fourth of july Word Searches

Nail Diseases and Disorders 2024-11-14

20 Items: nailspoon nailswhite spotsbitten nailstrumpet nailfolded nailsingrown nailsfungal infectionram's horn or clawtiny pits roughnessdeformity or diseasethickening of the naildarkening or black bandlifting of the nail plateskin becomes split or tornsplit brittle nails with ridgesthin white nail plate very flexible...

africa 2025-11-18

24 Items: rulerboatsgo betweenssole controltrading citylargest citymeans "people"sickled princeoral historiansmetallic elementsemidesert regionabundant resourcefertile grasslandsprecious commoditylongest known journeypeople conquered malilocation of the capitalbantu speaking migrantsenslaved Turkish soldierscenter of trade and learning...

Word search 2023-09-28

40 Items: warmauntwifejulyfoursunnyhumidrainyfoggywindyunclenieceaprileightthreenephewfathermondayautumnspringaugusttwelveeleventwentyfamilybrotherhusbandtuesdayjanuaryoctoberfifteenfreezingthursdaysaturdayfebruarydecemberthirteenfourteenwednesdayseptember

Sarah and Tyson 2024-05-03

43 Items: lovejunevowssuitloveringjulysarahtysonpiperbridegroomdressdanceyoubouremmenfamilykitimatweddingbouquetstevensflowerstequilakitimatromancefriendsforevermarriagetogethermarriagesteenbucknashvillegreatdanehoneymoonhappinessengagementcumberlandcelebrationkendalavenueclingmansdomelaketownranchcampbellriverhighschoolsweethearts

Rosalind's Word Search 2025-01-16

38 Items: NoTeaDogBeefJulyBlackBibleHawaiiGreensWinterDooneyMorningChickenReadingSaturdayFootballBenihanaRed.DoorCallalilyChristmasChocolateMargaritaTelevisionMade-A-WayWatermelonPerry.MasonBig.TroubleThe.JetsonsLife-SaversSweet.PotatoMary.J.BligeDecaf.CoffeeCicely.TysonEddie.MurphyBlack.PantherSugar.CookiesKirk.FranklinDenzel.Washington

Nervous System 2025-05-15

40 Items: ViaDietJulyBrainOrganItalyFocalPaviaNervesSportsSeizureMachineBalanceJanuaryEpilepsyMessagesMedicineDiscoveryNerveCellsBodySystemSpinalCordEnviromentElectricalTreatmentsNobelPrizeHomeostasisInformationPathologistInvoluntaryGeneralizedCamilloGolgiNerveNetworkBrainSurgeryCoordinationNeuroscienceWorktogetherNervousSystemCommunicationSilverNitrate...

Zero Word Search 2025-09-22

40 Items: sixmaypensayzerofivejulypinkblueopenworkthreesevenfortyfiftyblackwhitebrownrulerwriteclosecheckthirtyaugustsummerwinterspringautumnyellowmarkerpencileraserlistenfifteenhundreddecemberseptembersharpenercalculatorhighlighter

Key Words Review 2025-12-09

40 Items: dayMaydadmomhotweekyearJuneJulycoldhellomonthMarchAprilsunnywindySundayMondayFridayAugustfamilysistercloudygoodbyeTuesdayJanuaryOctoberbrotherweatherrainingsnowingThursdaySaturdayFebruaryNovemberDecemberWednesdaySeptembergrandfathergrandmother

Sugars 2025-09-02

16 Items: linkages found in glycogenthe unbranched type of starchcommon to all N-linked glycosidespolymeric form of glucose in plantsthe major structural polysaccharide in plantsisomers that are not mirror images of each otheramino acid responsible for N-glycoside formationclassification of any sugar that can be oxidized...

Advance Functions 2024-07-22

13 Items: To change the base, we used the:Statements that compare two expressionThe smallest repeating unit of the functionWhich is attached to the highest degree of “x”line that a curve approaches, as it heads toward infinityA set or group of functions that share common characteristicsA relation in which each x-value in the domain has a unique y-value...

