fourth of july Word Searches

chapter 2 basic chemistry vocab 2023-09-25

14 Items: the outermost shell of any atomAnything that takes up space and has massnumber of protons within the nucleus of an atomScientific study of the properties and behavior of matterA substance that can't be broken down by non-nuclear reactionsthe mass of an atom of a chemical element expressed in atomic mass units...

Top 15 Laws/Court Decisions 2025-05-05

15 Items: of RightsAmendmentAmendmentAmendmentAct of 1862Constitutionv. Madison (1803)v. Arizona (1966)Rights Act of 1964Rights Act of 1965v. Wainwright (1963)Security Act of 1935v. United States (1919)Scott v. Sandford (1857)v. Board of Education (1954)

Jesus 2026-02-08

17 Items: Mother of JesusJesus calmed thisFollowers of JesusBirthplace of JesusJesus walked on thisBlind man Jesus healedJesus rose on this dayEarthly father of JesusTown where Jesus grew upDenied Jesus three timesJesus is the Lamb of GodStories Jesus used to teachJesus turned water into thisRiver where Jesus was baptizedJesus is the Light of the World...

Chapter 9 vocab 2026-04-15

14 Items: energy.material in which heat flows slowly.sum of the kinetic and potential energytransfer of thermal energy by electromagnetic waves.a measure of how spread out, or dispersed energy is.transfer of thermal energy in a fluid from one place to another.matter consisting of positively and negatively charged particles....

Introduction and Safety for Radiology for Veterinary Technicians 2026-01-23

19 Items: An example of PPEAs Low As Reasonably AchievableThe x-ray ___ contains the anode and cathodeDevice used to measure x-ray exposure (2 words)Negative end of the x-ray tube containing tungstenPositive side of the x-ray tube where x-rays are producedDecrease in the strength of the x-ray beam near the anode (2 words)...

Topic of Novel Study 2026-05-05

15 Items: Harrison ___constant ___constant ___bad "not place"prevalence of ___values ___ the mosttopic of novel studyGreek for "not place"the individual is ___TED talk by ___ Gendlerblindly following a ______ characteristics of a dystopiadestruction and distrust of the ___illusion of utopia, but actually...___ of information, freedom, and independence

Word Search for Dementia Care 2026-03-10

10 Items: not shortshape of a ballthe color of snowthe color of rosesthe color of grassthe color of nightthe opposite of bigthe color of the skyshape with four sidesthe opposite of small

Writings of Wisdom 2025-12-13

12 Items: JobGloryIsaiahWorkerPraiseof LifeEternalWorshipof SolomonDeliveranceof the WorldResurrection

MONTH 2021-09-14

5 Items: JUNEJULYMARCJANUARYSEPTEMBER

MONTH 2021-09-14

5 Items: JUNEJULYMARCJANUARYSEPTEMBER

family and sports 2024-12-24

18 Items: leapingslow runninga female childthe son of one's siblingthe sister of one’s parentthe brother of one’s parentthe daughter of one's siblinga child of your uncle or aunta father's or mother's fatherthe world’s most popular ball gamesport in which people lift weightsthe sport takes place in pools or open water...

Participles 2022-06-23

9 Items: past participle of bepast participle of buypast participle of wakepast participle of comepast participle of knowpast participle of givepast participle of drinkpast participle of beginpast participle of break

verbs 2025-04-05

10 Items: the past of gothe past of eatthe past of buythe past of seethe past of tellthe past of tellthe past of havethe past of writethe past of speakthat past of sleep

The skeletal system 2025-10-01

18 Items: This is the long shaft of a bone.This bone is located in the upper legThis is the side-to-side curve of your spine.metacarpals are which classification of bone?The sternum is an example of this type of boneThis is the single large bone of the upper armThis is the main core or axis of the skeleton.This is the process of creating new bone growth....

las alonso 2026-02-10

21 Items: DogsArmedAvatarof ManWrightDetroitJarheadTraffikthe YardDetainedof Youthto Earth& Furiousthe BroomChristmasCaptivity& Furious 6at St. Annaof the YearConstantineLeprechaun:

World War II People and Events 2026-05-12

14 Items: Naval station bombed by JapanLeader of Italy during the warLeader of Germany during the warTurning point of the Pacific WarLeader of Soviet Union during the warLargest amphibious landing in historyName of German invasion of Soviet UnionAmerican president during most of the warCity that America dropped an atomic bomb on...

