fourth of july Word Searches

Module 16 Vocabulary 2026-04-08

15 Items: The capital of ChinaA thin, beautiful type of potteryA body of unelected government officialsThe capital of China during the Qin dynastyThe capital of China under the Song dynastyA mixture of powders used in guns and explosivesA policy of avoiding contact with other countriesA device that measures the strength of earthquakes...

Homestuck Characters (+SBaHJ) 2025-04-28

81 Items: JohnDaveRoseJadeJaneDirkRoxyJakeAradiaTavrosSolluxKarkatNepetaKanayaTereziVriskaEquiusGamzeeEridanFeferiLilCalGeromyDadBertCalliopeCalibornSweetBroThe MayorHellaJeffMomLalondeBroStriderSpadeSlickClubsDeuceErisolspriteHeartsBoxcarThe cue ballGrandpaHarleyDiamondsDroogParcel MistressAimlessRenegadeColonelSassacreTavros' ancestorEquius' ancestor...

July Word Search 2026-07-04

8 Items: HIKINGBOATINGCAMPINGBASEBALLCARNIVALVACATIONPATRIOTICINDEPENDENCE

Magnetism and Matter Topic Tree Key words 2025-08-24

25 Items: bar-magnetcuries-lawangle-of-dipdiamagnetismgausss-law-inparamagnetismmagnetic-fieldneutral-pointsferromagnetismelectromagnetsmagnetic-dipolepotential-energyearths-magnetismpermanent-magnetsaxis-of-a-bar-magnetearths-magnetic-axisangle-of-inclinationforce-on-a-bar-magnetuniform-magnetic-fieldtorque-on-a-bar-magnetsolenoid-as-bar-magnet...

RESISTOR COLOR CODE 2024-05-06

10 Items: The first two color bands are ______________ .The measurement of resistance is in __________ .The color that means ±5% is the color __________ .The fourth color band is the ___________________ band.The value of a 1000 Ohms is __________ than 10,000 Ohms.Resistance is the ______________________ to current flow....

HISTORICAL FIGURES (VERY COOL 🗣️🔥🔥🔥🔥) 2023-11-24

14 Items: French empireQueen of EgyptKing of FranceEmpress of RussiaQueen of ScotlandKaiser of PrussiaItalian noblewomenA Indian philosopherThe longest processdorEmperor of Maurya DynastyEmperor of the Mongolia empireThe greatest military commanderRole in the political and religiousKnown for creating the largest empires

Radiation Units of Measurement 2024-11-03

14 Items: Commonly usedRoentgen equivalent man“radiation absorbed dose”Internationally recognizedThe SI unit for radioactivityThe SI unit of electric chargeNamed after “Father of Radiation Protection”The release of ionizing radiation from a substanceThe quantity of energy that is absorbed by an object or person...

Inca and Maya Conflict Project 2022-09-20

15 Items: A female deity.Gods of the wild.We walk or dive on.Science of farming.An event of circumstance.A period of a hundred years.All visible future of an area.Person who designs a building.Largest continental mountain range.Widespread occurrence of a disease.The create and ruler of the universe.A condition of having too many people....

Integumentary system 2024-09-09

20 Items: skin turns bluefancy word for oilanother word for hairthe A in the ABCD ruleregulates body temperaturearrector pili muscle functionfunction of lamellular granulesproduces the pigment of our skinthe inability to produce melanina part of the integumentary systemthis degree is a full thickness burnlocated at the base of hair follicle...

Skin Word Search 2024-09-09

20 Items: bruiseproduces keratinred color to skinlack of blood supplyproduct of oil glandprogrammed cell deathfancy word for earwaxpale color to the skinanother word for cuticlethe largest organ of our bodyactive infection of oil glandsusually caused by liver diseasedetermines the color of our hairthis sweat gland offset is puberty...

CCES Wisers Extended 2023-02-22

15 Items: parademinifairfielddemoboardgamesartcontestthewitnesssportsgamesName of your schooltheme for this yeargroup _____ of Todaygroup ____ of TomorrowBarangay of your schoolgroup _____ of Yesterdaybeing celebrated right nowWhat you call the students who goes to your school

Word Work 2 2024-09-01

7 Items: The air surrounding earth.The bottom layer of the atmosphere where we live.It starts to get hotter and it is the second layer.The process of water on the ground entering the soil.Water vapor leaving the leaves an going to the plants.The third layer of the atmosphere and the coldest layer....

