuality and on time deliveryTopline growth and profitabilitySustainability and volunteer hoursThe app we go to for all our helpscreensAcronym for customer relationship managementThe name of the truck that brings us ice creamThe month that we celebrate a full week for CS...

T. L. E 2025-02-03

26 Items: These are flat heateduse to hold food in placeUsed to open canned foods.where food is directly cookedThe toaster is typically a smalluse to strain solid to liquid ingredients.Used to slice foods more evenly and uniformlyMachines used to chill sandwiches and other foods.A knife with a sharp edge that has saw-like notches or teeth....

Reconstruction Test Review 2025-10-05

22 Items: Became president in the election of 1876The constitutional amendment that ended slaveryHe was the first African American to serve in the U.S. SenateCivil rights leader and journalist who exposed lynching in AmericaThe Supreme Court case that upheld “separate but equal” segregation...

The Modern World 2026-05-20

30 Items: The Great WarGermany, Italy and Japan in WW2Economic hardship from 1929-1939The US and Soviet Union after WW2Germany and Austria-Hungary in WW1regular people who are not soldiersSituation where neither side is winningThe murder of 6 million Jews by the NazisCountries that choose to stay out of a warDigging trenches for protection during war...

Onboarding Word Search 2024-11-13

3 Items: The process of integrating new hires into an organization and its culture.The total monetary and non-monetary rewards given to employees for their work.Non-wage perks provided to employees, like health insurance, retirement plans, and leave.

Chapter 12 Vocab 2026-05-05

19 Items: the address of a web page.adjustment to environmental conditionsvery skilled or proficient at something.expert skill or knowledge in a particular field.the established set of attitudes held by someone.the continued possession, use, or control of something.modify (something) to suit a particular individual or task....

Mental Health Awareness Month 2023-05-24

11 Items: swingsstressfatiguecourageinsomniaemotionsselfcareexercisetirednesscommunicatemindfulness

Customer Engagement Hub Market: Trends, Growth Opportunities, and Regional Insights 2025-06-23

13 Items: playersdriversupdatesanalysissegmentationOpportunitiesthe rising trend of cloud-native engagement hubs and strategic partnerships among tech giants to deliver unified, data-driven customer interaction platforms globally....

Game 2023-04-10

15 Items: The colour of chocolate.A small vehicle for travelling on water.The day before today. The letter starts with Y and ends with Y.An object for taking photos or making films or television programs.An object with a sharp blade used for cutting fruits, vegetables etc...It is a vegetable. The letter of the word starts with C and ends with T....

Lacena Word Search 2026-04-20

31 Items: meatfishpeasricefatsi dodinneronionsgrapesgrainsbutteryou dochickenlettucecarrotsto walkpotatoestomatoespastriesi preferbeefsteakspaghettiice creambeveragesIm hungryIm thirstygreen beansto exerciseto lift weightsfor ones healthto maintain ones health

AEG Word Search 2024-04-16

38 Items: airasgwildeiaegsoilsafewordsafeflowsoilarchwatercleanexcelearthhealthtimelysnacksrecycleleaderstestingsamplesclientsschoolsleadersteamworknutshellmanagersprojectscompliantdeadlinesstormwaterconsultingtechnicianaccountingconsultantsenvironmental

Brandon & Tiffany 2025-02-01

36 Items: FUNLOVECAKEKISSRINGADORETRUSTBLISSGROOMBRIDEDRESSDRINKSMALENYHEALTHCHEERSBRANDONTIFFANYFOREVERROMANCECHERISHSUPRISEPROMISELOYALTYWHISKEYFOREVERJOURNEYTOGETHERDEVOTIONTEAMWORKFAVOURITEHAPPINESSADVENTURECHAMPAGNEFLOWERGIRLSUNCONDITIONALENGAGEMENTPARTY

Junior Year in Review 2025-06-09

35 Items: ArtMathMassAPUSHHouseCommaLunchYondrHealthSummerWinterClauseFinalsEnglishHistoryPhysicsBaldwinRetreatChargerTechBarTheologyResearchMidtermsSentenceAssemblyWorkStudySemicolonFitzgeraldGradatGradSocialHallChromebookConvocationCollegeCareerMulticulturalGoogleClassroom