Zack & Kyli 2024-11-10

23 Items: Guns UpBest ManHometownDog's NameRing BearerMaid of HonorYears TogetherCollege MascotWhere They LiveBride's Maiden NameMonth Zack ProposedMother of the GroomMother of the BrideGroom's Middle NameBride's Middle NameGroom's Zodiac SignCollege They Went ToGroom's Favorite TeamColor of Groom's EyesBride's Birthday MonthBride's Favorite Movie...

US Symbols 2024-12-18

20 Items: SamFlagBellSealBillEagleHouseJerseyDonkeyLincolnBuildingRushmoreElephantPentagonof the USWashingtonof Justiceof LibertyConstitutionCourt Building

Revelation 4 2025-11-20

26 Items: doorlioncalfeaglewingsgloryhonorpowerjasperthronebeastsof mancrownsthankscrystalsardinetrumpetof goldraimentcreatedof glasspleasurethe spiritlightningsthunderingsfour elders

Just because party 2026-02-22

27 Items: IRGToJobcarDateTimeWantVentLoveDrinkCauseHappyMoneyGiftsHungrySingingDancingLaughingto relaxHomemadeof ur manHouseholdor ur ladyof sitting at homesick of dem dam kids

Theatre Terms Word Search 2025-06-26

39 Items: cueactoutleftwallrolebodycaststagerightpropsactorscenestagelinesvoicea legscriptpresetmanagerprogramcostumesdirectorblockingcurtainsensembleheadshotaudienceauditiontableauxbackstagedownstagespotlightrehearsalcharactertechnicalprojectionperformanceimagination

Heat science 2024-01-16

14 Items: Measure of heatthermal energy transferMeasure of heat in americaMeasure of heat for scientistsexpansion of matter when heatedtransfer of heat from air densityMeasure of heat in most of the worldtransfer of heat from direct contactA temperature so cold, Matter is motionlesstransfer of heat from electromagnetic waves...

Endocrine System 2022-10-03

24 Items: master glandsugar in urinetumor of a glandeyeball protrusiongland making insulinhormone from testiclesmyx/o is combining formword for increased thirstabnormally low blood sugardry, waxy swelling of skinhormone of body metabolismglucose-lowering medicationstimulator of fight or flightgland located above each kidneyremoval of a non-specific gland...

Human and Social Biology 2022-12-09

22 Items: Gas to SolidSolid to GasLiquid to GasGas to LiquidLiquid to solidSolid to liquidTightly compactedMovement of WATERSlightly sepraratedNeeded for photosynthesiscollection of different cellsFewer molecules and separatedThe shape of the red blood cell.collection of different tissues.Form tissues that line the body cavities....

Integumentary Search 2022-09-26

30 Items: fat layerpiercing woundfriction woundcovers the bodycavity with pusdeath of tissueabsence of germskilling bacterialice infestationfluid filled sacsolid lesion >1cmtorn, jagged woundblue color of skindeep linear splitscaused by itch mitewasting of epidermisabnormal hair patternanother name for boilanother name for hivesanother name for armpit...

7th Grade Saintly Profile Recap Chapters 1-24 2026-03-24

24 Items: Saint - AcutisSaint - BaptistSaint - Our LadySaint - Known as SimonSaint - Patron of WritersSaint - Patron of StudentsSaint - Patron of PrisonersSaint - Doctor of the ChurchSaint - of Calcutta (mother)Saint - Feast Day is April 28Saint - Patron of AstronomersSaint - Feast Day is March 25thSaint - Patron of Korean clergy...

Mattot - Massei 2024-07-27

18 Items: מֹשֶהמַטוֹת“Neder”שְׁבֻעָהיִשְׂרָאֵלSon of Nun.Son of JephunnehHe died on Mt. Hor at age 123To grant pardon for an offense.Anyone who kills anyone may flee here.After leaving Ritmah, Israel camped here.You are not to pollute the land with this: ______“My house shall be called a house of ______ for all nations.”...