Famous art galleries 2026-05-14

18 Items: MuseumModernBilbaoCenterMuseumMuseumsMuseumsd'OrsayGalleryPompidoudel PradoRijksmuseumof Modern ArtGallery of ArtNational MuseumHermitage MuseumInstitute of ChicagoMetropolitan Museum of Art

Askiathegreat Word Search 2024-10-04

29 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthagegreat early church fathers and martyrs from Carthage...

Foundation Word Search 2022-09-15

25 Items: an opening made in the wallthe lowest part of the buildingtriangular upper part of a walllowermost part of a window framea structure which combined with lintelthe horizontal upper portion of a stepa guard rail to give grasp to the handan isolated vertical load bearing memberwhere two of roofs surface meet together...

Anatomy & Physiology: J / K / Q / U 2026-02-12

20 Items: The savory senseAnalysis of urine to diagnose diseaseIncrease in the number of hormone receptorsBone located on the medial side of the forearmGranulated protein found in the stratum granulosumGeneral sensory perception of movement of the bodyType of scar that has layers raised above the skin surface...

Mesopotamian myth 2022-12-14

15 Items: The god of the moon (Sumerian).The Sumerian goddess of fertility.She was goddess of love and war (Assyrian).The god of air, wind, and storms (Sumerian).The Sumerian goddess of fermenting, brewing, and ale.The Sumerian mother goddess of mountains and nurturing.The goddess of the sea; drawn as a huge dragon (Babylonian)....

Chapter 10-3/5 Vocab 2023-05-17

25 Items: anarchistto fight againstto support publiclya type of dried meatan enclosure for animalsto refuse to allow; to forbida sled pulled by a dog or horseshare of a corporation's profitreplacement for a striking workerto tell about something that happeneda share of ownership in a corporationa shortage, lack, or insufficient supply...

Culture Word Search 2023-11-07

23 Items: - Belief in one God- Belief in many gods- growth to a global or worldwide scale- gender roles that are less restrictive- A restriction on behavior imposed by social custom.- the physical things created by members of a society- Central to a society and it helps to compare societies- the visible imprint of human activity on the landscape...

Geometry Word Search 2025-05-28

30 Items: !opp/hypadj/hypopp/adjequal to/samename of this mathfour-sided polygonthree-sided polygonPrism with two circle basesWhen lines will never intersectArea of all the faces in a 3D shapethe likelihood of an event occurringWhen lines intersect at a 90 degree anglethe Greek letter used to represent an anglea unit of angular measurement (not degrees)...

Find the Words! July 28 2025-07-28

16 Items: websendtypespacecheckemailletterendingsearchonlinegoogleaddresscapitalcomputerpasswordchromebook

Beginning of Moses 2025-11-14

26 Items: SeaBushVeilRiverSinaiTorahAaronLeaderSaviorCanaanMiriamProphetPlaguesPharaohLawgiverMediatorof EgyptCovenantof StonePassoverDaughterDecalogueWildernessof the SeaIsraelitesCommandments

Norse Mythology 2026-02-27

23 Items: AsgardMidgardHelheimAlfheimVanaheimNiflheimJotunheimFire GiantMusphelheimCorpse EaterSvartalfheimThor's HammerRainbow BridgeGods of AsgardGods of VanaheimThe World SerpentOlder Son of ThorWatcher of AsgardYounger Son of ThorBlow to Signal RagnarokThing used to kill BaldrHis death started Ragnarok3 year precursor to Ragnarok

US Cities 2025-10-07

22 Items: Big DBeantownSin CityMusic CityWindy CityEmerald CityThe Big EasyLittle HavanaThe Big ApplePeachtree CityMile High CityCity of AngelsWestern Twin CityValley of the SunSite of the AlamoThe City BeautifulGateway to the WestThe City by the BayThe Nation's CapitalCity of Brotherly LoveBirthplace of CaliforniaCrossroads of the Pacific

Korach 2024-06-30

15 Items: “Korach”“joining”Hebrew for “to join”Hebrew word for staffthe father of MethuselahThe land of Milk and HoneySatan’s final destiny 3wordsKorach root means __ _____ _____.severe criticism or harsh scolding.“The prince of the power of the air”the biblical name for the place of the dead.Hebrew: to guard, protect, keep, watch, preserve...