Stage 20 Culture Review 2023-05-11

23 Items: nikenikenikepseudo-sciencefather of medicinecenter of learninggreat griffin golfergreat griffin runnermade first water-clockAlexandrian astronomermade first steam turbinewrote a geometry textbookmeasured the circumferencefamous 20th century doctorfamous 20th century authorRoman contribution to healthtitle of first geometry textbook...

commerce find a word 2024-10-17

16 Items: items of valuebest teacher in the worldvery safe and secure sharesa tax on the profit of a companya part ownership of a public companyvalue of an asset increases over timeacceptable to society’s current standardsall the investments owned by an individualplace where shares in public companies are bought and sold...

Chapter 15 Vocab Word Search 2024-03-21

11 Items: A solution of known concentrationA compound whose color is sensitive to pH.The point at which an indicator changes color.The pH range over which an indicator changes color.The negative of the common logarithm of the hydronium ion concentration.The negative of the common logarithm of the hydroxide ion concentration....

Women of UPS (March, 2023) 2023-02-24

13 Items: EVP & Chief Corporate Affairs and Sustainability OfficerFirst woman package car driver, beginning in 1943, Los AngelesBoard of Director - President and CEO of Lumen Technologies, Inc.UPS’s first woman pilot, joining the newly founded airline in 1988Board of Director - Group President, Pfizer Biopharmaceuticals Group...

8th grade Mother to Son (poem) 2026-01-22

9 Items: brokenspeaker of the poemlast name of the poetfirst name of the poetin the place of somethingsmall, thin, sharp piece of woodwide, flat place between sections of stairsqualities like glass that is clear & elegantset of steps used to get from 1 floor to another

Spelling Test 3 2022-09-23

28 Items: against slaveryhostile; unkindunfit to be eatenthe act of going awayto repeat or say againone who is not a memberbefore recorded historythat which is not nuclearoccurring twice in a yearto stop or prevent an actionapart from one's choice or willto go do, come down, fall, or sinkof the highest degree or importanceextending across the Atlantic Ocean...

Skin care 2024-10-30

30 Items: boilWartpimplespink eyeswellingbirth markbeauty markchicken poxlack of pigmentpersistent itchingmedical practitionerpore clogging ingredientsover production of pigmentdarkened shade of the skinfoul-smelling perspirationabnormal growth of the skina permanent mark on the bodyredness caused by inflammationa small sac or blister filled with liquid...

Qualitative Word Search 2026-01-07

20 Items: Mass per unit volumeAmount of matter in an objectType of data that involves sensesA proposed explanation for an observationThe sub-atomic particle that has +1 chargeThe substance in which the solute dissolvesUsed to separate coloured substances in inkType of data that involves measurements being taken...

Floral Design Vocab Review 2024-11-04

62 Items: Red, Blue and YellowTotal area a person can seeThe outline of an arrangementLight reflected off an objectJapanese style of floral designVisual or tactile feel of an itemAppealing odor emitted by flowersCenter of interest that draws the eyeThree colors side by side on the wheelType of shears used to cut woody stems...

Middle East Geography Challenge Word Search 2024-12-09

15 Items: The capital city of IraqThe largest river in EgyptThe largest country in ArabiaA large mountain range in western ArabiaThe sea that separates Egypt from Arabia80% of Arabia is part of this environmentA country that borders Saudi Arabia and OmanThis country is east of Iraq and north of OmanThe country where you can find the Great Pyramids...

WHI.1 Vocabulary Practice 2025-05-25

15 Items: more than necessary ___________________skilled craftspeople __________________way of life of a society ____________________also known as the New Stone Age ____________________also known as the Old Stone Age _________________________way of life characterized by little movement _________________...

Inkspiration 2022-06-23

25 Items: catdogSIGNbookgamedreamhobbymottomoviecareercoupleANIMALfriendcopycathometowninterestmarriagememoriesmilitaryrelativechildhoodsuccessesOF A CHILDmilestonesOF A LOVED ONE

Molecule Word Search 2023-01-10

13 Items: general makeuphow something is arrangedthe sum of all living matter on Earthis made up of many different kinds of atoms and moleculessubstances that cannot be separated into simpler substancessubstances formed when two or more elements are chemically joinedthe layer of gas surrounding a planet that is held in place by gravity...

Unit 2 Vocab Review 2024-10-29

13 Items: The study of God and religious beliefs.A Greek word meaning "assembly" or "church."A system of beliefs and practices about the divine.A personal connection to the divine or higher purpose.Someone who follows Jesus and adheres to his teachings.A Hebrew word for the assembly or congregation of Israel....