Summer Enrollment 2025-06-11

30 Items: FSAEOITIPPDentalVisionHealthTexFlexYou_OnlyDeadlineLong_TermBeneplaceTexa$averShort_TermDependentsERS_OnLineDisability401(k)/457Add_or_DropEligibilityPrescriptionJune23-July04Opt_Out_CreditAD&D_InsuranceYou_plus_FamilyExpress_ScriptsAlightSolutionsOptional_Term_LifeTobacco_User_StatusChild_CertificationHealthSelect_of_Texas

Patient Education 2025-08-05

29 Items: AidsChangeSettingLearningTeachingFeedbackLiteracyHandoutsCoachingResourcesPromotionWorkshopsEducationteachbackCurriculumAssessmentEvaluationEngagementMotivationCounselingMultimediaMonitoringInstructionEmpowermentInteractiveDevelopmentCommunicationUnderstandingDemonstration

Leadership class 2029 2025-09-02

35 Items: TASKFIREGOALSEXCELSPHERESTRESSCAREERTRADESHEALTHMISSIONCOLLEGEPATHWAYPLANNINGTANGABLERIGOUOUSTEAMWORKCIVILITYEXECUTIVEEDUCATINGCOUNSELORINTANGABLEEMPOWERINGPHILOSOPHYFLEXIBILITYPERSERVANCEENCOURAGINGORGANIZATIONSTAKEHOLDERSSELFRELIANCEMETACOGNITIONCOLLABORATIONSELFAWARENESSSELFDIRECTIONSELFASSURANCESELFCONFIDENCE

Dental Word Search Easy 2025-12-29

30 Items: PAINCANALTEETHDECAYPLAQUEBRACESTARTARCROWNSHEALTHX-RAYSBRIDGESSURGERYDISEASEHYGIENEIMPLANTFILLINGSFLOSSINGBRUSHINGFLUORIDECAVITIESCHECK-UPCLEANINGDENTURESTOOTHACHEMOUTHWASHTREATMENTWHITENINGEXTRACTIONPREVENTIONANAESTHESIA

Design Thinking Vocabulary 2026-01-04

35 Items: UAETESTWASTELOCALSMARTDEFINEIDEATEIMPACTGLOBALHEALTHMENTALPROBLEMCLIMATEQUALITYSOLUTIONFEEDBACKHERITAGEIDENTITYPROTOTYPEREDUCTIONRESOURCESRENEWABLESOLUTIONSWELLBEINGLIFESTYLEUNDERSTANDCREATIVITYTECHNOLOGYARTIFICIALENVIRONMENTSUSTAINABLECITIZENSHIPINTELLIGENCEAPPLICATIONSRESPONSIBILITY

Cohesive Word Search 2025-02-10

30 Items: UnifiedDoubterPowerfulResidentGratefulSeparationExtremely angryLoyal and dedicatedEffect or influenceTamed for human useCombine into a wholeThe way someone actsOpen to harm or attackCareful and responsibleAccepting of differencesInequality or differenceOpen-minded or progressiveLack of interest or concernNatural impulse or behavior...

Sharks 2025-07-25

30 Items: makocoraljacksonmale cowstriped horsemetal in wiresvaluable metalto lie in the sunpirates of the ...yellow citrus fruitopen ocean swimmingflorence nightingaleclothes you sleep inbiggest fish in oceanhead shaped like a toolAfrican spotted big catcolour of ocean and skyspriritual agent of Godstripes and eats anythingmouth like a cookie cutter...

Neuroanatomy Word Search 2026-02-12

34 Items: pain reliefsignals painmuscle movementtriggers hungervital functionsfear,aggressionhearing,languagememory formationtriggers fullnessvisual processingvoluntary functionsinvoluntary functionssleep cycle regulationtouch,spatial awarenessfatty, insulating tissuecalming:"Rest and Digest"maintenance(ex.hunger,thirst)arousal:"Fight, Flight, Freeze"...

