fourth of july Word Searches

Environmental Events and their Implications to Human Lives 2023-03-11

15 Items: The extent of being liable.It is a potential source of harm.A real threat to general welfare.It is commonly known as biohazards.It is also known as social hazards.It is commonly known as tidal waves.The gradual caving in or sinking of an area.The sudden and violent shaking of the ground.These are hazardous substances that can cause harm....

Environmental Events and their Implications to Human Lives 2023-04-01

15 Items: The extent of being liable.It is a potential source of harm.A real threat to general welfare.It is commonly known as biohazards.It is also known as social hazards.It is commonly known as tidal waves.The gradual caving in or sinking of an area.The sudden and violent shaking of the ground.These are hazardous substances that can cause harm....

Globalization 2025-08-19

27 Items: In comparison.Public perception.Area of expertise.Provider of goods.A reduction in priceTo use up completely.To take something awayA product not made abroad.To leave out or not include.Operates in several countries.Purchase and use of goods and services.Making something easy to use or access.Most important, powerful, or influential....

Econ concepts 2023-07-16

16 Items: iloveeconomicsmyfavoriteclassbestteacherevergreatlifelessonsThe study of the economic behavior of individuals and firms.A situation in which extra units of something produce successively smaller benefits.A school of economic thought advocating government spending to pull economies out of recession....

Macbeth 2024-10-30

10 Items: his heirs will be kingthe author of the playthe protagonist of the playmanipulates Macbeth with magiccomes up with the plan to kill Duncanthe son of Duncan who flees to Englandthe son of Duncan who flees to Irelandthe only person Macbeth should beware ofthe king of Scotland at the beginning of the play...

States of Matter 2022-11-30

17 Items: an example of a gasan example of a solidan example of a liquidgases can take this shapekeeps its own shape & volumesolids do not _____ or expandsolids have ______ kinetic energytakes the shape & volume of its containergas particles move in rapid random ______particles of a solid move like this in placeparticles of a liquid can flow past each other...

Unit 4 Vocabulary Word Search 2025-10-24

18 Items: independent poweran addition to a documentapproval of a document or policyan agreement between opposing partiesA complaint about something unfair or wrongA law or rule made by a city or local governmentan alliance of states created for a common purposeA person who is running away, especially from the law...

Game Online of Colaboration Project (National Hero, Province/Capital City, Local Foods, Tradition, and Culture) 2025-11-12

10 Items: A hero from MalukuOne of Palembang's typical foodsThe capital of North Sulawesi provinceThe capital of West Kalimantan provinceThe name of the capital of Central JavaThe name of the capital of East KalimantanAngklung and gamelan musical instruments come fromLompat Batu is a traditional culture from the island of...

Angel 2020-07-15

39 Items: dogcatsodasandJulyantsAngelCarolsnakeLindapizzaelvisdancebingoPattyrocksamberhorsessummerredcarflowersspidersyeseniacookiesKristelCourtneyWandasuesunshinebutterflyelephantswordsearchpopcorndaydisneylandoregoncoastpeanutbutterjailhouserocknelsonmandelabluesuedeshoesalwaysonmymind

The weather and the seasons 2 2021-05-26

39 Items: MayhotwetdryicyJuneJulywarmcoldcoolMarchAprilsunnywindysnowyrainyfoggytodayspringsummerautumnwinterAuguststormycloudyJanuaryOctoberthundershoweryrainbowFebruaryNovemberDecemberfreezingtomorrowSeptemberlightningyesterdaytemperature

Unreal Unearth: Unending by Hozier 2025-01-08

31 Items: JulyHozierBedouineTooSweetFareWellWhoWeAreSonOfNyxEmpireNowFirstTimeFrancescaThatYouAreFirstLightAnythingButUnknown/NthSwanUponLedaHymnToVirgilEatYourYoungAllThingsEndBrandiCarlileAllisonRussellDeSelby(Part1)DeSelby(Part2)DamageGetsDoneNobody’sSoldierButcheredTongueI,Carrion(Icarian)WildflowerAndBarleyThroughMe(TheFlood)Abstract(Psychopomp)...