Saved by the Lab 2023 QuidelOrtho 2023-03-09

20 Items: Na,K,Cl,CO2BUN,CREAT,GFR testingIAT, IS, or EXM are optionsQuidelOrtho Chemistry PlatformWinner of the 2015 Edison AwardWaterless chemistry methodologyWhen will the test be resulted?Brought PCR testing to many labsbody system that regulates hormonesDeveloped in the 80's by Dr LaPierreLessens incubation time in AHG testing...

Quantum Word Search 2025-01-28

21 Items: A colorful manSnakes can see itAlpha, Beta, this.One packet of lightWhich way light goesPrefix meaning one billionthThe study of colors of lightA specific amount of somethingAs light, or a range of thingsThe distance from peak to peakThe father of quantum mechanicsEM waves good for communicationBlack lights are in this EM range...

Heather's Mortgage Word Search 2022-10-27

20 Items: Fannie MaeFreddie MacWhat is a 1003To buy real propertyThe number of days the lock is effectiveproperty secured to the repayment of the loanThe numeric value issued by the credit bureauFee paid to an appraiser for preparing an reportThe annual cost or fee associated with a serviceThe first individual listed on a loan application...

Rock Word Search 2024-11-14

23 Items: - A use or marble.Mountains - Where Granite is found.- What is a common sedimentary rock?- What type of rock is coal classified as?- What type of rock forms from cooled magma?- What are limestone and sandstone used for?- What is an example of an intrusive igneous rock?- What is an example of an extrusive igneous rock?...

final 2024-12-18

20 Items: a band of nerve fibersthe process of chewinga curvature of the spineinflammation of the sinuslongest and strongest boneinflammation of the appendixthe liquid component of bloodsecond largest part of the brainan illness that affects the lungscells that prevent the body's loss of bloodthe number of times your heart beats per minute...

Lesson 1,2,3,4,5,6 2024-07-19

54 Items: dayartecoclubtripshowcoldnoserestgamefeeddogstripthisgradefirstthirdfifthhanokearthfieldonionpantssocksfeverrunnywaterplantdancemusicmoviethesesecondfourthminhwasportstalentpotatodoctorsoccerssireumyunnoriconcertflowersmariachiflamencobirthdayheadachemedicinepineappletaekwondowatermelontraditionalstomachache

MITOSIS WORD SEARCH 2025-04-29

17 Items: the stage before mitosisthese pull chromatids apartnew nuclei form around chromosomeschromosomes line up at the equatorcytoplasm divides into two new cellsorganelle which has cell chromosomescell containing one set of chromosomeschromosomes are pulled to opposite polesa cell containing two sets of chromosomes...

Chapter 8 Hair and Scalp Disorders & Diseases 2024-12-09

27 Items: split endstechnical term for beaded hairtechnical term for brittle hairtotal loss of all terminal scalp hairloss of terminal hair on the body and scalpinflammation or infection of the hair folliclesinfestation of the hair and scalp with head licepartial or complete hair loss from where it typically grows...

World Religions Word Search 2023-02-06

15 Items: God in IslamA Jewish FaithJewish LanguageJewish Holy BookA God or GoddessMuslim Holy BookMuslim set of rulesThe Worlds Oldest ReligionFounder of the Jewish FaithA leader of the Jewish faithA religion with only ONE GodA religion with multiple GodsA religion followed by MuslimsFounder of the Christian FaithThe set of rules for Christians

Medical Terminology Scavenger Hunt/Word Search 2025-01-09

15 Items: meaning fastsuffix for thirstdefinition of cytesuffix meaning recorddefinition of nephr/osuffix meaning openingdefinition of the term glyccombining form meaning brain-ic, -ior, and -eal all meanhemi is an example of a _____combining form meaning cancercombining form meaning voiceboxprefix meaning few, very little...

with VON 2025-02-05

15 Items: SurnameDating appFarming gameFirst date cafeDiscord channelName of boy catAnniversary dateName of girl catAnniversary monthFrequented KL plazaCondo we moved intoName of largest plantDream country to travelMultiplayer cooking gameCountry of overseas trip (not sg)

The Basal Ganglia & The Cerebellum 2025-11-22

20 Items: Unclear, slurred, poorly articulated speechLack of coordination during voluntary movement of the limbsA lack of motor coordination that impacts one's ability to walkInability to rapidly alternate movements due to cerebellar damageAn involuntary movement causing the eyes to rapidly move back and forth...