Domestic Word Search 2022-11-20

35 Items: mentraphelptvadwomenstoryhealthdangerverbalgroupsaccessrightsvictimsupportwebsitedomesticviolencephysicalproductsservicesreliablepositivenegativechildrenfinancialresourcespreventioninfluencesobligationconsumerismrealisationinformationinfographicsocialmediaresponsibility

Love Word Search 2022-12-26

35 Items: joyloveflowsafehopemagicfaithtravelfamilybeautyhealthgrowthchangesecurefriendscourageclaritymindfulforgivefreedomempathymanifestkindnessstrengthblessingfearlessabundancegratitudestillnesslimitlessconnectionproductiveinspirationbreakthroughspirituality

Words of the Day 2023-04-06

35 Items: hivairaidsrestviruswaterhearthealthcancerasthmastrokevaccinehygieneobesitypathogenimmunityepidemicpandemicexercisesunlightdiabeteswholisticnutritiongermtheoryantibiotictemperancemoderationtrustingoddanieldietdeprivationmicroorganismdirectcontactchronicdiseaseindirectcontactcommunicabledisease

Human Services Word Search 2024-09-10

35 Items: careneedsgoalsnursehealthskillsassistmidwifeserviceempathysupportguidancepositivecounselorabilitiescommunityambulanceaptitudesattitudeseducationcompassionprotectionbehavioursexperiencecasemanageroccupationsolderadultsspecializedsocialworkerdisabilitiesindependenceprofessionalschildandyouthrelationshipsrehabilitation

Animal Rights vs. Animal Welfare 2024-10-09

35 Items: ZoosCareHealthRightsEthicsComfortJusticeCircusesEqualityAutonomyActivismAdvocacyStandardsWellbeingSufferingAbolitionSentienceEnrichmentRegulationProtectionLiberationCompassionSanctuariesFurindustryConservationExploitationAnimalrightsAnimaltestingInherentvalueAnimalwelfareRehabilitationOverpopulationFactoryfarmingNonhumanrightsHumanetreatment

Word Search Puzzle #2 2024-11-17

35 Items: ARTMATHDESKDRAMABOOKSLEARNMUSICPENCILRECESSGRADESSCHOOLHEALTHHISTORYNUMBERSSCIENCEENGLISHFRIENDSREADINGLIBRARYCRAYONSTEACHERWRITINGALPHABETHOMEWORKBACKPACKSPELLINGSTUDENTSSUBJECTSSCISSORSCLASSROOMGEOGRAPHYELEMENTARYLANGUAGEARTSSOCIALSTUDIESPHYSICALEDUCATION

risk taking 2025-11-03

30 Items: riskliferightsdangerhealthmakingsafetytrustsskillsdevelopseekingsupportstrategythoughtsidentityfeelingspositivenavigatenegativesolutionsjudgementawarenessbehaviourconscienceresiliencemanagementchallengesrecognisingadaptabilityresponsibilities

New Years 2025-12-28

35 Items: NewOldWishPartyToastMusicGoalsPeaceHappyClockCheersSnacksHealthNewYearBalloonSparkleSequinsBubblesFriendsGlitterDancingSingingConfettiMidnightBallDropMemoriesStreamerCelebrateCountdownFireworksGoodVibesGratitudeTraditionNoisemakerResolutions

Heard Word Search 2026-05-17

35 Items: herdholewhosheardwholewhoseheresstagelargejudgehumanhealthbehindhappenbridgejacketorangeenginedangerhazardlegenddamagevillagegiraffehabitathostileharmonycollegecouragebandagehospitalhesitategeneroushighlightemergency

DEPOSITS SYSTEMS 2024-11-05

15 Items: USED TO ROUTE THE CORRECT CALLS TO YOUUSED TO FILE CLAIMS AND SERVICE REQUESTSUSED TO TRANSFER CLIENTS AND ACCEPT CALLSUSED IN MOBILE BANKING AS A DIGITAL ASSISTANCEUSED TO GUIDE THE CLIENT TO THE CORRECT DEPARTMENTYOUR MAIN RESOURSE FOR KNOWLEDGE AND GUIDANCE ON CALLSUSED TO CAPTURE COMPLAINTS AND VIEW PREVIOUS COMPLAINTS....