Africa Geography Word Search by Katlego Pekenya ST10207233 Group 1 TISS7412 2025-11-06

29 Items: The ocean found to the south of Africa.A country that borders the sea or ocean.The ocean that lies to the west of Africa.The ocean that lies to the east of Africa.The edge of the land where it meets the sea.A nation with its own government and borders.A very large landmass made up of many countries.A small landmass completely surrounded by water....

Storey Word Search 2023-02-20

25 Items: the vertical surface of the staira room or a space directly unfder the roofthe lower square slab at the base of a columna continuous vertical brick or stone structurethe lower surface of a room on which one may walkthe provision of fresh air to a room, building, etc.a window that projects vertically from a sloping roof...

twist on vocabulary word search 2023-04-18

36 Items: The distance above sea levelthe transfer of heat by fluida tool that measures wind speeda device that measures temperaturethe flow of air from land to waterwinds that blow steadily over longThe lower layer of the thermosphereThe upper layer of the thermospherewinds that blow over short distancesThe middle layer of earths atmosphere...

Spanish Vocab 2 2022-10-06

33 Items: penmaybookjunejulytodaymarchaprilfolderpencilmondayfridaysundayAugusttuesdayjanuaryoctobernotebooktomorrowthursdaysaturdayfebruarynovemberdecemberclassroomwednesdayseptemberstudent deskstudent (male)sheet of paperteacher (male)student (female)teacher (female)

PE2 2024-09-18

37 Items: pendaymayBookyearweekjunejulymonthtodaymarchaprilfolderPencilmondayfridaysundayaugustStudentStudentTeacherTeachertuesdayJanuaryoctoberNotebooktomorrowthursdaySaturdayFebruarynovemberdecemberClassroomwednesdayseptemberStudent deskSheet of paper

Anatomy & Physiology: T 2026-02-18

53 Items: PlateletsShin boneMale gonadsAlso known as T4Also known as T3Primary lymphoid organExcessive clot formationAlso known as triglycerideA continuous fused contractionRelating to positional informationImmature T cell found in the thymusHormone secreted by the liver/kidneysHormones produced/secreted by the thymusStepwise increase in contraction tension...

Found Objects Word Search 2026-04-10

21 Items: ARTBEDBARSWOODEARTHSKULLSTONEARTISTHANDLETROUVESHELLSOBJECTSCUTTINGSOF GLASSAESTHETICMATERIALSPROPERTIESPHOTOGRAPHMADE OBJECTSOF SCRAP METALOF TEXTILE FABRICS

The Linguistics of Speech and Language 2026-03-04

14 Items: the smallest unit of soundthe vocabulary of a personthe social rules of speakingthe smallest, meaningful unit of languagethe patterns of rhythm and sound used in poetryhow words are built, with prefixes, roots, suffixesthinking about, analyzing, and reflecting on languagea variety of language associated with a specific social group...

constitution terminology 2023-01-22

20 Items: Having two branches or chambers.The first term amendments in the U.S. ConstitutionComposed of the Senate and the House of Representatives.A person who shapes or creates a concept, plan, or system.To control or supervise by means of rules and regulations.The funds or revenue of a government, corporation, or institution....

Askiathegreat Word Search 2024-10-04

28 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthagegreat early church fathers and martyrs from Carthage...

Unit 3 VST WordSearch 2025-11-24

25 Items: a suitcaseclearness of thought or styleflagrantly wicked or impious : evilGerman for realm, empire, or kingdomsprinkled or streaked with gray; grayingintensely emotional : impassioned, fervidto be about to occur; to hover threateninglyGerman for in a rapid manner; faster; quickera badge of authority; a distinguishing mark or sign...

April Word Search 2025-04-02

13 Items: Small groupArmigerous orderThe _______'s TrackNon-armigerious orderSean is the _________.Esme is the ____________.Barony of the ____________.Also known as the King and QueenSmall group of the Steppes - Denton_____ of the Oak - for baronial serviceFirst part of the name of the baronial A&S awardSecond part of the name of the baronial A&S award...