Which word in the puzzle is one of the seven plagues of Egypt 2025-03-20

10 Items: licehailbloodfrogsfliesboilslocustsdarknessof livestockof firstborn

Spanish vocab 2026-01-16

28 Items: artmathtalklunchclassclassteachstudyfirstthirdfifthsixthninthtenthsecondfourtheighthspanishscienceenglishseventhscheduleinanhourhomeworkcomputerscalculatorsocialstudiesphysicaleducation

English 1 Terms 2024-12-02

17 Items: __________ is the central idea___________ is a writer's attitude.The exact meaning of a word is _________.A sequence of events that make up a story.To illustrate is to show an ______________.______ is a transition for adding information.Something that stands for something is _________.Words that join other words are ________________....

Our Lady Peace - Word Search July 2023 2023-07-07

31 Items: boyrunhopelifeanniecurveholesjuliasorrythiefclumsydeniedmettlenaveedrefugewaitedapologybirdmanblistergravitypicturerabbitsshakingcarnivalinnocentstarseedallowancedreamlandsimulationsomethingnesssupersatellite

Pope Word Search 2025-06-10

26 Items: ofMaypopeheadawaybornfromstaypoorhopeAprilpapalpeaceEarthbravefaithchosencaringleaderhumblenaturememoirprotectencouragethe age ofguesthouse

Solar System 2025-10-22

14 Items: orbits star directlyfails to clear orbitorbits planet directlysame as asteroid but smallerSun-based solar system modelEarth-based solar system modelmass from space hitting surfaceforce of attraction between massescelestial mass of rock, gas, & dustmass from space striking atmospherefield of comets & debris past Neptune...

Electromagnetic Waves 2024-05-09

12 Items: blocked by bones and teethused in heat lamps for reptilesconverted into sound and pictureemitted by radioactive materialsa disturbance that transmits energybees can see this type of radiationthe transfer of energy by electromagnetic wavesthe distance from one crest of a wave to the nextwaves that transmit energy through matter or empty space...

Summertime 2023-05-05

39 Items: bbqhotjulyjunebeachboardchalkchillgamessleeptexasaugustcruisefamilyhikingmoviesskiingsmoressoccertennisairportbicyclebubblescampingfriendshydratebaseballcarnivalfestivalshoppingsunshineswimmingvacationfireflieslakehousesnowconessprinklersunglassesgrandparents

Teddy Inspired Word Search 2025-01-17

39 Items: JOYOMIROBTEDBABYBIBSBURPCRIBCUTEJILLJULYLORILOVEPLAYANGELBRYANOLLIETEDDYBOTTLEDIAPERFAMILYGIGGLEGRAHAMGRAMMYGRAMPSKISSESONESIERATTLECUDDLESLULLABYNAPTIMEPAJAMASRACHAELSWADDLEBATHTIMEPACIFIERTEETHINGSAUFFERERSEVENTHEENTH

Chapter 11 Word Search 2024-05-03

37 Items: the outermost layer of our atmospherethe lowest layer of Earth's atmospherean instrument that measures temperaturemeasures the distance north or south of the equatorwinds that occur in belts that go all around the planetan instrument that measures wind speed and wind pressure.heat-driven cycles that occur in the air, ocean, and mantle...

4th Grade Final Word Search 2026-01-29

52 Items: artecodayseegetclubwhatwhentripshownosecoldsomerestfeeddogsgamethisfirstthirdfifthsixthgradedancemusicmovieearthfieldwrongrunnyfevergoingplantwatchtheresecondfourthsoccersportstalentdoctorconcertflowersweekendbirthdayheadachemedicinebaseballtomorrowtaekwondoafternoonstomachache

Constitution 2023-09-19

20 Items: vetoratifyReviewPowersPowersPapersProcessCollegepreambledelegaterepublicamendmentbicameralof Powersof RightsfederalismConventionSovereigntyconstitutionand Balances

The Nutcracker Ballet 2023-10-11

20 Items: taleclaraPrinceCoffeemagicalde deuxof SnowelegancegracefuldazzlingballeticSoldierswhimsicalof SweetsgrandiosedreamlikeenchantingPlum Fairytchaikovskyof the Flowers

God's Names - By: Dillon Postma 2024-04-10

18 Items: sonwordabbajesusbiblerabbisaviorof Godof GodfathermessiahteacherMessiahof JesusDelivererDelivererChosen OneRelated to Man

Memory Word Search 2024-12-17

18 Items: "Flash Drive" of the brain​Inferior to hippocampus proper​Paired, almond-shaped structure​Learning stage of memory creation​Ability for brain to adapt and learn​A type of memory correlated with smell​Receiving input from Entorhinal Cortex​A type of memory correlated with hearing​gateway between hippocampus and neocortex...