Communication Word Search 2026-02-05

23 Items: Communication that uses spoken words.The physical ability to perceive sound.Communication between two or more people.The process of sending and receiving messages.Actively paying attention to understand a message.The use and understanding of time in communication.The study of tone, pitch, volume, and rate of speech....

Chapter 6 ED310 2023-02-14

10 Items: Data software______ ProcessingAllows ______ on documentsAssess the _______advantage_____lesson results and impactEncourages writing across the_________________dynamics within collaborative writingShare lessons, _______, and outcomes with other peer teachersTeachers create documents for instructions and _________ tasks...

Greek Mythology 2026-02-16

17 Items: God of wineMother EarthThe god of warGoddess of loveThe god of the seaGoddess of the huntThe King of the GodsThe goddess of wisdomGoddess of the hearthGoddess of agricultureThe goddess of rainbowsThe god of the UnderworldThe messenger of the godsGod of fire and blacksmithsThe god of healing and prophecyQueen of the Underworld, goddess of spring...

DOG 2025-01-31

17 Items: – The top of the neck.– The side of the face.– The digits on the paw.– The upper hind leg joint.– The joint on the front leg.– The rear end, above the tail.– The loose, hanging upper lip.– The dog's nose and mouth area.– The upper front leg attachment.– The area between ribs and hips.– The lower hind leg, above the paw....

Sexual assault awareness 2026-04-12

13 Items: GSRCSAVRPoliceCenterSupportOptionsSupportAdvocacyPlanningIX OfficeResourcesof Equity and Inclusionand Sexuality Resource Center

Micah 4 The Lord's Reign in Jerusalem 2023-04-30

21 Items: You will go off to ???We will walk in His ???I will make your horns ???Many say, "Let her be ????"There will be no ??? anymoreArise and ??? daughter of ZionAnd their ??? into pruning hooksNo one shall make them ???anymoreAnd they do not understand His ???I will gather the lame and the ????Now it shall come to pass in the???days...

Word Search 2025-12-15

20 Items: App for short videosSweet ring-shaped treatSuperhero movie universeSport played with a hoopTakeaway food with toppingsPopular casual or sports shoesPlaying video or computer gamesWhat you hold to play most gamesUsed to listen to music privatelyThe part of a car that makes it runOnline game where users create games...

Vocab Part 2 2023-02-28

15 Items: a popular votemilitary draftthe right to votecan defend with logicking noble and easantssudden overthrow of the governmentmilitary static where they burn or destroy cropsto formally give up control of a country or stateto incorporate into an existing political unit, such as a city or country...

Vocab 3 2024-09-18

15 Items: A living part of an ecosystemA nonliving part of an ecosystemStep in a food chain or food webAn organism that makes its own foodAn organism that cannot make its own foodA consumer that eats both plants and animalsConversion of light energy from the sun into chemical energyOrganism that feeds on plant and animal remains and other dead matter...

Deaf Appreciation Month Word Search 2025-03-11

15 Items: Not completely deafDeaf Awareness MonthTo have loss of hearingA device that can help people hearA famous deaf inventor and businessmanThe last name of the inventor or hearing aidsA famous deaf disability rights activist and an authorThe past of deaf or hard of hearing people and cultureA famous deaf composer and pianist in the 1700s and the 1800s...

Business Basics 10/31/24_Wellness is Safety 2024-10-29

36 Items: FluIAPNSCDietTeamColdsRisksSleepTiredAccessHealthInjuryMentalOfficeSafetyStressFatigueHazardsIllnessObesitySupportServicesVaccinesDecisionsIncidentsOwnershipReportingResourcesUnhealthyWorkplaceDrowsinessMedicationRespiratoryDistractionsConcentrationPsychological

Fiber Word Search 2025-01-02

29 Items: RiskpainFiberTotalfruitwatersugargramstrackgrainsweighthealthsolublehealthyDiarrheabloatingBenefitsgel-likeDigestionInsolubledissolvesmovementsvegetablesregulationsupplementsConstipationinflammationinflammationfermentation