French Revolution 2025-12-08

20 Items: XVIRégimed'etatClergyEstatesAssemblyBastilleMonarchyJacobinsof TerrorGirondinsCourt OathAntoinetteGuillotineConventionBourgeoisieRobespierreNationalismSans-culottesof Public Safety

Age of Revolutions word search 2023-10-12

10 Items: fearestateestateestategeneralof terrorof rightsguillotineof bastilleconstitution

cxcb 2023-12-26

8 Items: Mangandhiof Fireamadeusplatoonof AfricaLast Emperorof Endearment

PhT 100 Word Search 1 (Spring 2024) 2024-05-09

17 Items: To grind to a smooth substance with moisture.The basic unit of weight in the apothecary system.The dating of any medication that has a short shelf life.The liquid in which another substance is being dissolved.The determination of the covererage an insured is entitled.Complete destruction of organisms after they leave the body....

Cellcycle Word Search 2026-01-07

12 Items: A part of the cell cycle when replicated chromosomes are separated into two new nuclei.The part of the cell division process during which the cytoplasm of a single eukaryotic cell divides into two daughter cells....

The armor of god 2024-11-07

6 Items: of Truthof Faithof Salvationof the Spiritof Righteousnessof the Gospel of Peace

MYTHS AND LEGENDS 2024-09-19

15 Items: Giant wolf from Norse mythology.Greek goddess of wisdom and war.Greek monster with snakes for hair.Giant sea monster from Norse legend.Norse trickster god, brother of Thor.Egyptian falcon-headed god of the sky.Legendary bird that rises from its ashes.Greek god of thunder and king of the gods.Half-man, half-bull, trapped in a labyrinth....

Pinchas 2024-07-20

18 Items: Moses successorThe seventh day.Phinehas’ father.Daughter of Asher.Jeremiah’s hometown.Zimri was from this tribeSimon was know as a _______.Phinehas’ reward for his zeal.The 14th day of the first month.his Hebrew name means “3 Israelites”The new moon or the first of the month.Cozbi was the daughter of this Midianite prince....

Lech Lecha 5.0 2024-11-09

18 Items: מִצְרַיִם“messenger”King of ElamKing of Salem“KHohSHehK” חֹשֶׁךHer name means “flight”“father of a multitude”Hunger, scarcity of grain“noblewoman” or “princess”Son of Haran, Avram’s nephew.His name means “G-d will hear”His name means, “exalted father”Avram’s age when Ishmael was bornAvram ask her to masquerade as his sister....

Meanings from glossary 2024-11-11

14 Items: Natural elevationsan area of countrysideIs a huge body of salt water.Is the difference of height from place to place.Is an area of the earth's crust that is below sea levelsis the activity or business of growing crops and raising livestock.is the science or practice of planting, managing, and caring for forests....

5 & 6 Vocab Review 2022-09-27

40 Items: hasherhimhismaynotshewhyyoudoesfallgoeshavejulyjuneusesyouraprilcookslikeslovesmakesmarchplaysreadsaugustautumnspringsummerwinterbecausejanuaryoctoberstudieswatchesdecemberfebruarynovemberpracticesseptember

Birthday party 2023-03-21

41 Items: boywkdbeercakecokegirljunejulylovewinemarscomemilkfantapepsimusicchrissweetmarchaprilwarpsfantapeopledrinksfamilysisterauntiesummerballoonbrothersausagechickenjanuaryweekendbowlingbirthdayinvolvedsandwichswimmingfavouriteenjoyning

everything 2023-10-06

40 Items: dadmomzoemaycoolmarcjunejulydadslouiebradycornymarioluigipeachaprildrinkmaggiegeorgecringysundaymondayfridayaugustmatthewmichaeltuesdayjanuaryoctoberjohnpaulsaturdaythursdayfebruarynovemberdecemberfavoritekatherinewednesdayseptemberoldfasion

SUMMER 2024-10-25

40 Items: SKYHATHOTANTSBEESGOLFJULYJUNERAYSBEACHFLIESGRASSSWEATWASPSAUGUSTBREEZEHIKINGPICNICSOCCERSUNTANBICYCLEBOATINGCAMPINGFISHINGFLOWERSSANDALSSUNBURNBARBECUEBASEBALLHOLIDAYSSOLSTICESUNSHINESWIMMINGGARDENINGSUNSCREENMOSQUITOESSKATEBOARDSPRINKLERSSUNGLASSESWATERMELON