CELL CYCLE 2025-01-07

18 Items: double helixresting phasemeans "one part"means "many parts"life activities of a cellbuilding block of proteinprovides quick energy for cellcarries DNA message to ribosomecarries amino acids to ribosomebuilding block of nucleic acidsDNA replicates during Interphasecell divides into 2 identical cellsa structural component of ribosomes...

Los meses 2025-10-09

19 Items: MaywasJuneJulydateMarchAprilmonthtodayfirstAugustJanuaryOctoberFebruaryNovemberDecemberbirthdaySeptemberyesterday

CP S2 Word Search 2025-05-12

38 Items: the charge on an ionstarting substances​substances that are formed​substances are not evenly spread out​Chemical reactions that absorb energy ​The mass of a substance per unit volume​number of protons & neutrons in an atom​Chemical reactions that release energy ​anything that takes up space and has mass​...

Lunes Word Search 2025-01-29

19 Items: MayJuneJulymarchAprilmondayfridaysundayAugusttuesdayJanuaryOctoberthursdaysaturdayFebruaryNovemberDecemberwednesdaySeptember

Lesson 4: Father of Many Nations 2024-04-05

14 Items: heirisaacshieldrewardnationnationsbehavioralmightyoffspringtestamentof promisedemonstrateof the earthrighteousness

APP Week 2025-05-31

17 Items: ExpertsAutonomyMidwivesEmpoweredEducatorsSeptemberAdvocatesChampionsAssistantLeadershipof PracticeAnesthetistPublicationsPractitionerCertificationBased Practiceof Nursing Practice

Aerodynamic Word Search 2025-10-30

25 Items: Real-world applicationEarly models of designsStudy of motion and forcesScientific tests conductedPhysical model for testingOutdoor real-world testingUsing computer calculationsHow well a system functionsFactors that can be changedPositive aspects or benefitsFacility for airflow testingPower efficiency measurementNegative aspects or drawbacks...

Peace Out Poplin! 2025-05-30

51 Items: RussRubyMoonLongKochJobeLokenKauppPatelVidalCobosPerezMooreCrewsKotheHelmsPetkoCareyFirstThirdFifthLauriGlahnWattsSparksStokesMurphyWhitedLemmonMedlinSiegelSecondFourthButtersWheelerMcLaneyMenesesBeverlyBellamyCarlsonMoreiraHollandHolsmanHagermanMcTeagueMelendezRoskoskeyMessengerMastrovitoHouseholderKindergarten

Word Search 2025-12-04

50 Items: LeoZoeArtBusEricCyanTestMathDeskHelioSilasAzielRubenLoganDylanXariaElisaLopezGradeMusicLunchBookspaperValenaRonaldJustinCastroAvilesKellerSchoolFourthRecesspencilOfficeNashlynJerremeLatrellShanellGustavoHonestyPhonicsReadingScienceLibraryteacherCrystellcomputerMaryAliceclassroomCristopher

International Celebrations and Festivals. 2024-09-18

16 Items: festival of colorsMuslim fasting monthBeer festival in GermanyHindu festival of colorsWater festival in ThailandFestival of lights in IndiaJewish celebration with candlesLunar New Year celebrated in ChinaMexican holiday honoring the deceasedIrish holiday honoring the patron saintStAmerican holiday with a feast of gratitude...

Building Components 2023-02-20

25 Items: a lowest part of basea top that covering of a buildingto guide water flow from the roofa protection from the rays of the sunthe bottom horizontal member of a walla very tall building with many storiesthe part of a wheel or tire that makes contacta triangular portion of a wall between the edgesprovide the structure's stability from the ground...