Fiber Word Search 2025-01-02

29 Items: RiskpainFiberTotalfruitwatersugargramstrackgrainsweighthealthsolublehealthyDiarrheabloatingBenefitsgel-likeDigestionInsolubledissolvesmovementsvegetablesregulationsupplementsConstipationinflammationinflammationfermentation

Fiber Word Search 2025-01-02

29 Items: RiskpainFiberTotalfruitwatersugargramstrackgrainsweighthealthsolublehealthyDiarrheabloatingBenefitsgel-likeDigestionInsolubledissolvesmovementsvegetablesregulationsupplementsConstipationinflammationinflammationfermentation

District 34 - Williamsburg P&P 2025-05-29

30 Items: CityCityKentPurgeLegalWorksLetterBridgeCurfewHealthRightsReleaseCaseloadBehaviorLifeScanMedicaidPoquosonRecoveryRestraintConditionsIdentifierMedicationObligationSuperviseeRestitutionRestorationShadowtrackSupervisionNotificationWilliamsburg

Change Word Search 2025-12-30

36 Items: joyloveflowboldpowerspacegracefocusshareshinechangefamilyrhythmlaunchhealthevolvelistenthrivepresentpurposeempathybalancestrengthcreationorganizeautonomysimplifyalignmentintentiongratitudeabundancecommunityconnectioncompassionenvironmentrelationships

Health Careers Offered Through West Kentucky Community and Technical College 2014-06-06

14 Items: diagnosticmedicalcoderphlebotomistdentalassistantdentalhygienistregisterednursemedicalsecretarynursingassistantmedicalsonographerpharmacytechniciansurgicaltechnologistradiologictechnologistlicensedpracticalnursephysicaltherapyassistant

Askiathegreat Word Search 2024-10-04

29 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthagegreat early church fathers and martyrs from Carthage...

Beauty 2023-10-25

50 Items: spagellooksstylenailscurlscreammouseblushbrushbeautymakeupfacialpampervanitylotionprimerpowderpolishfashionglamourclothesperfumehaircutmassagejewelrystylistmascarashampoocologneretinolskincarecosmeticflatirongroomingwellnessbathbombhaircarelipstickeyelinereyecreamvitaminslipglosshairstylehairdryereyeshadowconcealerhairsprayfoundationconditioner

Nutrition 2026-03-26

50 Items: FatFuelBodyMindCareMealIronTrustSnackLunchFiberEnergyGrowthHungerDinnerCopingSkillsNourishBalanceHealingVarietySupportRestoreProteinVitaminMineralCalciumRoutineCourageFreedomRecoveryStrengthFullnessWellnessProgressAppetiteFearFoodExposureBreakfastHydrationDigestionChallengeMetabolismConfidenceResilienceFlexibilityConsistencyCarbohydrateSatisfaction...

Geometric Word Search 2025-09-27

18 Items: 23Forms occupy space, such as sculptures or buildings.- A line is a path made by an object moving across a surface.- describes the different ways elements of an artwork are arranged.- The art of making objects from clay and hardening them in a kiln.Shapes - are irregular or uneven shapes. These can often be found in nature....

constitution terminology 2023-01-22

20 Items: Having two branches or chambers.The first term amendments in the U.S. ConstitutionComposed of the Senate and the House of Representatives.A person who shapes or creates a concept, plan, or system.To control or supervise by means of rules and regulations.The funds or revenue of a government, corporation, or institution....

Vocabulary Words 2025-11-25

13 Items: adj. -French origin, bizzare "odd/fantastic"adj. -Latin origin, from vulnerare "to wound"v. -Latin origin, from in "in" and durus "hard"v. -Latin origin, from examen "a test, balance, or weight"n. -Latin origin, from per "through" and specere "to look"v. or n. -Latin origin, from contra "against" and stare "to stand"...