Los Meses Del Año 2025-02-23

20 Items: MayJuneJulyyearMarchAprilmonthyearsAugustmonthsdecadeJanuaryOctobercenturyholidayFebruaryNovemberDecembercalendarSeptember

Nanci Word Search 2025-03-21

40 Items: elfluispinkbluejulycowsbabeultananciramosduranblackwhitebrowncandyfloresinnoutbailesmakeupcoffeesummertargetpadillaflowersfishingdancingonesizevanillajaripeoanimalseyelashwalmarticecreamlemonadevacationdutchbrosextensionsgoldeneaglestrawberriessoldejaniero

Summer Word Search 2025-05-21

40 Items: sunfunjunejulypoolsandparkballbeachwatertowelbikesrelaxsummertravelshellsaugustpicnicfamilyhotdogsburgerssandelsfriendsfishingcookoutoutsideswimmingicecreamvacationsleepingnoschoolbarbequeroadtripumbrellaswimsuitbonefirewaterparksprinklersunscreensunglasses

Oak Island Depositor Theories 2024-12-01

25 Items: GrailTheoryTEMPLARVIKINGSCatharsBaronetof MaltaAntoinetteLOST PAPERSSHip TheoryMash THeoryGold TheoryKIDD treasureFrancis DrakeCipher TheoryDEMATERIALIZERHerring THeoryChamber THeoryHalpern TheoryOF THE COVENANTMAP/ FREemasonsTunnels/Box drainsKabbala/Gematria/Tree OF LifeColumbus-Ark of the Covenant THeoryof 7 people must die to find the treasure

TH10 U1 2025-06-23

24 Items: areapathaheada goalbehindthe viewthe pondthe trailup a tentand quieton a rootmade poolof breathof energythe treesin a cabina campfirethe silencein the shadeof the hikera water bottlenatural bridgeinstant noodlestop of the world

Inherent Powers - Word Search Activity 2024-01-28

11 Items: The Supreme Law of the Landthe Contract that Ended World War OneMs. Mangum’s Favorite Color (x2 points)Purchase made by President Thomas JeffersonA Form of Government that the United States HasDocument Written by Abraham Lincoln to Free the SlavesConsists of the House of Representatives and the Senate...

Retrieval 2025-01-06

11 Items: The brittle bone disease OThe body's primary source of energy CThe bodies secondary source of energy FHow many components of health there are TThe type of health that relates to friends SThe type of health that is effected by obesity PWhen a person has a large body fat percentage OThe name of the hormone released during exercise S...

science review wordsearch 2023-06-01

22 Items: Unit for workThe transfer of heat in the form of wavesHighly reactive nonmetal elements in group 17Solution that has more solute than the solventHow tightly packed the atoms are in a substanceDescribes both the speed and direction of an objectReactions that release thermal energy when they react...

Cell Energy Word Search 2025-02-21

18 Items: Requires oxygenDoes not require oxygenForm of energy for a cellLocation of the Calvin CycleFermentation common in plant cellsFermentation common in animal cellsOxygen is a by-product of this processLocation of the light-dependent reactionVital for animal life, produced by plantsOccurs in the cytoplasm to start respiration...

School's Out for Summer 2019-05-01

40 Items: funmaypoolheatlakejunejulyplayswimwaterbeachgrassfruitsummerhikingaugustdivingsoccerfriendsfreedomcampingfishingcyclingfrisbeesandalsnoschoolkayakingsunshinesunburnsbonfirescanoeingoutdoorsicecreamvacationsunscreenwaterparksandcastlebackpackingbathingsuitairconditioner

Nagashree & Brian's Engagement Party 2024-08-27

40 Items: LEOAMCJULYAMORLOVEKINGPARISBRIDEGROOMNORMSQUEENPYAARDOSTILONDONLAKERSENGAGEDFOREVERBESTIESFERRELSPIZOOKIESENORITADECEMBERPROPOSALMARQUISESOULMATESANTACRUZTWENTYONECAPRICORNSTEVENSONBOLLYWOODCELEBRATECULVERCITYHOUSEEIGHTBANANASLUGUPSIDEDOWNFRIENDSHIPEIFFELTOWERSANFRANCISCOPERFECTMATCHBETTERTOGETHER