Word Search - 2nd Game 2025-04-10

24 Items: Famous rice dish with chickenMost popular bun in BreadtalkA popular savory fried dough snackA small, steamed bun with a filling-BaoSoft and tender grilled skewers of meatSweet, chewy dessert made from glutinous riceMinced meat and dough and being fried afterwards.A thick rice porridge served with different toppings...

Chapter 7 Foundations Electricity 2025-05-17

31 Items: also known as probe1.1,000 of an amperealso known as insulatorray Tesla high-frequency currenttherapy also known as phototherapyany material that conducts electricitycurrent rapid and interrupted currentelectrode used on the area to be treatedsubstances that speed up chemical reactionsuse of electrical currents to treat the skin...

Unit 3 Vocabulary Word Search Review 2025-11-07

40 Items: a minor wrongdoingnot harmful or offensivevery unpleasant, annoyingbeyond criticism, faultlessbrisk and cheerful readinesscountless or extreme in numbernoxious, harmful, or poisonouscareful of one's speech/actionswarn or reprimand someone firmlyauthoritative counsel or warningthe state of being without guiltnot showing respect, impertinence...

Improperfraction Word Search 2023-01-12

12 Items: part of wholetop of fractionbottom of fractionnumerator is larger thanfractions that are equalthe product of two factorsnumber whole number with fractionnumerator is smaller than denominatorfraction using lowest number possiblea number multiplied with another numberknown size or amount that helps understand the difference...

BriZee's Baby Shower 2015-07-23

40 Items: BibBabyCribMilkGirlJulyCrawlBottleDiaperRattleCryingOnesieCradleWalkerShowerBlanketTeetherBouncerCarseatFormulaNurseryLullabyBootiesLayettePacifierStrollerBabyfoodBassinetSwaddlerSippycupHighChairDiaperBagWashClothBurpclothBabyshowerBriZeeBabyBabyRizwanTwentyfifthNurseryrhymesTwoThousandFifteen

DAILY WORDS 2021-10-18

40 Items: agecowmaygoodnamelivemeetnicebluejunejulynightbrowngreenhorserulermarchaprilyellowerasermondayfridayaugustmorningeveningtuesdayjanuaryoctobernotebookscissorssaturdaythursdayfebruarynovemberdecemberafternoonwednesdayseptembernationalityhighlighter

Love Word Search 2024-05-27

44 Items: lovejunevowssuitloveringjulysarahtysonpiperbridegroomdressdanceyoubouremmenfamilykitimatweddingbouquetstevensflowerstequilakitimatromancefriendsforevermarriagetogethermarriagesteenbucknashvillegreatdanehoneymoonleviathanhappinessengagementcumberlandcelebrationkendalavenueclingmansdomelaketownranchcampbellriverhighschoolsweethearts

Long i words 2025-02-27

40 Items: whyshedryfrysilotinywisepipetiedtyperelyjulydenyshinyfinalpilotalikebrideglidetriedfrieddriedstylerhymelightfightsightrightapplycyclespidersilentstrifepolitebrightknightcomplytycoondelightcyclone

Revision 2025-09-21

40 Items: sixmaypensayzerofivejulypinkblueopenworkthreesevenfortyfiftyblackwhitebrownrulerwriteclosecheckthirtyaugustsummerwinterspringautumnyellowmarkerpencileraserlistenfifteenhundreddecemberseptembersharpenercalculatorhighlighter

Days, months, colours and school supplies 2025-09-26

41 Items: penMayredglueJuneJulybluegreypinkpaperdiaryrulerMarchAprilblackgreenbrownpencileraserAugustMondayFridaySundayorangeyellowpurpleJanuaryOctoberTuesdaynotebookscissorsFebruaryNovemberDecemberThursdaySaturdaysharpenerSeptemberWednesdayhighlightercontactbook

St. Brendan the Navigator Word Search 2023-11-16

12 Items: fenitmonkstraleeirelandfinnianscotlandmonasteryannaghdowncolumcilleof Irelandthe Navigatorof the Blessed

Macro Chapter 21 Vocab 2024-10-29

17 Items: exports minus imports (X-M)a period during which real GDP decreasesgoods and services purchased from other countrieswhen governments buy goods and services from firmsThe purchase of new capital goods (tools, instrumentsTaxes paid minus cash benefits received from governmentsThe expenditure by households on consumption goods and services...

