end of school Word Searches

10 History Word Search Revision 2024-08-18

42 Items: NAZI symbolAn Axis powerTreaty at end of WW1Prime Minister for most ofAllied power starting with FJapanese Prime Minister in WW2Group Hitler wanted eliminatedRussian leader in WW2.(2 words)German leader in WW2 (two words)Ban on a country trading with othersItalian leader in WW2 was Benito XXXXJapan's resource shortage of R???????...

Professorfaber Word Search 2022-08-19

15 Items: sieveFaber calls himself this."That Favorite Subject, ______"The two-way radio invented by Faber.Mildred and her friends watch this on the walls.This was waiting outside Guy and Mildred's home.Faber believes people do not have enough of this.The poem that Guy reads to Mildred and her friends.Book that Montag starts ripping up in front of Faber....

f 451 2 2022-12-14

15 Items: sandFaber calls himself this."That Favorite Subject, ______"The two-way radio invented by Faber.and her friends watch this on the walls.This was waiting outside Guy and Mildred's home.Faber believes people do not have enough of this.The poem that guy reads to Mildred and her friends.Book that Montag starts ripping up in front of Faber....

Chapter 5: Family Relationships 2026-03-02

18 Items: a brother or sisterabuse of one spouse by the otherlegal agreement to end a marriagea couple and their kid(s) living in one householdintentionally causing physical harm to another personadults failure to provide the basic needs of childrenfamily in which one parent lives with the child or children...

M4 Vocabulary review 2024-09-02

15 Items: the energy of motionthe ability to do worktype of reaction A+B= ABtype of reaction AB= A+Btype of reaction AB+C= AC+Btype of reaction AB+CD= AC+BDmoves from areas of high to lowtype of energy stored in an objectreaction or process that takes in heatreaction or process that releases heatsubstances made from a chemical reaction...

AHA SLEEPOVER 2025 2025-12-11

15 Items: Mr Suleiman’s surnameUstadh Adam’s 3rd son’s nameName of Class of 2024 head boyWhat is Aliyu Tanko’s full nickname?Number of houses in Al-Hidaayah AcademyThis family have enrolled 5 kids in AHAWhat book do AHA students read in Year 8?The male companion green house is named after2026 is AHA’s ___________ year since opening....

Mr. Gerald's Flurry's FOT 2025 Message I 2025-10-10

32 Items: outlawjoyGodrockcrownpeaceZadoklightstonetruththronehastenof GodFlurryof hopeAdullamloyaltyAmaziahnobilityhappinessAntiochusof safetyArmstronggovernmentcommissionrevelationpreparationof the Agesking-priestspurificationrighteousness

The Deluge Wordsearch 2025-03-25

20 Items: GOD"Man of the soil"Made of gopherwoodThe cause of the floodNoah's age when he diesAbundant on the big boatThe symbol of the promiseThe stop to Noah's big boatLasted 40 days and 40 nights2 pairs of this on the big boat7 pairs of this on the big boatAn agreement between God and NoahThe young one whom Noah had cursedThe years of Noah after the Flood....

Classic Literature 2025-10-03

27 Items: WARMANFANGTWISTCRUSOEISLANDGARDENBEAUTYMARNERMY CRYHOBBITMACHINEHATCHETKIDNAPPEDIT COURAGEOF THUNDERFERN GROWSFAHRENHEITCOPPERFIELDOF THE WILDTIME MACHINEFRANKENSTEINOF THE BEAVEROF TWO CITIESOF THE WORLDSFAMILY ROBINSONMAN AND THE SEA

Parts of the school 2026-04-21

7 Items: GymCanteenLibraryArtroomClassroomPlaygroundAssemblyhall

Anatomy & Physiology: G 2026-02-12

30 Items: GumPregnancySense of tasteStorage carbohydrate in animalsPresence of glucose in the urineAnerobic breakdown of glucose to ATPEntire complement of an organism's DNAHormones that regulate the function of the gonadsTuft of capillaries surrounded by Bowman's capsuleProtein that has one or more carbohydrates attached...