Engineering Word Search 2024-09-27

20 Items: Increase in speed or rate.The main body of an aircraft.Something that a chicken laysThe matter from which something is made.A stoppage or sudden cessation of motion.The speed, or time that it takes to land.A subject concerning numbers and equations.Make something on a large scale using machinery.The action or process of moving, or being moved....

Masthead Word Search 2023-02-21

28 Items: journalista reportercapital letterstype of letteringtitle of an articlea piece of reportinga thick visible printa popular type of papera news article or bulletinnewspaper published everydayline giving the date of writingnewspaper published once a weekthe main article in a newspaper.information about current eventsnewspaper appearing every 4-weeks...

Interim Assignment DK 2026-02-25

25 Items: Founder of GeorgiaSystem of trade and wealthColonists loyal to BritainSpanish explorer in GeorgiaGroup of German immigrants in GAv GA Landmark Supreme Court caseCity founded by James OglethorpeSite of Georgia’s gold discoveryCharitable actions for the colonyRush Discovery of gold in DahlonegaHate group formed during Reconstruction...

Pathophysiology Word Search 2025-09-07

20 Items: Something you can see or measureHow often a disease causes deathCause behind why a disease startsWhen a disease suddenly gets worseYou are born with it, doesn’t develop overtimeWhen symptoms get better or disappear for a whileShape,Structure, or Appearance of cells or tissuesDiscovery of what disease or condition someone has...

Dental implants and partial dentures 2026-02-15

21 Items: of the crown.the denture teeth.Acrylic Partial Denturefor the partial denture.of one component, a rest.in the mouth by the patient.bone on the dental implant surface/A partial denture that can be removed andA denture used for a short interval of timeIt is a biologic process that allows the growth of...

Valley Word Search 2023-02-23

25 Items: a combination of tread and riserthe upper interior surface of a rooma upper horizontal portion of a stepthe horizontal member of the shutterdevice giving protection from the suna vertical distance between two successive treadthe lowest part of the base of an architectural columnThe angle formed at The intersection of two roof slopes...

verbs 2025-04-05

10 Items: the past of gothe past of eatthe past of buythe past of seethe past of tellthe past of tellthe past of havethe past of writethe past of speakthat past of sleep

Assessments and teaching 2023-12-01

21 Items: any curriculum not included in classroom discussioncurriculum that is formally written and tested in the classroomcurriculum that has been implemented into classrooms but not explicitly taughta set of teaching behaviors that have been validated in research such as direct instruction...

Veterinary Science: Write the term for each definition 2026-01-29

22 Items: catdoghorsetowards the sidetowards the tailtowards the backtowards the noselength of pregnancylarge flightless birdstudy of body movementpertaining to the livername of the chest cavityinflammation of the skinsx amputation of dewclawpertaining to the kidneysshort nosed/flattened facesx incision into the stomachlistening with a stethoscope...

Constellation Word Search 2023-12-18

20 Items: giving off lighta milky band of lightbig bear constellationsmall bear constellationa floating rock in spacesomeone who explores spacerevolving around somethingthe coldest day of the yearthe hottest day of the yearthe study of celestial bodiesa group of stars that form a shapemirroring light that is put on themthe belief system of constellations...

wedding 2024-10-03

26 Items: Our babyOur hometownMake of our carFavorite breweryColor of our eyesFirst family vacationLocation of engagementFavorite getaway stateMonth of our first dateFavorite date night activityFavorite pinot noir wine brandFavorite sneaker brand & styleFavorite sport to watch togetherMain stone on my engagement ringRestaurant we had their first date...

Science Word Search 2023-05-16

20 Items: A row on the periodic table.A metal bonding with a nonmetal.Something that can be dissolved.A nonmetal bonding with a nonmetal.Something that can dissolve other things.The number of protons contained in an atom.A subatomic particle with a neutral charge.A subatomic particle with a positive charge.A subatomic particle with a negative charge....