Medium Level 2021-02-23

40 Items: SamLOLRedMayELAGymNiceBluePinkJuneJulyMathEasyHardFunnyGreenMarchAprilDanceAudreyOrangeYellowPurpleAugustSocialMeduimSoccerJanuaryFebuaryOctoberScienceReadingStudiesNovemberDecemberSwimmingSeptemberGymnasticsVolleyballBasketball

February Word Search 2023-10-25

40 Items: idoannlovehughmarydavejennterppylejulybridegroomjuliascottsarahloganblakedavidkevinncatslaythsilvergoldenaugustcarlylelindsayflemingweddingtestudokavetskyfebruaryredskinsmarylandfirstkissjambalayacakesplusfatherjohnwashingtongusthegoosecitrussquall

Summer Word Search 2024-05-24

40 Items: hottanjunejulybeachsunnyaugusttennisvacationcarnivalicecreambarbecueswimsuitlabordayoutdoorsbaseballsunscreenhurricaneflipflopsfireworkslawnmowermarcopolosharkweekwaterslidesandcastlesunglassesgraduationtrampolinebasketballvolleyballsummertimeblockpartyfrieddoughsummerbreakferriswheelperspirationamusementparkrollercoasterairconditioner...

Zxxxxx 2024-06-02

40 Items: zooangjulylumapinkwifezachboratyoshishrektacosconanqueenaugusthawaiimarvelsummerpandasmoviesanimalsfloridafriendsmihalikhibachitangledhusbandwatchesaquariumicecreamsixyearsbabyyodastarwarsbikeridestheofficedinosaurspointpeleevideogamesmapleleafstaylorswiftjurassicpark

asdf 2025-07-06

40 Items: funred,blue,July,flag,Bell,white,Tacos,stars,block,party,Quincy,family,summer,Anthem,friends,america,freedom,Hotdogs,stripes,Memories,Dunktank,IceCream,Barbecue,Sunshine,Fireworks,neighbors,LongBeach,Sparklers,Lawnchair,Sunscreen,BaldEagle,Patriotism,Declaration,SixthAnnual,Starspangled,firecrackers,unitedstates,Independence,Constitution,

Summer word search 2025-07-23

42 Items: sunhotfunpooldeerJulypoolswimsunnybeachoceanmangobunnycloudGrasssportwatersummerstitchfloweryellowgelatoseasonAugustslushypicniccoconutrainbowchickenicecubegogglespopsicleicecreampalmtreetropicalswimsuitpineapplebutterflyplaygroundwatermelonsummerbreakawesomeMarley

3 Worlds Meet 2025-09-08

10 Items: a large farm zonea series of religious warsa monotheistic religion of the muslimsWhen you travel from one place to anothera mixed woodland grassland biome and ecosystemthe line of descendants of a particular ancestora period marked in time of Classical learning and wisdoman ethnolinguistic group of indigenous people of mesoamerica...

Caput II 1st Declension Nouns 2024-11-07

20 Items: lifepoetsmoneyangerlivespoet'spoets'of livesgate (acc.)of the roseof thoughtsto the girlsthe sailor'sshapes (acc.)rumors (abl.)sailor (acc.)for philosophywith penaltiesfortunes (acc.)fatherland (voc.)

Magazine Word Search 2022-12-09

16 Items: My Last NameMy First HusbandMy Third HusbandMy Second HusbandMy Fourth HusbandMy Daughters NameMy Dads First NameWhat Did I Die FromWhat I Loved To ReadMy Fifth And Last HusbandThe Month I Was ConvictedMy Highest Grade Of EducationWhere I Got Injured As A ChildWhat I Used To Poison My VictimsHow Many People I Admitted To Killing...

CHAPTER 14 2023-04-21

16 Items: eraeonfossilepochsperiodshalf-lifekt-boundrypaleontologistplatetectonicsrelative-datingradiometricdatingcambrian-explosionlaw-of-superpostiongeologic-time-scaleendosymboint-theorytheory-of-biogenesis

BSN Fair Treatment of Financial Consumers Word Search 2024-03-13

20 Items: BSN Treat Customer Fairly Charter (TCF) can be found in the Bank's ____________________________________________.There are _________________________________ principles of FTFC stipulated in Bank Negara Malaysia Policy Document of FTFC....