15 Buv 2026-03-12

43 Items: mebobslegohippopigonmiaminoddyslopsdrivelovestacosvaginewinklefourthbonzailisbonmatcharenaultcuddlestattoosnoddlesreigateshrekklesomebodycervezasfootjobscocklickspooningpaintingbarcelonafamilyguybraceletschristmasluxembourgnottinghambumbumtimepeakdistrictunitonethreebossmanpizzamatchingcupsstrangerthingsmissingflightswhatsappmoments

Neuschwanstein Word Search 2025-02-19

15 Items: Name of the best manThe proposal locationTheir favourite seasonName of the maid of honourcosmonauts Name of the bandLocation of their first tripGrooms favourite type of beerHow long do they live togetherWhat month did they get engagedWhat number is the couples houseThe stone in the engagement ringNumber of dresses the bride tried...

Anarchy Word Search 2025-11-14

15 Items: No rules or orderLegislative body of IsraelLegislative body of TurkeyDiscrimination against JewsLegislative body of Saudi ArabiaGovernment led by Religious leaderA mass genocide of Jews during WWIIForm of Government led by a King/QueenBranch of government that enforces lawscitizens vote only for Legislative body...

Morphemes We Know! Suffixes 2026-05-13

14 Items: WithoutState ofPast tenseable to, can doFull of or fullLike or manner ofCausing or makingMost (superlative)More than one or 3PSVaction, process, or materialsAct of, state of, or result ofInclined to or characterized byOf, pertaining to, or characterized byOne who, that which, more (comparative)

Ancient Greece 2025-11-04

13 Items: a cityGod of musicgo of the seaThe god of warthe leader of gods.Greek godness of wisdomthe birthdate of democracyGreek god of the Underworlda place where gods are prayed.the study of fundamental questionsa city where they held the Olymipicsthe greece army that everyone relied on.The city that invented black - figure pottery

GI/Hepatobiliary System 2023-12-21

23 Items: inflammation of the gallbladderMost common type of hiatal herniaSmooth muscle tumors of the esophagusA twisting of bowel about its mesenteric baseA serous membrane that lines the abdominal cavityA fluid collection that develops from the pancreasAn outpouching of the bowel wall caused by a weakening in its muscular layer...

Follow Along! 2024-03-16

20 Items: What clan is the author a member of?The name of this poem! (without "the)The author of the poem is ______ Keeshig.The word "plop" indicates which literary device?Over 52% of children in _____ _____ are IndigenousThe author is a member of the Chippewas of ______ Unceded First Nation....

Japan Word Search 2023-04-10

31 Items: sagefourfivejulyjapanblackaprilfantapastakoreannguyenfishingsamoyedchicagogeorgiawakandabusinesscheyenneajrafaelinfinitichocolateseptemberhalloweenchristmasstitchicalhellokittyvietnamesegrandrapidssanavongxaygrandvalleystmarymagdalen

Key Words Review 2025-12-11

31 Items: MayhotdaysweekyearJuneJulycoldmonthMarchAprilsunnywindySundayMondayFridayAugustcloudyTuesdayJanuaryOctoberweatherrainingsnowingThursdaySaturdayFebruaryNovemberDecemberWednesdaySeptember

SUMMERTIME! 2026-06-03

31 Items: hotbbqJuneJulygolfboatbeachsunnyrelaxhappysummershortspicnicaugusthikingparadesandalscookoutpartiesflowerscampingvacationlemonadeswimmingbaseballpopsiclefireworksgardeningfestivalsgraduationwatermelon

Freedom 2024-02-08

10 Items: the right to choosesynonym for freedomthe opposite of freeall freedom comes with (one word) _______every person should (one word) ______ the lawsecond fundamental freedom (one word) that involves faithfourth fundamental freedom (one word) that involves securityfirst fundamental freedom (one word) that involves expression...

Anchor Word Search 2023-02-20

25 Items: where people take coverthe top level of a buildingis the ceiling or ceiling of the houseWindow placed on the roof of the buildingis the best way to cover your house from sun lightit is the base where the windows of the building restthe side-post or lining of a doorway or other aperture.a non-load bearing walls that separate spaces in buildings...