Summer Word Search 2025-07-31

40 Items: BBQSKIJULYHEATLAKESWIMPOOLBEACHCRABSKAYAKOCEANFRUITROCKSTOWELHUMIDSUMMERSHELLSAUGUSTBIKINIGARDENHIKINGCOOLERFAMILYFISHINGCAMPINGHOLIDAYEXPLOREFRIENDSBASEBALLVACATIONSUNSHINESWIMSUITUMBRELLAHEATWAVELEMONADESUNFLOWERMOUNTAINSSANDCASTLESUNGLASSESWATERMELON

Year 5 light 2025-04-10

30 Items: SunRayBeamDawnTorchLaserMirrorObjectObservePhotonsDiffuseTwinkleRainbowEinsteinLightbulbBlackholeRadiationIntensityLess lightScatteringLuminescentThe best subjectDark area or shapeTo take in or swallow upNot letting light throughChange of direction of lightPermitting the passage of lightThrowing back by a body of light...

Musicals 2025-01-16

15 Items: QManLineCatsRentGirlsAnnieWickedGreaseCabaretChicagoof MormonHairspraySide Storyof the Opera

Further Equilibrium 2024-12-12

14 Items: Reaction quotientReactants form productsEquilibrium constant (pressure)Products go back to form reactantsEquilibrium constant (concentration)No. of moles of A/total no. of moles of gasAll reactants and products in the same phaseForward and backward reaction rates are equalAt least one reactant/product in different phase...

Topic 9 Lesson 3 Jackson Whitley 2025-04-02

10 Items: What is the job of a bishop?What is the job of the priest?What is the bishop of Rome called?Who made one of the gospels(starts with an m)?What did the early christian leaders establish?A person that is willing to die for their belief.What group in Africa was one of the first Christian kingdoms?...

Ides Word Search 2024-03-04

12 Items: luckbeefwindygreenspringrainbowof goldcabbageof MarchshamrockleprechaunPatrick’s Day

Mixed Religious words 2025-11-07

12 Items: Ceiling of Paradise7 of them are above usThe life after this lifeMiracle from Jerusalem to aboveEvery creation was made from itBest act of worship after beliefRising of the dead from the gravesEach believer should fear entering itA man of significant religious knowledgeYou need this to get reward for your deeds...

Unit 6 vocab 2025-11-07

15 Items: tenthrightsrecall6 vocablibertiesnineteenthinitiativereferendumseventeenthtwentythirdtwentysixthof servicestwentyfourthof the state Governmentof the local government

January Word Search 2025-12-22

14 Items: Windsor Castle is near this river.This duke of Suffolk is buried at WindsorAuthor of "Five hundred points of good husbandry".St George's Chapel is the spiritual home of this order.New Year gifts at court were recorded in the New Year Gift .....This wife of Henry VIII rests in the same vault as her husband at Windsor....

Words, words, words. 2025-11-17

17 Items: The King's wifeprince of NorwayPoured in the earsbrother to Opheliawhat the Ghost desiresa brother and murdereranother word for ecstasystabbed behind a tapestrydaughter of the King's advisorthe main setting of the tragedythe capital crime of this tragedyspeaks the first line of the playthe only person the Ghost spoke to...

Middle East Geography Challenge Word Search 2024-12-07

15 Items: The capital city of IraqThe largest river in EgyptThe largest country in ArabiaA large mountain range in western ArabiaThe sea that separates Egypt from Arabia80% of Arabia is part of this environmentA country that borders Saudi Arabia and OmanThis country is east of Iraq and north of OmanThe country where you can find the Great Pyramids...

Federalist Party in 1800: The Word Search 2024-12-16

14 Items: A member of a labor union.An adherent or advocate of libertarianism.Of,relating to, or favoring a philosophy of conservatism.The development of industries in a country or region on a wide scale.Of adherence to or government according to constitutional principles.The concentration of control of an activity or organization under a single authority....

Constitution and First Five Presidents 2025-04-10

11 Items: 1st President of the U.S.2nd President of the U.S.3rd President of the U.S.4th President of the U.S.5th President of the U.S.Novel by Harriet Beecher StoweThe government's powers are restrictedThe turning point of the American revolutionPolitical group that wanted a new constitutionis a 3-letter abbreviation of our first constitution...