Chemistry, Physics, Energy Concepts 2023-06-01

21 Items: the universal solventsubstance being dissolvedhow fast an object is movingexerting a force over a distancethe ability to do work or cause changesubstance that is doing the dissolvinganother term for negative accelerationmeasure of amount of matter in an objecta type of energy where energy is in motionhow much work was done over a period of time...

Office Word Search 2023-10-17

36 Items: desmondO_S _ _ _ _ _ _ORV example _ _ _80+ _ _ _ _ _ _ _H_A _ _ _ _ _ _ _R_PDO _ _ _ _ _ _New driver _ _ _ _ _ _Not sober _ _ _ _ _ _ _ _MM _ _ _ _ _ _ _ _ _ _ _ _ _Annual report by REO _ _ _ _ _VRU example _ _ _ _ _ _ _ _ _ _What we call a road _ _ _ _ _ _ _Form of stunt driving _ _ _ _ _ ________, move over _ _ _ _ _ _ _ _...

Reeh 2024-08-24

20 Items: Re’ehTorahThe NameThe Placegood works“THE Prophet”The Feast of Booths“Dreamer of dreams”Instruction, for life!faith cometh by _______.The Diana cult. Acts19:28New Jerusalem’s foundationThe 3rd son of Jacob and Leah.The Jewish method of slaughter.the first pilgrimage festival of the year.“Our struggle is not against _____ ____ ______. “...

vocabulary building 2023-02-20

25 Items: an entrydoor handlea set of stepsthe frame of doorwaybuilding upper storeya level of a buildingspread between two limitshorizontal upper of stairsthe top surface of a buildingtwo roof surfaces meet each otheran opening in a wall of a buildingthe lowest load bearing part of a buildingstructural element used to divide or enclose...

Human-Environment Settlement 2023-05-04

32 Items: to give support toremoval of all treesarea turns to a deserteffort to restore forestsraising of animals for foodelectricity powered by waterremoval of salt from seawaterwide variety of life on Earthhaze caused by chemical fumesresource that can't be replacedpermanently frozen layer of soilrich soil made up of sand and mud...

Vocab 2026-05-19

44 Items: a tiptrickerytalkativeinsincereto praisesecretivethe resultcommonplacesecond to lastangry; wrathfula play on wordsto praise highlygreed for richescourage; initiativeabsolutely necessaryto have an effect onthrifty; not wastefulto make fun of; scornto clear of suspicionmenacing; unfavorableexcessively particularto make clear; explain...

Earth's Landscapes 2025-11-18

11 Items: moving to and froevidence of past lifecarved by the Colorado riverlayer in earth with lots of fossilsvisible features of earth's surfacemethod for determining age of objectstudy of fossils of animals and plants30 ft below surface used to be under waterlayers of mud + sand/over time become rocklayer of rock often formed on top of another...

Devarim 2024-08-03

18 Items: King of BashanKing of Heshbon.יַרְדֵּן (English)הַדְבָרִים (English)Brother of the Master.synonymous with “overseer”Number of men it takes for a minyan.The 12 spies are better known as ______.Moab and Ammon were descendants of ____.Moses’ farewell speech to the sons of Israel.The original inhabitants of the territory of Mt. Seir....

Final Exam Review 2023-06-02

34 Items: SI for timeSI for distanceSI unit of forceEnergy of motion.SI unit for energy.Speed plus directionThe change of velocityThe ability to do work.Characteristic or qualityEnergy that will run out.Change of position in timeMercury, Venus, Earth, MarsEnergy of position or stored.Example of a renewable energyJupiter, Saturn, Uranus, Neptune...

Wave Terms 2025-11-06

21 Items: Unit of frequency.Lowest point of a wave.Highest point of a wave.Material through which a wave travels.The passage of light through an object.Wave changes direction because its speed changes.A wave that requires a medium through which to travel.The number of wavelengths that pass by a point each second....

Cnidarians Word Search 2024-01-29

20 Items: Having a diet consisting of other animals.The ability of cnidarians to regrow lost body parts.Stinging organelles within cnidocytes, injecting toxins into prey.The union of egg and sperm outside the body, common in many cnidarians.Symmetry around a central point, a characteristic feature of cnidarians....