Of Mice and Men 2026-06-23

15 Items: Up NorthInstrument of deathWhere Curley meets his wifeKnown as Prince of the ranchWhere deaths escalate in sizeWhere Lennie must go and hideTo be obtained in red, blue, green...Communal space for the men on the ranchWhat Crooks faces as a result of his raceLennie is always wanting what we ain't gotSomething every character has but no one gets...

Disneyland Word Search 2025-05-06

11 Items: The AP title I holdThe middle school I attendedMy favorite place on planet EarthIn 5th grade we took a 3-day field trip hereMy favorite band that l've seen 5 times since 2018The first film I made to be shown in film festivalsLa La _____ The first movie I remember seeing in theaters....

Climate and Natural Resources Word Search 2024-11-08

31 Items: to form a crystal structurePollutants released into the airTrapping of heat near planet's surfaceGradual increase in average temperatureThe average annual conditions of an areaChange Sudden or gradual change in climateRate Number of people born per 1000 individualsRate Number of people who die per 1000 individuals...

Fences Word Search 2023-05-22

40 Items: johnmary1weekfencesplantsfencesjospehflowersbaseballheisretiringplaybaseball1dayand1nightPeter’s Gatescryoutfortroyhefellofacliffnineteenforties2daysand2nightstendtothegardennineteenthirtiesheisdivorcinghernineteenseventiesheisdyingofcancerhewasinacaraccidenthewantedgabe'smoneyTroywerebeingharassedhecouldn'tpaygabe'sbailthecompanylessenedtheirpay...

Lyric genre 2024-11-05

20 Items: stanza with six linespoem with nineteen linesname of a ten syllable line poemit compares by saying one thing is anotherpeople who created lyric poetry in medieval agenumber of verses in the poem Now close the Windowsnumber of stanzas in the poem The House on the HillA figure of speech composed of a striking exaggeration...

UNIT 7 FINE ARTS MAS 2024-03-17

18 Items: A Mexican art movement after the RevolutionArt made by ordinary people using traditional methodsPictures or words painted or drawn on a wall, building, etcMexican art era where more images within Christianity were usedTraditional Mexican musical style during the end of the 19th century...

Weather 2024-11-19

25 Items: Movement of airMeasures wind speedFrozen precipitationLiquid precipitationFrozen precipitationMeasures air pressureRotating column of airStudy of the atmosphereSound caused by lightningHigh-altitude wind currentRain, snow, sleet, or hailVolunteer weather spottersBoundary between air massesRadar technology for weatherPrediction of future weather...

PLAYS 2022-10-25

33 Items: endplayplotactsdramadramagenrestorymusichorrorcomedytittlerhymesscenesactingmiddleromancetragedymusicalsettingthrillerconflictsolutionlanguagecostumesmelodramadialoguesbeginningcharactersplaywrighttragicomedyperformanceexpressions

7 Habits of Highly Effective Teenagers 2017-11-07

34 Items: inendwinlifegoalmindSeanwillloveHabitSevenfirstCoveypowerhighlymissonfriendbuffetmirrorleaderdestinyvictoryrespectteenagerparadigmpatienceeffectiveProactiveintegrityprinciplesleadershipRetroactiverelationshipresponsililty

BUSHONG REVIEW 2025-01-21

20 Items: Energy in motionThe ability to do workAnything occupies spaceUnit of radiation exposureProduct of mass and velocityWhat is the SI unit of force?Electron in the outermost shellRemoval of an electron from an atomAbility to do work by virtue of positionThe force that keeps an electron on orbitSame atomic number but different atomic mass...

minecraft bioms 2019-03-20

5 Items: endkõrbnetherfriikadtasanndik

Swing Word Search 2023-11-08

5 Items: endswimwalkfrogswing

Industrial Revolution Word Search 2026-01-21

24 Items: Steel-making processCo-creator of communismBlack rock used for fuelModernized the steam engineFather of modern capitalismUses steam to power machinesCreator of the Spinning JennyAcute contagious viral diseaseBuilding where goods are producedTurns cotton to threat super efficientlyStimulates immunity to a certain disease...