Gov Vocab 2025-12-07

25 Items: information from congressImplied presidential power to withholdPresident's annual message to Congressauthority of a court to hear and decide casesA person who brings a legal action against anotherLegal rule or rule established in previous court casesLegal right of a party to bring a case to federal court...

Fantasy Cartoons 2025-07-27

15 Items: TimeShrekPrinceTangledthe PoohOwl HouseDuckTalesof ArcadiaSchool BusLion GuardLittle PonyTales of ArcadiaFairly OddParentsto Train Your DragonThe Labyrinth of Magic

Happy Birthday, Michael!! 2025-08-02

13 Items: to the leftto the righta great leapgroup of twomonth of loveseven of themmost of Earthjust next doorbackwards loopdrive with easewithout minionsbefore an audiencesounds like enchiladas

Occupational Therapy Care vocabulary 2023-03-10

23 Items: adulteatinghealthdevicereportbathingof lifeleisureculturegroomingmobilitydressingtoiletingpediatricassessmentadaptationenvironmentproductivitydevelopmentalaccommodationof daily livingcare activitiesrecommendations

Nail Diseases and Disorders 2025-03-12

20 Items: nailspoon nailswhite spotsbitten nailstrumpet nailfolded nailsingrown nailsfungal infectionram's horn or clawtiny pits roughnessdeformity or diseasethickening of the naildarkening or black bandlifting of the nail plateskin becomes split or tornsplit brittle nails with ridgesthin white nail plate very flexible...

Spelling 6 2024-03-27

10 Items: opposite of shortthe opposite of pushanother word for nicethe solid form of waterthe eighth month of the yearused to make windows and cupspart of an animals foot, especially catsa mineral used in jewelry, like a diamonda small round piece of metal used for moneyparts of the body muscles connect to (plural)

Tristan's word search it's hard 2026-01-23

15 Items: actactorscenepropsstoryscripttheaterproblemdialoguenarratorsettingsof dramadirectionsof charactersme if you can

Legacy of the Congress of Vienna 2026-02-01

15 Items: RussiaAustriaPrussiaBritainAllianceof Powerof ViennaMetternichHardenbergTalleyrandLegitimacyCastlereaghAlexander IRevolutionsPolitical Map

Unit 3 Vocab Word Search 2025-11-14

12 Items: skewedspreadoutlierassociationcategorical dataline of best fitquantitative datameasure of centermeasure of spreadstandard deviationinterquartile rangecorrelation coefficient

Stem List 3 - Find the example words hidden in this puzzle. Look at the clues and definitions at the bottom of the paper for clues on which words are hidden. Use your stem notes! 2024-11-04

22 Items: the act of forgivingcapable of being submergedaffected with or inclined to claustrophobiaattended by or causing suffering or disasterShe suffers from some ____ without her glasses.one of the same or nearly the same age as anotheran undertaking usually involving danger and unknown risksthe adhesive friction of a body on a surface on which it moves...

Quality Definitions 2025-03-27

20 Items: waste materialrequirements have been metDoing it right when no one is lookingexisting, happening, or done at the same time.for a specific intended use have been fulfilledWhere requirements for a procedure are retrievedrelating to a corporation, especially a large company or group.a thing that makes something better or is better than something else....

Equalforces Word Search 2025-12-16

17 Items: to take inwhen light bendsto bounce off a surfacea form of energy we can seean object that stores energya form of energy we can hearthe stored energy an object hasforces that have the same strengthforces that have different strengthsa device that opens and closes a circuita form of energy measured by temperature...

Vocab Word Search 2022-09-08

20 Items: to ask a questionthe act of hunting for factsthe size or amount of somethingto work effectively with othersmodel a constructed model of somethingmodel a picture that represents somethinga guess or hypothesis based on observationsa factor in an experiment that affects the outcometools and supplies needed to conduct an experiment...

Geography Terms 2022-11-16

28 Items: A small streamWet spongy groundNatural elevationA small wooded hollowNarrow gorge with streamrounded hill or mountainA high steep face of rockA ring shaped coral islandA waterway dug across landA slowly moving mass of iceA steep rugged rock or cliffsmall low lying coral islandA small sheltered bay or inletA ridge of sand created by wind...