Unit 10 APES Review 2024-05-02

20 Items: Cancer causing agentsType of source pollution from a specific locationType of water with high biodiversity and productivityArea of permeable rock, gravel, or sand that holds waterCover 71% of earths surface and moderate earths temperatureType of water that is clear and has low biological productivity...

6th Grade Unit 1 Lesson 1 Vocabulary 2025-09-26

23 Items: to the third power.to the second powerthe space inside of a shapeEach flat side of a polyhedronEach straight side of a polygon(of a parallelogram or triangle)a type of polygon that has 4 sidesside of a parallelogram or triangletell you how many factors to multiplya point where two or more edges meet....

The Jefferson Era 2024-09-03

20 Items: legal authorityprotection moneyleader of the Shawneeloose constructioniststaxes on imported goodsstrict constructioniststype of wagon used to move westhero of the battle of new orleanstreaty that ended the war of 1812site of the death of "The Prophet"explored the purchase north and westexplored the purchase south and west...

Fundamental Word Search 2023-11-18

20 Items: A type of suppressed demandTourism arrivals number refers to ____________ demand.___________demand is when geographical location of demand is changed.Tourism __________ are expenditures by international inbound visitors.Visitor arrivals into Singapore are also known as ___________ tourists....

Musculoskeletal System Diseases & Disorder Word Find 2026-03-18

20 Items: A type of cell that is commonly found in mature bones.A lateral curvature of the spine and can occur at any age.An exaggerated inward curve of the lumbar spine, aka swayback.MD; an inherited genetic disorder that affects skeletal muscle.A type of inflammation that involves the bone and its structures....

Building Component ANF 2023-02-20

25 Items: rounded stairs edgeswall separating two independent plotlittle room that projects from a roofany level part of a building with a floorthe lowest load-bearing part of a buildingthe horizontal portion of a stair assemblysteel rods that building engineers set in concreteconnect the highest point of intersected roof sides...

Askiathegreat Word Search 2024-10-04

30 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriaspans much of southern Africathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthage...

Famous Venues 2025-09-14

20 Items: Home of English rugbyHome of Manchester UnitedParis venue of the French OpenIconic New York baseball venueHome of the Los Angeles DodgersStadium of FC Barcelona until 2023Historic home of the Boston Red SoxKentucky racetrack hosting the DerbyIconic London stadium rebuilt in 2007Home of the US Open tennis tournament...

Word search 2026-05-12

20 Items: Energy , stored energy, the ability to do workEnergy , energy of motion, a push or pull on an object, speed in a certain direction, the flow of electric charges, a change in position over time, the smallest unit of an element, two or more atoms joined together,the rate at which velocity changes, the amount of matter in an object...

Polish Verb Chcieć 2025-11-04

24 Items: the form of "chcieć" in present tense for "ja" (I) meaning "I want"the form of "chcieć" in past tense for "on" (he) meaning "he wanted"the form of "chcieć" in present tense for "my" (we) meaning "we want"the form of "chcieć" in past tense for "ona" (she) meaning "she wanted"the form of "chcieć" in future tense for "ja" (I) meaning "I will want"...

Social Studies 2025-11-10

20 Items: the right to votethe father of Communismbelief in equality of the sexesman who unified Germany in 1871the rights everyone is born withfirst ten amendments to the US Constitutionresources used to create goods and servicesJefferson, 3rd president of the United Statesthe middle class that owns the means of production...

united 2022-12-08

66 Items: rosesagebiomecamelbridgeantigenacologybiologybiofuelbiotechbiomassparsleyaerologyairplaneaccepterantibodybackbonebiometerbroadwaybrooklynconsumercompounddolphinscardamomlavenderaerospaceanabolismastronomyacidulantbiospherebiologistchinatownchemistryatmosphereabsolutismabsorptionantibioticabsorbancecapitalismcryospherecardiologyaerodynamic...

MS13 Ch 8 Vocab 2025-03-14

45 Items: sidesamewallmovievoicemeetingagainstdenyingbusinessfaithfulto returnyou have tountil / evendisappointedabout / overto yell at meyou have donebetween / amongmatters / affairsto leave / to letto hurt / to injurethrowing at him/herto manage / to drivefurthermore / besidesto be able to / powergo (subjunctive form)cinema / movie theater...