Weather Word Search 2024-05-05

37 Items: Mass/VolumeAlso known as heat energy.The degree of heat in an objectThe lowest layer of the atmosphere.An instrument used to measure heat.Envelope of gases surrounding the planet.The outermost layer of Earth's atmosphere.A breeze blowing from the sea to the land.A coordinate the specifies north or south.The transfer of heat due to physical contact....

CMS Exam Break 2022-12-07

20 Items: restbluenavyrelaxrootswingswhiteeaglesrechargeteachersstudentsour mascotWho We AreOur Principalone of the 3 r's8th grade administrator7th grade administratoranother one of the 3 r'sand one more of the 3 r'sAssistant Principal of Instruction

Ancient Greece Gods And Goddess Word Search! 2025-11-11

10 Items: The god of warThe god of fireThe god of musicThe leader of the godsThe god of sea and oceansThe goddess of war and wisdomThe goddess of love and beautyThe goddess of fields and farmingThe goddess of hunting and animalsThe wife of the leader of the gods and is the goddess of marriage and family

Root Words Chrono 2026-03-27

19 Items: Chronologically misplaced.Arranged in the order of time.A fear of the passage of time.The scientific measurement of time.Existing or occurring at the same time.The state of occurring at the same time.Someone who records past events in order.How time and space are used in literature.Not occurring or existing at the same time....

Nitrogen Word Search 2023-04-18

36 Items: The distance above sea levelthe transfer of heat by fluida tool that measures wind speeda device that measures temperaturethe flow of air from land to waterwinds that blow steadily over longThe lower layer of the thermosphereThe upper layer of the thermospherewinds that blow over short distancesThe middle layer of earths atmosphere...

Matariki- The Maori New Year 2024-06-20

32 Items: newfoodjunejulytreeyearsevenstarsmaorisongslightmusicnightgamessongsfamilynaturepublicfridaywintersistersclusterfriendscultureholidayoutsidematarikipresentsaotearoahandmadeimportantcelebration

Kimya is TWELVE 2025-07-01

30 Items: YMCAGenZJulyHomeAuntLoveSmartNieceBeachKimayaFamilyTwelveNewtonCanadaCaringCabotsSelfieBigelowSephoraIceCreamBirthdaySwimmingEnergeticWaldenPondNewBedfordThoughtfulFriendshipGranddaughterLincoln-EliotMassachusetts

Word Search #1 2026-01-30

32 Items: LilaOrinKaiaLiamOpalEllaJulyDylanAveryAlizaFianaConorWillaRileyAydanAnuragTiannaVioletHarperSylviaVioletPaetynLheerinAriellaEleanorAbigailGraydonTristanEllenoreAlexanderConstanzaBrookston

IKT 2023-08-10

5 Items: mayjunejulymarchapril

JJ Test 2026-01-27

5 Items: CupJulyShoeEasterTickle

Laura & Monica 2025-04-24

14 Items: Dog's nameCat's NameLaura's hometownFavorite TV showMonica's hometownLaura's go to beerLaura's birth monthMonica's birth monthWhere the couple metFirst vacation togetherBoard game used to proposeThe month they got engagedCouple's favorite kind of foodCouple's dream vacation location

International Business Etiquette 2 2024-09-05

22 Items: Avoid ___________________ and high pressure talk.Do not ___________________ touch your Chinese colleagues.As of 2008, Germany was global leader in ___________________.Most business meetings are conducted over ___________________.___________________ is the most widely spoken language in Europe....

gary and amanda 2026-07-25

17 Items: Name of venueToday's dessertName of best manNumber of guestsMonth Gary proposedStreet they live onGroom's middle nameHoneymoon destinationFirst holiday togetherColour of bride's eyesMonth they got togetherCouple's favourite tripNumber of years togetherFather of the bride's nameCouple's favourite takeawayDestinations visited together...