Reception 2023-10-22

23 Items: First dateAustin's jobKaitlyn's jobWho is older?years togetherour cat's nameTown of first homeAustin's first namecouple's dog's nameAustin's birth monthname of the best manKaitlyn's middle nameKaitlyn's birth monthKaitlyn's maiden namewhere did he propose?Austin's favorite sportour nontraditional petsnumber of months engagednumber of total siblings...

Sleep 2023-06-10

14 Items: moodmemoryanxietylearningsnackingcaffeineconsistentrelationshipsEmit blue light that affect sleepLack of sleep can lead to ___ gainDaytime rest that can affect nighttime sleepTeens should get ___ to ten hours of sleep a nightIncreased risk of ___ and injuries (drowsy driving)Weakened ___ system increases chance of getting sick

Citizen Word Search 2024-12-04

13 Items: Classicalrepu…a member of a political communitya religion supported by the state through tax moneythe care, guardianship, and control exercised by a deitythe principles of virtue as expressed in Judeo-Christian teachingsthe status of a citizen with its attendant duties, rights, and privileges...

Discern Word Search 2023-12-20

10 Items: parishbishopdiscernmandateof Faithcelibacyseminarydalmaticof bishopsinfallibility

Tourist Spots 2025-08-31

40 Items: BenMauiBaliTowerTowerPetraMahalPalaceSophiaPicchuPhuketKhalifaFamíliaof GizaAlhambraBoraBoraMaldivesColosseumAngkorWatMountFujiHaLongBayPatagoniaSantoriniof LibertyStonehengeSeychellesJejuIslandChichenItzaGrandCanyonAmalfiCoastthe RedeemerNiagaraFallsMountEverestWall of ChinaVictoriaFallsNorthernLightsGreatBarrierReefAcropolisofAthens...

Civics Wordsearch 2025-11-13

50 Items: LawVoteDutyBillPartyMayorCivilLegalRightsBallotPolicyActiveRightsCensusof LawCitizenJusticeServiceSenatorProtestProtestAnalyseRepublicSuffrageElectionLobbyingActivismInformedMinisterMajorityMinorityDemocracyExecutiveJudiciaryAmendmentof Powersof SpeechGovernmentParliamentReferendumFederalismGovernmentLegislatureBureaucracyPerspectiveConstitution...

Unit 10 2024-05-14

15 Items: The smallest unit of lifeSomething that has never been aliveVariations that help a species surviveSomething that is alive or used to be aliveWhen two organisms both need the same resourceAll populations of different species in an areaPhysical differences between members of a speciesMosquitos and humans have this kind of relationship...

WHI.1 Vocabulary Practice 2025-05-24

15 Items: more than necessary ________________________way of life of a society _____________________skilled craftspeople __________________________also known as the New Stone Age ______________________________also known as the Old Stone Age ______________________________way of life characterized by little movement _______________________________...

July is UV Safety Awareness Month 2025-07-09

14 Items: glarecornearetinasunburneyelidspterygiumeyehealthcataractssundamagesunglassesblockUVrayssunprotectionphotokeratitisavoidsunpeakhours

Vocabulary Lesson 6 2022-10-22

10 Items: To conquerHarsh; severeNatural talentAdded/non-essential partAuthoritative command/orderTo give forms of verbs in a fixed orderWithout skill/inappropriate/out-of-placeSevere/constricted/tight or pertaining to scarcity of moneyA serious state of affairs/the condition or point of being joined...

Brains and Development 2025-03-23

12 Items: The outer layer of the brain.The part of the brain that connects to the spinal cord.The part of the brain responsible balance and coordination.Actions that are automatic and happen without conscious control.The lobe of the fully formed brain responsible for functions such as vision....

☆Echo Word Search!☆ 2024-04-22

30 Items: The scientific study of insects.The scientific study of language.The art of thinking. Translated from Greek into "the love for wisdom".French composer and pianist, known for his Gymnopédies and Gnossiennes.Fictional band, created by Blur frontman Damon Albarn and artist Jamie Hewlett....

The Long Way Home Word Search 2025-09-12

16 Items: EarDewBeadMossGnomeStaffCreekBadgerLilvaraAureliaBerriesMushroomsFireplaceNanna Firlof Croaking Stonesof the Listening Leaves

Dillon Singleton Ch.14 Vocab 2025-04-11

13 Items: A fluid's resistance to flowing.Amount of force exerted per unit area.Temperature at which a solid begins to liquefy.Increase in the volume of a substance when the temperature is increased.The process of a solid changing directly to a vapor without forming a liquid.The amount of energy required for a liquid at its boiling point to become a gas....