How Can Hormone Health Help Me? 2025-07-01

21 Items: CalmFocusEnergyMemoryStrengthImmunityRecoveryVitalityStrengthDeepSleepDigestionEnduranceClearSkinFertilitylongevityStableMoodMetabolismConfidenceResilienceMentalClarityRegularCycles

The Nervous System :) 2024-02-21

15 Items: - the largest lobe of the brain- the sensory switchboard of the brain- part of the brain that controls breathing- part of the brain that coordinates movement- part of the brain in charge of memory and hearing- a disorder of the brain characterized by repeated seizures- part of the body that receives and sends sensory information...

About me - (HEALTH CLASS PROJECT) 2025-12-12

15 Items: catgymsteamorangeapplesrobloxtiktoksoccercarrotsUkraineMcdonaldsbasketballArtemKushnirJoeBartolozziCounterStrike2

Sexual Health Word Search Extravaganza 2026-02-19

15 Items: What does U=U refer to?A fluid that can transmit HIV.The only way to know your status.STI that can cause genital warts.Daily medication that prevents HIV.Virus that attacks the immune system.A barrier method that reduces STI risk.STI known for stages and a painless sore.STI often known for discharge and burning....

Semperfidelis Word Search 2024-04-15

24 Items: light and liberty-UNCto err is human-Senecafrom sea to sea-CanadaFor humanity-Wake ForestMake haste slowly-Augustusmind and hand-NC A&T + MITbuyer beware-famous proverbo the times! o the customs!always faithful-US Marine CorpsI think therefore I am-Decartesthus always to tyrannts-Virginiaart is long,life is short-Horace...

Criminal Thinking Errors 2025-07-01

15 Items: A criminal thinking error that shows a failure to follow through with commitments and intentions.A behavior of criminality that displays a lack of accountability for one's actions or obligations.A positive attitude of being thankful or having a readiness to show appreciation for and to return kindness....

Nurse Word Search 2025-09-22

25 Items: Your mom and dad.Work that you do after school.The leader of the whole school.The children who learn at school.The place you go to learn every day.You can find swings and a slide here.The teacher writes on this with chalk.You carry your books and pencils in this.A short break for playing between lessons.The room where the school secretary works....

Health Care Compliance Word Search 2016-08-19

15 Items: HIPAAfraudstarkethicsprivacysanctionintegrityvalueslinefalseclaimantikickbackconfidentialityminimumnecessarycomplianceofficerstandardsofconductconflictsofinterest

The Mental Health Body Parts 2025-10-06

15 Items: LegHairEyesNoseNeckChinMouthHeartLiverKidneyStomachLeftHandLeftFootRightHandRightFoot

The Olympian Games 2025-10-15

10 Items: What is the BOA?Further games took place here.When was the Olympian Society established?Where did the NOA's first Games take place?Who created the Much Wenlock Olympian Games?A Christian commitment to health and manliness.When was the Much Wenlock Olympian Games founded?The school that Coubertin was inspired by in England....

Whole Word Search 2026-01-29

11 Items: – Feelings of failure or low self-esteem.– Sense of pride gained from mastering skills.Thinking – Logical thought based on real situations.Intake – Nutrient essential for bone and tooth development.– Adequate water intake to support energy and concentration.Protein – Foods that support muscle growth and tissue repair....

Pirate Word Search 2025-06-22

12 Items: A costume with a helmet and hoseA costume that looks like a machineA round, orange costume with a stemA big, roaring costume from long agoA fancy costume with a crown or dressA costume with a cape to save the dayA costume with a cape and sharp teethA costume with a pointy hat and broomA costume with a hat, boots, and lasso...

10 Humanities Revision 2025-11-09

12 Items: The mixing of races.Being the same in status and freedoms.The forced separation of people by race.Man who challenged Terra Nullius and won.Contained area that held Jewish people in WW2.Mass genocide of Jewish people by Nazis in WW2.Feelings of contentment that come from good wellbeing.A member of the National Socialist German Workers Party....

PBS The Nervous System 23-24 2023-11-15

20 Items: the top part of the brain stemthe lobe that processes hearingthe bottom part of the brain stemthe middle part of the brain stemthe lobe of the brain that processes visionthe study of microscopic anatomy of tissuesthe type of cell found in the nervous systemthe nervous system that consists of the nerves...