Homophones 2024-05-07

42 Items: bytoatebuytooforweakweekfourhearherelosealoudbreakbrakeeludewhichwitcheightquietquiteplainplaneforthpeacepieceloosealludecoarsecourseensureinsurefourthallowedweatherwhethercapitalcapitolprincipalprinciplestationarystationery

Dillon Singleton Ch.16 Vocab 2025-04-16

14 Items: Horizontal row in the periodic table.Vertical column in the periodic table.Number of protons in an atom's nucleus.Particle in the nucleus with an electric charge of 1+.Particle of matter that makes up protons and neutrons.Atom of an element that has specific number of neutrons.Electrically neutral particle inside the nucleus of an atom....

Respiratory System 2024-10-18

26 Items: The exchange of gases between the blood and cells within the body.The process of gas exchange between the external environment and the blood.A principle that states the pressure of a gas is inversely related to its volume.The complete absence of oxygen in tissues leading to severe cellular damage or death....

CV aging cl 3 2024-11-16

18 Items: bad rhythmpredictabilityheartbeats per minutename for a muscle cellheart rate less than 50impulse causes contractionmajor complication of afibheart rate greater than 100pacermaker node of the heartresting state after contractionion responsible for contractionchest sensation of skipped beatsanother name for atrial contraction...

corporate identity 2026-01-14

11 Items: Reputation...............Management..........of Brands....of Corporate Brandsof Corporate Communication..... of Corporate Reputation........ Tools, and the MediaBranding–Reputation ...........Dimensions of Corporate .......Significance of Corporate................... Corporate Brand and Reputation

WORD SEARCH- Thanks Giving Time 2019-10-02

45 Items: daynewpiehamtimerockcrabcornbeanyamssaucegravysweetgreenrollscyberfourththanksgivingturkeyapplesmashedpotatobakingmondayindiansenglandharvestpumpkincandiedthursdaynovemberpilgrimspuritansplymouthdressingstuffingroastingmayflowercranberrytrimmingschestnutscasserolecornbreadcornucopia

Level 7 PT 21-24 2026-06-29

45 Items: joytoyoillawsirfurtoysboyssoilbluelawstalkverbwormenjoynoisevoicepointmovedthrewtrulystrawawfulturnshurryearthorderporchstormshortboardjoinedcausedthirtyforestcornerreportcoursefourthenjoyedbecausetalkingorangessquirrelsurprised

First Day of School 2026-07-28

45 Items: PELeeArtBeckMathSafeYoungLloydTanyaChaseHempyMusicEnyartTurnerCondryMurphyTurnerEachusLawsonCristiFourthSmitheyPohlmanEverettDonnellHensleyBurgessWillardScienceReadingWritingLibraryMcDonaldMustangsMaryanneComputerCoppingerNurseLoriTempletonMcConnellRichardsonRespectfulResponsibleOfficerRowleySocialStudies

Mathcounts Terms 3 2023-12-09

44 Items: Half of a circle.A positive integer.A polygon with four sides.Having the same shape and size.The sum of the digits of a number.A positive or negative whole number.A number without fractions or decimals.The average value of a random variable.The point where a line crosses the y-axis.A set of equations with the same variables....

A Love Story To Tell 2025-02-19

40 Items: JoyRemyLoveSoulHugsBlakeNickaI-HopPeaceDreamHeartLaughTruckMusicTrustKissesRKellyChicagoRockingRealBadNoodlesAwwwManForeverChickenJordansWorthItDeathRowFebruarySexyFaceTogetherMemoriesWeOutsideHappinessCornbreadLemonDropJustBecauseAnniversaryKeepSwimmingPrayedForYouTwenty-Fourth

Leading Tone 2026-01-24

43 Items: HalfFlatMajorMinorNotesPianoSharpVoiceTonicThirdFifthStarsTheoryScalesEighthChordsViolinStringFourthOctavePrizesAdagioPrestoSunriseHarmonyHistoryPlayingQuarterRecitalAndanteSunshineSunbeamsClappingDominantDynamicsModeratoMoonbeamsIntervalsSixteenthAugmentedArpeggiosDiminishedRitardando

Roisin Niamh Griffin wedding 2023-02-24

31 Items: cakedatesuitkisswinesingfoodringtacojulyphotomusicdrinkdancehappyenjoypizzapeopleflowerinvitefamilyfriendsistersausagebrotherbestmenchickensandwichtoptableseweddingbellweddingdresses