Dystopian Fiction Vocabulary 2025-09-16

10 Items: serious and immediate dangerto fill up completely with somethingto end or destroy something completelyabsolute and total control by the stateto make someone motionless with awe or terroran irresistible urge to behave in a certain waythe careful and continuous watching of a person or group...

Unit 5 Vocabulary 2024-12-10

28 Items: TERMIMAGESLOPEANGLEANGLESSIMILARVARIABLEDILATIONFUNCTIONVARIABLEROTATIONCLOCKWISECONGRUENTOF CHANGEINTERCEPTREFLECTIONTRANSLATIONTRANSVERSALRELATIONSHIPOF EQUATIONSOF A DILATIONCORRESPONDINGTRANSFORMATIONTO AN EQUATIONTRANSFORMATIONINTERIOR ANGLESCOUNTERCLOCKWISEOF TRANSFORMATION

Unit 6 Statistics Vocabulary 2025-03-04

24 Items: A guess or estimate based on patterns or data trends.A method of collecting data by asking people questions.The entire group being studied in a survey or experiment.– The number(s) that appear most frequently in a data set.A ratio that compares one part of a group to the entire group....

Provider Referral Word Search 2024-03-28

30 Items: 2. __________3. ______________4. ____________ of times referred.2. Language other than ___________California state animal is a ______.2. (orthodontist, endodontist, etc.)3. ______________ for a given provider3. Unusual or exceptional ____________.The member is referred to this team for ________.These needs include things such as: 1._____________...

Bella + Hunter 2025-03-02

23 Items: Groom’s motherBride’s motherBride’s fatherGroom’s fatherGroom’s eye colorBride’s hair colorThey’re tying the ____Bride’s favorite flowerBride will toss the ____Bride’s favorite book genreGroom’s preferred house choreMonth the bride and groom metBride drives this brand of carGroom drives this kind of truckNumber of years law school takes...

christian & shahara 2024-10-24

15 Items: Favorite SeriesSha's dream carSha's favorite colorWhere they first metChristian's dream carFirst tattoo togetherSha's Favorite dessertMonth Christian proposedFavorite ice cream flavorFirst trip together locallyChristian's favorite dessertFirst out of the country tripFavorite activity together (2)Favorite activity together (1)...

Arianne Word Search 2024-10-23

15 Items: mebffmontanacapybarawhere im frommy dog's nameyoghurt and herbthe couch potatoeI "blank" you allthe name of our schoolthe meaning of my namewhat sofie says i havethe subject i hate the mostme and ariannes favorite thingthe word the boys are literally attracted too

Terraria Bosses 2024-09-02

17 Items: BeeLordGolemSlimeSlimePrimeTwinsFishronCultistof LightPlanteraof FleshDeerclopsof WorldsDestroyerof Cthulhuof Cthulhu

Bethlehem's Significance 2023-10-18

21 Items: innholylandstarjudeaHerodfieldcensuslineageWisemenmessiahJourneyof Davidbiblicalof Breadnativityof JosephEphrathahbirthplacepropheciespilgrimage

School in Japan 2026-06-01

39 Items: ITArtP.E.MathsMusicDramaRecessschoolScienceHistoryHome EcteacherHomeroomPeriod 1Period 2Period 3Period 4Period 5Period 6GeographyLunchtimeHumanitiesYear/GradeUniversityManual ArtskindergartenI study _____.Primary SchoolSchool SubjectsI/me (only boys)Religious StudiesJunior High SchoolSenior High SchoolI'm bad at _______.I'm good at _______....