Birthday month 2023-02-07

32 Items: fryjunejulyyearhometimegoodweekcokemarymarsdavebluemarchclassfantapepsiaugustoctberdinnerfamilyfriendjanuaryholidayweekendfebruarynovemberdecemberbirthdayhospatilshoppingseptember

THIS IS US 2024-08-28

32 Items: LIVTYGGUEJEANLOVEJULYTANKTYLERJAMESBEEZYANGELBELLAOLIVIAWADERSHUNTERGANNONENERGYWINNIESUNTOMERAELYNNSUNRISEPEBBLESKIRKLANDFEMININEILOVEYOUZACHBRYANEVERLEIGHMASCULINEUNCLEMIKEGOODVIBESDADDYSGIRLBESTFRIEND

Arthur’s Celebration - Sense-Sational 2025-11-14

30 Items: SeeD.W.SodaHearEyesEarsNoseCakeJulyBinkyTouchSmellTasteMouthPartyMovieArthurBusterSensesPiñataTicketsPopcornFingersScienceFrancineBalloonsBirthdayStreamersGrandpa-DaveGrandma-Thora

LET'S FIND THE WORDS! :) 2026-05-22

32 Items: HOTMAYCOLDJUNEJULYWINDYRAINYSUNNYSNOWYMARCHAPRILSTORMYCLOUDYWINTERAUTUMNSPRINGSUMMERMONDAYFRIDAYSUNDAYAUGUSTTUESDAYJANUARYOCTOBERTHURSDAYSATURDAYBIRTHDAYFEBRUARYNOVEMBERDECEMBERWEDNESDAYSEPTEMBER

Part Of Building 2022-09-15

25 Items: is situated above the ground levelis vertical member of step on stairis horizontal member of step on stairis the vertical component of any structureis an isolated vertical load bearing memberare the main entry and exit point of any houseare the horizontal load bearing member of a buildingis a part of a wall just under an opening like a window....

GOVERNOOP-THE-WORD PUZZLE 2024-09-17

30 Items: Government by many peopleA state having no governmentGovernment by an absolute rulerAn authoritarian type of governmentThis society has no central governmentIn which the government rulers are maleA type of government led by the PresidentIt is usually consist of chambers or housesAn economic system where productions are valued...

Ancient China Vocabulary 2025-02-18

26 Items: to make the sameable to live foreverpassed along from parent to childto improve the quality of somethingto come into possession of somethinga large group of family members and friendsan official who watches others for correct behaviora Chinese philosophy that emphasizes proper behaviora violent action in opposition of a government or law...

Askiathegreat Word Search 2024-10-04

30 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriaspans much of southern Africathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthage...

Chapter 2: Fundamentals of Ecology Vocabulary Review Part 2 2025-09-11

25 Items: The ocean water in an ocean basin.An organism’s role in its environment.An energy-storing level in a food chain.The water that covers the deep ocean basins.Organisms that float or drift in the sea’s currents.A symbiotic relationship in which both organisms benefit.The ocean bottom that extends from a depth of 4,000 to 6,000m...

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substanceenergy in the form of heatenergy associated with motionable to dissolve other substances.the basic unit of a chemical element.the degree of compactness of a substancethe speed of something in a given direction.the rate of change of velocity per unit of time.the ability to be dissolved, especially in water....

Genshin Impact 2025-06-18

102 Items: ChildeWolf BoyVoid StarMale twinVago MundoFlame-ManeGolden VowFemale twinEons AdriftShining IdolFrozen ArdorBlazing RiffMujina NinjaTrial by FireValley OrchidStage LucindaTurnfire HuntDire BalemoonWindborne BardKreideprinz(e)Plenilune GazeEclipsing StarWise InnocenceCanine WarriorLens of VerityDriving ThunderVigilant YakshaJuvenile Galant...

Environment Word Search 2025-12-10

39 Items: a small, narrow rivera net made by a spiderthe land next to the seanot harming the environmentcompletely broken or damagedthe colorful parts of a flowerthe height of the sea’s surfacea very large body of salt waterthe layers of air around the Earththe soft covering on a bird’s bodythe thick hair on an animal’s body...