Birthday party mother 2023-03-21

31 Items: boywkdbeercakecokegirljunejulylovewinefantapepsimusicchrissweetmarchaprilpeopledrinksfamilysisterinviteauntiesummerballoonbrothersausagechickenjanuarybirthdayfavourite

Calendar Words 2024-10-22

28 Items: MaydaytwoJuneJulyweekMarchAprilmonthsevenAugusttwelveMondayFridaySundaytwelveJanuaryOctoberweekendTuesdayFebruaryNovemberDecemberThursdaySaturdaySeptemberWednesdayhundred sixty five

Months/Holidays/Days of the Week 2025-04-29

31 Items: MayJuneJulyMarchAprilSundayMondayFridayAugustEasterTuesdayJanuaryOctoberNewYearThursdaySaturdayFebruaryNovemberDecemberMemorialLabordayWednesdaySeptemberHalloweenTurkeydayChristmasSt.PatrickJuneteenthValentine'sIndependenceBacktoschool

Red Word Search 2026-05-14

32 Items: redonetwosixtenmaybluegrayfourfiveninejunejulyblackbrownwhitethreeseveneightmarchaprilyelloworangepurplevioletaugustjanuaryoctoberfebruarynovembernovemberseptember

Vocab List 2 2025-09-30

37 Items: pendayMaybookyearweekJuneJulymonthtodayMarchAprilfolderpencilMondayFridaySundayAuguststudentstudentteacherteacherTuesdayJanuaryOctobernotebooktomorrowThursdaySaturdayFebruaryNovemberDecemberclassroomWednesdaySeptembersheet of paper(student) desk

Cellmembrane Word Search 2023-01-06

18 Items: The head of a phospholipid that likes waterThe tail of a phospholipid that dislikes waterCell membrane made of proteins and the phospholipid bilayerDiffusion of water through a selectively permeable membraneProcess by which a cell releases large amounts of material; "exits"...

EASTER 2023-04-03

32 Items: funjulyjunepoolbeachbikesaugustmoviessplashcampimgfishingparadespartiespicnicssandalscarnivalcookoutsicecreamjumpropeswimmingvacationfirefliesfireworksflipflopshulahoopspopsiclessprinklersnowconessunscreenthemeparksunglassesrollercoaster

sjeioshreoishresiorhesfnkajkfnjkfnasjkdnajkda 2023-07-08

32 Items: funcakelovewifejulybridegroomdressdancetoastkatieitalytuxedochapelcheersfamilydrinksaustinweddingfriendshusbandvermontcollegememoriesmarriagemountainhoneymooncelebratesaintmikesburlingtonislelamottelakechamplain

Groom Word Search 2024-08-25

32 Items: BRADLUCYLISASEANJULYGROOMBRIDEAPRILOLVERNAOMIDAVIDSTEVEJESSEFIONASARAHLAURADEEWHYALISONANGELADARRENLISBONBERRIMATEACHERDARRELLTERENCEFEBRUARYBENDOOLEYGROOMSMENAUSTRALIARICHARDSONBRIDESMAIDOPTOMETRIST

Week 7 2026-04-09

32 Items: MaycornriceeggsJuneJulybreadpizzabeanssunnyrainysnowywindyMarchAprilapplescheesecloudyAugustbananasorangescarrotschickennoodlesJanuaryOctoberpotatoesbroccoliFebruaryNovemberDecemberSeptember

Fundations 2026-04-15

32 Items: youcuesoupnoonhoopcookbookhookcrewJulyyouthgroupsoupydroolshootshookvaluearguesmoothrescueenoughshampooroosterfoolishscooterspecialJanuarybloomingcontinueFebruaryDecemberunderstood

Sicily’s Halloween Word Search 2022-10-05

15 Items: Sweet foodWolf monsterMagical womanCar of a witchApposite of dayOrange vegetableDemonic creatureBones of a personMonth of HalloweenBlack bug with 8 legsSoul of a dead personBlood drinking monsterOutfits worn on HalloweenMakes werewolves come aliveResting place of a dead person

Science 2024-05-06

38 Items: and diffusedpressure exerted by aira measure of the amount of storagedevice for measuring atmospheric pressurethe quality of being hot; high temperature.the outermost region of a planet's atmosphere.winds that occur in belts that go all around the planetvapor water in a vaporous form especially when below boiling...