Unit 4 Vocab 2025-10-22

15 Items: PowersymbolsInverseSquaredSimplifyExponentsexpressionParenthesisof equalityproperty of additionproperty of equalityproperty of equalitySubstitutionpropertyproperty of multiplicationproperty of multiplication

ISTILAH-ISTILAH nu patali jeung Materi: Warta, Wawacan, Novel 2021-06-08

32 Items: endleadwacaJawaintrorisetmediajejergalurbelukpupuheventsamanatpaniténnaratifMataramheadlineKiUmbaragurulagungaruwatobservasiwawancarapasantréninstrinsikékstrinsikpurwakantimoboktengahperangbubatpanjiwulungguruwilanganbudakteuneungpuseursawangan

12-21-2025 JBSS When Your Understanding Falls Short Luke 1:26-38 2025-12-01

32 Items: endGodhowsonyouhighHolyLordMarymostwithangelbirthDavidfavorfoundgreathouseJesusafraidJosephspiritvirginGabrielkingdomnothingservantconceiveNazarethElizabethgreetingsimpossible

at school 2022-02-11

13 Items: ourallwaymeethavelikemanyalsopaintborrowpleaselibrarywelcome

School Subjects 2024-01-08

13 Items: artmathsmusicnaturebiologyphysicshistoryenglishgeographychemistryukrainianliteraturephysicaleducation

School Supplies 2025-02-18

13 Items: deskrulerpaperpencileraserfoldercrayonsnotebookscissorsbackpackgluestickcalculatorhighlighter

SCHOOL PLACES 2025-09-03

15 Items: LABHALLPOOLAREAROOMOFFICEOFFICETOILETKITCHENLIBRARYPARKINGPLAYROOMCLASSROOMCAFETERIAEDUCATION RESOURCE ROOM

School values 2026-02-26

13 Items: RespectHonestyEmpathyCourageKindnessIntegrityInclusionToleranceSolidarityPerseveranceCollaborationResponsibilitySelf-discipline

After School 2026-05-19

14 Items: MiaLuisLiamLiamRylieDiegoJadenKadenJamesJustinJarielJulianaNathalySamantha

BioMid Review 2025-12-09

31 Items: the study of cellsthe study of cells2nd phase of mitosis1st phase of mitosis3rd phase of mitosis4th phase of mitosiscondensed threads of chromatinDNA to RNA; occurs in the nucleusDNA enables life through this criteriaorganelle responsible for protein synthesisRNA to protein; takes place inthe cytoplasm...

school subjects 2021-10-04

13 Items: peartmathsmusicdramarussianenglishhistorybiologysciencereadinggeographyliterature

Saturday School 2023-03-04

13 Items: juansandybobbyjihadmalayalondynconnorlacayacamdynzaleahjayvionronnellechristopher

school objects! 2025-09-07

15 Items: pencasebookgluerulerpencilrubberfoldernotebooktextbookscissorsbackpacksharpenersharpenercalculator

SCHOOL FACILITIES 2025-09-17

15 Items: LABGYMROOMROOMROOMFIELDCOURTGARDENLIBRARYRESTROOMSCAFETERIAINFIRMARYSTAFFROOMCLASSROOMPLAYGROUND

SCHOOL OBJECTS 2025-11-18

13 Items: PENBOOKGLUERULERRUBBERPENCILMARKERSCISSORSNOTEBOOKSCHOOLBAGSHARPENERPENCILCASESHEETOFPAPER

School subjects 2026-02-10

13 Items: PEDTREartmathsmusicEnglishhistorysciencereadingspellinggeographycomputing

Onix Middle Names 2024-08-10

18 Items: pegasus’ first namethe ruler of MordorDeveloped the PokédexRank 14 in classic WoWthe act of electrocutionthe most photogenic hourName of the gang in KantoName of generation 1 HeroName of Generation 1 RivalName of Dietrich’s brotherthe hardest mineral on earthReleased alongside Gold versionthe plateau of champions in gen 1...

Cfi Word Search 2023-03-31

22 Items: control towercontrol stationcenter of gravityfirst-person viewFixed-Base OperatorCertificate of WaiverDepartment of DefenseFlight Service StationFlight Tracking Numbercrew resource managementFlight termination pointcontinental United Statesdeclaration of complianceDesignated Pilot ExaminerCode of Federal RegulationsCertificate of Authorization...