Services Word Search 2024-11-14

49 Items: – Government agency that promotes tourism.- What is the act of traveling to and from work called?- What is the activity of traveling for pleasure called?– The promotional name for tourism in the west of Ireland.- What is an urban railway system, often underground, called?- What primary activity involves catching fish and other seafood?...

Cultural universal 2025-09-22

46 Items: ArtFoodrolestrademoneyGoodsToolsMusicSportfamilyverbalvaluesbeliefritualFormalclimatesymbolsshelterclassesWeaponsLeisureof waterlanguageof laborclothingreligionInformalof YouthGeographylandformsResourceseconomicsEducationand OrderproductionGovernmentTechnologytechnologyExpressionLiteratureof survivalconsumptionenforcementDistributioncommunication...

word search 2025-10-22

12 Items: XVIFranceDantonestatesnapoleonmonarchyof terrorguillotinerevolutionAntoinetterobespierreof the rights of men

Lesson 8 Become The Best Version of You / July 26, 2026 2026-07-23

21 Items: joylovekinddutyheartfaithtrustdailyunityservechoicehumbleaccessmiracleimprovetreasureyourselfencourageimportancecompassionwillingness

Magic Joy 5 2023-11-16

32 Items: busysoupjulyricebeeflatefishcombhairwalkbreadearlysteakfirstaprilfifthdirtymarchaugustalwaysdishesschooloctoberjanuarysciencenoodleschickenchineselibraryexercisedecemberdumplings

long I sound 2024-03-18

32 Items: cryfrydrypietiebikepinesighjulytinytypeideagridvinecrimelightfightrightchildpilotfriedstylerhymeslidesquidweightspiderfreighteighteenneighbourintelligentinsignificant

KATSEYE PD 3 2025-09-25

30 Items: miagemLarajulyManonMegantouchdebutmywayspicek-popdenimmusicstoneSophiagnarlyDanielagameboykatseyeeyekonsyoonchaegabrielameangirlstimelaspeI'mprettycatloversmonsterhighdreamacademytonightImightbeautifulchous

FRANK OCEAN 2025-10-03

26 Items: IVYPINKJUNEJULYOCEANWHITETOKYOJONESBLONDORANGEBLONDECHANELSECRETDEALERAUGUSTCHANNELWEDDINGFIGHTERFRANCISMISSINGENDLESSTalbottBISEXUALPROPHECYRELIGIONNOSTALGIA

chapter 2 basic chemistry vocab 2023-09-25

14 Items: the outermost shell of any atomAnything that takes up space and has massnumber of protons within the nucleus of an atomScientific study of the properties and behavior of matterA substance that can't be broken down by non-nuclear reactionsthe mass of an atom of a chemical element expressed in atomic mass units...

Med Terms Midterm Review 2023-04-03

20 Items: cell eatera bone cellsuture a tendondischarge of oildisease producingdifficult movementrecord of a vesselpertaining to bloodcutting into a veinfat tumor or swellingdestruction of a clotexcessively large heartlymph gland inflammationpertaining to against lifesurgical repair of a wrinkleinflammation inside the heartabnormal condition of no sweat...

Coding 2025-06-18

20 Items: RISKPAYERAUDITSDETAILREVENUETHERAPYTEAMWORKSPECIALTYREPLACEMENTSThrough the skinMIS procedure to treat VCFStandard or degree of excellenceWithout variation or contradictionA pulling force applied to a part of the bodyMIS Procedure with balloon assistance to treat VCFConforming to a set of predefined rules, laws, regs...

Ramadaan and after 2026-02-12

22 Items: SunsetSuhoorEasternSunriseIntentionTaraaweehSteadfastnessnumber of gates for Paradisestart time for the suhoor mealwhat gets multiplied in Ramadaanbest thing to open your fast withdirection of the setting of the sungate of paradise for those who fastalternative night prayer to ramadaanone looks above this for the crescent...