Socialisation, culture and identity 2024-05-21

17 Items: going against the normsmeaning variety or differenceexpected patterns of behaviourthings enjoyed by the majoritya merging of two or more thingssmaller group within a larger groupsocial control from family or peersideas that society sees as importantprocess of learning norms and valuessocial control from the police or laws...

Birthday Boy 2023-02-13

25 Items: benuvahubryanjakejulygolfjuliaemilydennyHeelssauceStreetfamilycuisinesouthernfootballCarolinabusinesscolthurstrestaurantfraternitybasketballhospitalitytwenty-third

Moreno Likes 2025-07-10

28 Items: MayLawJackAriaJulyJuneMiguelCarmenDanielMorenoGarciaPotterMexicoClaudiaAbrahamNazaretJoaquinNovemberHogwartsPropertyStephanieSeptemberHalloweenChristmasQuidditchLuis PotosiCalisthenicsEntrepreneur

Globes, Projections, GPS 2024-03-22

19 Items: a person who makes mapsthe intended use of a projectionsize, shape, distance, distortionMap map of earth taken from spacemost accurate representation of the earthMap shows three-dimensional aspects of the planetMap shows the elevations, related to a relief mapMap shows land and water features shaped by nature...

Congress Word Search 2025-10-06

19 Items: meaning two chambersOne of your US Senatorsthe lawmaking branch of governmentthe vote taken to end a filibusterthe number of members in the Senatethe process of redrawing district linesthe type of representation in the Housethe type of representation in the SenateYour US House Representative for District 5...

Vayera 2024-11-10

18 Items: יִצְחָקהִנֵּנִיYeshua’s mother.Rebekkah’s father“And he appeared”“The Feast of Trumpets”The Holy One’s appointed time.His name means, “father of a king”This place means “place of sojourners”Eastern border of Egypt, name means “wall”The place Abraham took Isaac for sacrificeThis place means “well of the sevenfold oath”...

Baba Word Search 2026-02-06

10 Items: a fat catbaby ____ ?our mama babyour baby pangitour favorite siomaiwhat you smell like!what we call each otherour favorite snow placeour LA daniel caesar songthe month of you asked me to be your gf

World Word Search 2025-06-27

19 Items: GodPoollifelovedSavedof GodHeavenchosenhealedFamilySpiritChangerMatthewforgivenKids Campto win itmasterpieceof the weekof the world

Saints 2025-10-26

12 Items: MaryLucyof ArcPatrickDe PaulNicholasAnthonhyof assisiValentineElizabethof LisieuxChristopher

Unit 5 Word Search 2023-03-08

10 Items: XVILOCKEOF RIGHTSOF POWERSBONAPARTECOURT OATHROBESPIERREphilosopherOF BASTILLEOF THE RIGHTS OF MAN

Chapter 6 Chemistry Review 2023-01-10

10 Items: 6.022·10^23The mass in grams of 1 mol of the substance.A small unit of mass equal to 1.66·10^-24 grams.Which has more mass, 1 mol of silver or 1 mol of lead?The number equal to the number of carbon atoms in 12.01g of carbon.The weighted average of the masses of all the isotopes of an element....

ALL first grade heart words 2026-05-12

87 Items: oftodohebemenoweorbymytheyouseearewasforwhoonetwoanywonsoneyewhathavesaidlookfromyourwantgoessaystheyweretalkwalktheyoncedoesmanybeenintomovebothfourverypoordoorhourtheircouldwouldtherewheretherewomanwomenfortyotherwatertodayaboveamongagainfloormonthheartaboutshouldfriendfourthpeopleprettymotherfatheralwaysalmostminuteMondayanswernothinganother...

chapter 2 basic chemistry vocab 2023-09-25

14 Items: the outermost shell of any atomAnything that takes up space and has massnumber of protons within the nucleus of an atomScientific study of the properties and behavior of matterA substance that can't be broken down by non-nuclear reactionsthe mass of an atom of a chemical element expressed in atomic mass units...