Food , Drinks and deserts 2023-12-21

138 Items: hammilkcrabporkPORKmushyamswaterlagerlattestoutgritssushicoffeefrappegrappaeggnogoolongbrandycognacshrimpwafersturkeyquinoapotatosalmonsalamifondueseltzerslushiechicorylobsterhotdogslasagnawafflesoatmealpumpkinmuttonsoxtailslemonadesmoothieiced-teaestragonabsinthepancakesporridgepigtailspopsiclemilkshakecherryadeorangeadeiced-beerroot-beergreen-tea...

Health Benefits of Physical Activity 2024-06-20

15 Items: aerobicagilitywarm-upstrengthintervalanaerobicendurancecool-downhydrationintensitymetabolismresistanceflexibilitycoordinationcardiovascular

Ruler Word Search 2025-06-22

12 Items: A sheet you use to write or draw onThe person who leads the whole schoolThe room where students learn and workA writing tool with bold, colorful inkPeople you like to play and learn withA book with pages for writing and notesPages you read to learn or enjoy a storyA white stick used to write on chalkboards...

Chapter 4 Section 1 2025-11-03

13 Items: AgoraKnossosHoplitesHoplitesMainland __________ is a mountainous peninsulaThe first Greek kings were _____________________Early Greek communities grew up ____________________The Greeks were the first people to develop _____________like independent countries and varied in size this area is called...

Hardware Unit Vocabulary 2025-12-11

19 Items: The "U" in "USB"A type of storage that keeps data without powerTransmits data at high speeds via light signalsCable that connects storage devices to the motherboardStores and manages files for other devices on a networkA piece of software that may need to be installed for a peripheral to work....

Word Search! 2024-08-13

50 Items: carhatgolfreeftaxisanddocklakeroambeachkayakoceanplanegrilldivingtravelbrunchguestsresortdinnerfoodiecoolerrentaleatingshrimpleisureholidayexploreairportluggageswimmingwellnessfestivalsuitcasetravelervisitingmemoriesoverseasseashellstarfishswimsuitflounderpassportwhirlpooladventuresunglassesexplorationsightseeingdestinationentertainment

Wray Word Search 2026-05-11

51 Items: IVLABWRAYCAREXRAYNURSECLINICTRAUMACTSCANVITALSSAFETYPATIENTTHERAPYSURGERYIMAGINGMONITORBANDAGEHEALINGHYGIENERESPECTSERVICEHOSPITALWELLNESSPROVIDERRECOVERYTEAMWORKCOMMUNITYPHYSICIANRADIOLOGYEMERGENCYMATERNITYINJECTIONDIAGNOSISTREATMENTINTEGRITYHEALTHCAREPHARMACISTTECHNICIANPEDIATRICSLABORATORYULTRASOUNDVENTILATORMEDICATIONPREVENTIONCOMPASSION...

Yes! Word Search 2025-11-19

21 Items: METTALOTUSBUDDHADHARMASANGHAMANTRATEMPLEBEINGSRINPOCHECHENREZIGSUFFERINGNAMASKARACOMPASSIONMEDITATIONDEDICATIONcan simply copy the list below and paste it into the generator of your choice:Using an online generator is the easiest way to make a custom word search puzzle....

Renewable energy Snjeza Word Search 2026-04-20

18 Items: Moving air.Dirty air from fire.A machine that spins in the wind.A small thing that stores energy.Water that flows across the land.A vehicle we drive on the road.A mountain with hot lava inside.Energy that gives us light and power.A wheel that turns in water.A place where water makes electricity....

Elementa Unit 9 word search 2026-05-11

11 Items: orandbutgodtreetemplebecauseholidaygoddessalthoughand (attached to end of word)

Eucharist 2023-11-13

9 Items: Going to the altar to receive...invoking the power of the Holy SpiritTranslation of Eucharist in Greek and thanks to GodAct of turning bread and wine to Body and Blood of Christ"to make holy" and shedding of Jesus' blood for our salvationthe highpoint of the mass and central sacrament with special title...