THE BLOOD 2024-04-04

24 Items: ELSEloveWINEjesusBLOODWHOLEsavedcrossgloryLIVEStruthenoughchristOF GODCHAINSfreedomvictoryhealingsurrendercrucifiedhallelujahforgivenessresurrectionOF SUFFERING

Branches of Government Wordsearch 2024-12-18

22 Items: VetoBillsHouseSenateBranchOrdersPolicySpeakerCabinetCongressMajorityMinorityLawmakingCommitteePresidentPresidentFilibusterImpeachmentof the UnionBranch (Congress):of RepresentativesCommander-in-Chief

Mock Trial 2025-11-10

29 Items: JuryJuryjurorCourtIssueJudgeFelonycorpusMotionCounselprocessHearsayVerdictWitnessof proofof courtreporterevidenceMistrialAcquittalDefendantPlaintiffProsecuteTestimonyAdmissibleConvictionIndictmentMisdemeanorinstructions

Literary Terms, Elements & Devices Word Search 2022-10-05

40 Items: A voice behind the peomThe objective meaning of a wordThe choice of words a writer usesThe Central character and a storySomething is given human attributesThe classification of literary workThe perspective a story is told fromThe highest point Tension in the plotThe use of informal language in writingThe struggle between two opposing forces...

Excellence 2025-08-26

20 Items: Never giving upProcess of improvingTreating others wellAchievement of a goalCreating something newAlways aim for the bestImportance of somethingConcentrate on one thingClear idea of the futureHard work towards a goalGuiding others to achieveStrong commitment to workReason for doing somethingWorking together as a groupSelf-control and consistency...

Nonfiction/Memoir Vocabulary. 2025-10-10

20 Items: Roll call of prisonersTo give false representationA person who carries out harmful actsThe fear and hatred of anything strangeA Jewish prayer recited in the daily ritualA person not recognized as a citizen anywhereAn official whose job is to inspect new thingsA prisoner who is elevated to a better position...

Ida B. Wells-Barnett 2025-05-06

15 Items: NACCPIdaJrHermanAlfredaCharlesJournalistSuffragistCourageousBirth PlaceDeath PlaceCause of DeathWhen She was BornNumber of Children She HadName of the Book She AuthoredComplete the Sentence - Anti-Lynching _____

X Word Search 2025-03-06

13 Items: XrayXenonXeroxXfactorXrayfish(a name)Xylophone(a type of ship)(part of a plant)(hugs and kisses)(a type of fruit)(a garden walkway)(short for xylophone)

Fantasy Cartoons 2025-07-27

15 Items: TimeShrekPrinceTangledthe PoohOwl HouseDuckTalesof ArcadiaSchool BusLion GuardLittle PonyTales of ArcadiaFairly OddParentsto Train Your DragonThe Labyrinth of Magic

Spelling Test 3 2022-09-23

28 Items: against slaveryhostile; unkindunfit to be eatenthe act of going awayto repeat or say againone who is not a memberbefore recorded historythat which is not nuclearoccurring twice in a yearto stop or prevent an actionapart from one's choice or willto go do, come down, fall, or sinkof the highest degree or importanceextending across the Atlantic Ocean...

A Monster Calls: Vocab #1 2023-12-04

30 Items: a small sofarefuse to stoplean but strongin an unclear waynecessary for lifeconfused; perplexedto disturb or irritatevery scary or frighteningrise and move, as in wavesa look of anger or dislikea tall tower in a buildinga close friend or associateexpress pleasure with wordsa feeling of a lot of angerexert much effort or energy...

Dictionary Day - 20 Cool Words to Know in English 2024-10-15

20 Items: A commotion or uproarSomething conducted in secretA violent and uncontrolled frezyA mix or jumble of various itemsSomething delicate or insubstantialPreordained by a force of fate or destinySmall in size, particularly a small childA physical fight or altercation using fistsSpeaking foolishness, nonsense, or insincerely...

Chapter 11 Genetics 2025-03-20

20 Items: version of a genestudy of hereditythe separation of allelesregion of DNA w/ informationgenetic makeup of an organismphysical characteristic of an organismorganisms that have two identical allelesalleles genes that have more than two allelestraits traits controlled by two or more genesthe likelihood that a particular event will occur...