Glossary 2024-11-11

14 Items: Is a raftelevationsflat ground.enclosed bodyNatural area,low-lying areasjob in the camplanguage of landbetween mountainspoisonous effectspractice of plantingLower than the adsaining land.quantity of water flowing throughThe difference of heught from place to place

Acids and Bases 2025-03-27

15 Items: ph of 7ph below 7ph above 7ph is in _____ of tensph of a neutral substancewhat we trying to neutralizered cabbage is an example of this- what acids and bases are to skindigital device that tells you the pha kind of indicator we use to test pHwhat color litmus paper turns when an acidwhat color litmus paper turns when an base...

Topic 3 2024-01-19

26 Items: means Incomerider with Paul RevereTax on legal documentsriders with Paul Revereclosed the port of BostonProtest against the Tea actharsh and unfair governmentNickname for British Soldiersthe leader of the Sons of Libertyauthor of the Common Sense pamphletWarned the approach of British TroopsGroup that protested British policies...

Long County LIT-erary Terms 2025-12-08

15 Items: device techniques emphasizing sound.repetition of initial consonant sounds.(originally) a poem intended to be sung.a stanza or poem of four lines, usually with alternate rhymes.the leading character, hero, or heroine of a drama or other literary work.the study of historical linguistic change, especially as manifested in individual words....

1B Unit 7 1-14 (across and down only) 2025-03-27

14 Items: A very large cityA large amount; plentyTo go with a person or vehicleA range of different things or peopleA particular way of considering somethingExisting or happening now, seeming modernOf the highest quality or rank; excellentRelating to or characteristic of a city or townRelating to members of your family from the past...

Equilibria Word Search 2025-08-14

10 Items: the amount of a substance produceda reaction that does not go to completionYield oppose direction and an explanation.The equilibrium constant given in units of concentrationthe moles of reactant/product divided by the volume in dm3the amount of reactants/products at the start of a reaction....

Panhandle Press Wordsearch 2025-12-19

19 Items: Billie Jo's brotherma died because of a...Billie jo's favorite hobbywhere the animals are keptBillie Jo threw a pail of...Billie Jo's father's professionthe state where Billie Jo livesBillie Jo's father's girlfriendthe first name of Billie jo's mathe crop Billie jo's father growstime when the economy was very badthe first name of Billie Jo's father...

Clinicaldepression Word Search 2022-10-21

15 Items: UnhappyPsychoanalystA mental disorderRelated to emotionsA form of treatmentA bad way of thinkingAuthor of Harry PotterIn need of sleep and restFreud's theory on depressionA medicinal form of treatmentThe inability to relax or sleepA person who prescribes medicationAnother word for Clinical DepressionActor who's open about his depression...

Pathophysiology word search 2025-02-10

15 Items: The result of an invasion by a miteThick and leathery patches on the skinAn inherited tendency toward allergic conditionsassociated with allergic responses and causes itchiness of the skinCommon infection in infants and children but can also infect adultsBenign lesions that are usually associated with aging or skin damage...

Nervous System 2023-02-05

14 Items: action under our controlThe largest part of the brainregulates blood pressure and breathingconnects your brain to your spinal cordextends downward from the base of your brain.voluntary control of body movements via skeletal musclesbest known for its role in responding to dangerous or stressful situations...

Emily & Aiden 2025-07-20

25 Items: Our first holidayOur favorite hobbyName of 'our' songNumber of GroomsmenAiden's middle nameWhere we got engagedWhere they first metAiden's favorite cityName of wedding venueAiden's favorite sportEmily's favorite sportEmily's favorite hobbyFirst date destinationEmily's favorite colourThe month we got engagedAiden's favorite takeaway...

CV Aging Cl 5 2024-12-09

15 Items: Reestablishes blood flowOcculsion of LAD leading to MIRoto router of coronary vesselsAbbre for Coronary Artery Bypass GraftTroponin levels establish myocyte injuryDamage to all levels of the heart muscleCombines PCI and CABG to improve outcomesLack of adequate oxygen for cell metabolismSupply a list of these if you come to the ED...