Vocabulary for Test 2023-05-16

25 Items: an egg or sperma form of a genea fertilized eggrequires one parentpart of a chromosomethe inherited allelessperm and egg combinethe study of geneticsa difference in a traita family tree for a traitan inherited characteristica change to genetic materiala type of asexual reproductionthe process that makes body cellsstructure made of DNA and protein...

Griot Word Search 2025-11-17

25 Items: RulerStorytellersInbetweenersCapital cityMeans "people"Group of travelersSole control of tradeImportant trading cityRuled from 1307 to 1332Reported Muslim historyBoat with triangular sailCenter of trade and learningFounder of a line of emperorsFertile grassland, South of SahelDescendants from a common ancestorCulture of Bantu speaking migrants...

Moose Lodge 509 Nov 2023 Word-Search 2023-10-11

20 Items: Our Lodge MascotMan's best friendCurrent US PresidentCurrent Chapter Senior RegentFirst name of the LOOM ChaplainNumber of barstools we have in useEditor of Anderson Moose HighlightsLast name of our Lodge AdministratorThese Members deserve our many THANKSThe largest planet in our solar systemLast name of our 2022/23 LOOM President...

Read Word Search 2025-11-25

28 Items: 3rd person singular to buy3rd person singular to fly1st person singular to read1st person singular to live1st person singular to work1st person singular to swim1st person singular to cook1st person singular to walk3rd person singular to push3rd person singular to rain3rd person singular to snow1st person singular to study...

Unit 7 2026-07-23

8 Items: bags of...a piece ofbottles oftins of ...a bag of...a tin of...a bottle ofpieces of ...

Unit 2: Spelling Test 2 2022-09-27

25 Items: scenicembarrassedin a loud mannerin a curious mannerparticular; definitea two-wheeled vehicleto get rid of; removea large, ornate houseone who replaces anotherto consist of; be composed ofexcessive; unrestrained; imprudentto clarify the meaning of; to translatein a manner indicating great weightinessconsistently; with little or no variance...

Stress, Anxiety and Bullying 2023-05-15

25 Items: too muchbe afraid ofslightly angryfeeling of annoyancea feeling of physical tensionworry, unease, or nervousnessa feeling of emotional tensionelapsed time between two eventscausing or likely to cause harmextreme anxiety, sorrow, or painthe condition of being anonymous.responsible for flight, flee, freezemake or become less tense or anxious...

Chemistry, Physics, Energy Concepts 2023-05-30

21 Items: the universal solventsubstance being dissolvedhow fast an object is movingexerting a force over a distancethe ability to do work or cause changesubstance that is doing the dissolvinganother term for negative accelerationmeasure of amount of matter in an objecta type of energy where energy is in motionhow much work was done over a period of time...

semester review 2024-12-12

25 Items: direct currentshield metal arcalternate currentAmerican welding societypin holes or round voidsresult of trapped oxygendevice used to hold materialsprotective covering for handsstate of being free of dangerdirect current electrode negativedirect current electrode positiveAmerican society of mechanical engineers...

Pathophysiology Word Search 2025-09-07

20 Items: Something you can see or measureHow often a disease causes deathCause behind why a disease startsWhen a disease suddenly gets worseYou are born with it, doesn’t develop overtimeWhen symptoms get better or disappear for a whileShape,Structure, or Appearance of cells or tissuesDiscovery of what disease or condition someone has...

May 2025 Wordsearch 2025-05-02

20 Items: the ability of an organism to resist diseasetreatment intended to relieve or heal a disorderthe invasion of the body by harmful microorganismsthe process of returning to a normal state of healththe identification of the nature of an illness or problemthe action of stopping something from happening or arising...

BÚSQUEDA DE PALABRAS 2025-06-20

20 Items: SaularmyDavidGiantStoneFaithJesseSlingArmourIsraelBattleGoliathCourageVictoryChampionof HostsSlingshotof IsraelPhilistineUncircumcised

Work Word Search 2026-03-08

15 Items: energy of motionSI unit of powerSI unit of energythe ability to do workthe rate at which work is doneThe force applied to a machineA device that makes work easiera machine made of more than one simple machineImpeding effect exerted by one material object on another.the number of times a machine increases a force exerted on it...