National 4 Physics Wordsearch 2025-04-01

20 Items: The rate of change of velocity?The number of waves per second?The emission on alpha, beta or gamma?Another term for Potential Difference?The rate of flow of charge in a circuit?The name given to the Sun and the planets?Component used to measure the temperature?The only particle in an atom that can move?Quantity that is often simplified to speed?...

Environment Stewardship 2025-05-06

20 Items: Long-term weather patterns in a regionTo break down naturally by microorganismsA poisonous substance harmful to the environmentA natural or artificial lake used to store waterThe upper layer of a forest formed by tree crownsTo plant trees in areas where forests were removedImproper disposal of trash in public or natural spaces...

Fantasy Cartoons 2025-07-27

15 Items: TimeShrekPrinceTangledthe PoohOwl HouseDuckTalesof ArcadiaSchool BusLion GuardLittle PonyTales of ArcadiaFairly OddParentsto Train Your DragonThe Labyrinth of Magic

God's Names - By: Dillon Postma 2024-04-10

18 Items: sonwordabbajesusbiblerabbisaviorof Godof GodfathermessiahteacherMessiahof JesusDelivererDelivererChosen OneRelated to Man

Gods Names - Eli Postma 2024-04-10

18 Items: sonwordabbajesusbiblerabbisaviorof Godof GodfathermessiahteacherMessiahof JesusDelivererDelivererChosen OneRelated to Man

Module1: Introduction to pathology/Skeletal system 2023-12-20

18 Items: The primary site of ossificationThe most common form of arthritisA generalized decrease in cell sizeA generalized increase in cell sizeHaving more than one illness at the same timeAn abnormal change occurring in mature cells.The forward slippage of one vertebra on anotherA specific cancellous bone located in the skull...

Lisa and Rob's wedding wordsearch 2025-06-02

14 Items: City we live inRob's middle nameRob's birth monthLisa's middle nameLisa's birth monthName of our pet catHazel's middle nameMatching tattoo animalSchool we both attendedLast gig we went to seeOur most watched TV seriesOur first holiday destinationBig nut that brought us togetherWhere we hung out together in our teens

Lech Lecha 5.0 2024-11-03

18 Items: מִצְרַיִם“messenger”King of ElamKing of Salem“KHohSHehK” חֹשֶׁךHer name means “flight”“father of a multitude”Hunger, scarcity of grain“noblewoman” or “princess”Son of Haran, Avram’s nephew.His name means “G-d will hear”His name means, “exalted father”Avram’s age when Ishmael was bornAvram ask her to masquerade as his sister....

algebra ll word search 2024-09-19

15 Items: GCFtermsrootszerosnumbersbinomialsolutionfunctionfactoringminomialsexpressionpolymonialsof polynomialspoint end behaviorform of polynomials

Ambassador Word Search 2025-04-21

17 Items: LeakOrderPolicyPardonActionTreatyCabinetImpeachCollegeof StaffPrivilegeSecretaryAmbassadorBureaucracyWhistleblowerSecurity Councilof Management and Budget

Origins and Insertions of the Neck, Face, and Respiration Muscles 2025-09-25

23 Items: Origin: Temporal fossa. Insertion: Coronoid processOrigin: Spinous process C2. Insertion: Transverse process C1Origin: Transverse process C1. Insertion: Inferior nuchal lineOrigin: Spinous process C2. Insertion: Lateral inferior nuchal lineOrigin: Posterior tubercle C1 Insertion: Medial Inferior nuchal line...

ntro to Arts A/V Tech and Comm Weeks 13 - 14 2025-12-03

24 Items: A unit used to measure the intensity of sound.The art and technique of motion-picture photography.The written text for a play, film, or broadcast production.A public display of art, objects, or information for viewing.The process of repeating a segment of audio or video in production....

Middle School ELA Literary Terms 2026-02-12

21 Items: Boom! Zing! Crunch!the problem in a storyMain character in a storyusing words that sound alikethe leaves danced in the stormcomparing two words using like or asa major category or type of literaturecomparing two words not using like or asgroup of lines in a poem; poetic paragrapha word that means the same as another word...