School 2025-05-29

8 Items: friendsteacherstudentshomeworkclassroomeducationprincipalexamination

SCHOOL\ 2025-12-03

8 Items: MathTAPSlunchPreathscienceHistoryTheatorEnglishlanguagearts

school 2026-03-13

8 Items: desktablechairrulerpencileraserstudentteacher

School 2026-06-16

8 Items: PenPencilEraserScissorsNotebookSharpenerLiquidpapperAdhesivepencil

CHONDRICHTHEYES 2025-04-14

26 Items: shark.fields.sharks.mother.mother's body.changes in water pressure.The family of rays, also known as eagle rays.The tail fin of a shark or ray, used for propulsion.The family of carpet sharks, including the wobbegongs.A compound found in the liver of sharks, used for buoyancy.The superorder of cartilaginous fish that includes all sharks....

School 2017-01-20

8 Items: slidestoneswingchalkdustbinhopscotchcaretakerplayground

School 2025-07-13

8 Items: BagBookSchoolEraserColourTeacherUniformPrincipal

school 2026-03-18

8 Items: pengluebookrulerchairrubberpencilcrayon

Anatomy & Physiology: D 2026-02-05

34 Items: ToothSet of teethFreely mobile jointExcess production of urineThree-stage process of swallowingPancreatic enzyme that digests DNACompound that increases urine outputDownward motion of the scapula/mandibleMolecule that activates protein kinasesBruch border enzyme that acts on proteinsDecrease in the number of hormone receptors...

Magazine 3 2025-08-19

24 Items: a small songbirda body of running waterthin; having little widtha pleasant smell; fragrancea stopper for a bottle or jugto be unwilling to do somethingsomething that is made or growngiving it strength so it can lastto carry from one place to anotherto push or force into a small placea ruler in charge of land and people...

School Bus 2015-10-13

13 Items: gobusstopfullhometownbusesemptylearnyellowschoolstudentstransportation

My school 2015-09-18

13 Items: gymmeetwalkmathsstartleavefinishsubjectpractisechemistrygeographyhighschoolprimaryschool

school subjects 2017-03-26

13 Items: pemathmusicdramahistoryenglishbiologysciencegeographylanguagescomputingvietnameseliterature

School subjects 2019-02-24

13 Items: ICTartdramamathsGermanEnglishsciencebiologyhistorygeographychemistryphysicaleducationreligiouseducation

school supplies 2020-07-21

13 Items: pensrulerfolderpencilerasermarkerplannerbackpacknotebookhomeworktextbookcalculatorprotractor

The School 2023-01-10

13 Items: hallcoachofficecenterlibraryfountainrestroomprincipalsecretarycafeteriacustodianlibrarianplayground

School Places 2024-11-22

13 Items: QuadHallOvalOfficeCanteenKitchenStaffroomPortablesGymnasiumCommonroomMulticourtsMaintenanceWellbeinghub

High School 2025-10-27

13 Items: sportrhodessewinghammerculturecookingcreativepaintingcommunityconnectiontechnologyfriendshipsbunsenburner

School objects 2025-11-25

13 Items: PenRulerPencilRubberTeacherStudentPlannerLibraryNotebookBackpackHomeworkClassroomBlackboard

School Events 2026-06-02

13 Items: quizracematchdebateconcertcontestrecitalsportsdayschoolplaytalentshowtournamentspellingbeecompetitions

End Of Month Reminders - July 2025-07-25

6 Items: CIIAuditCQIMeetingHAZCleaningLogWasteAreaInspectionPharmacyCleaningLogMyLearningTrainings

End Of Month Reminders - August 2025-08-26

6 Items: CIIAuditCQIMeetingHAZCleaningLogWasteAreaInspectionPharmacyCleaningLogMyLearningTrainings

Nouns 2025-10-06

80 Items: cardayendeyejobkidlawlotmanwayareabackbodybookcasecityfacefactgamehandheadhomehourideakindlifelinenamepartroomsideteamtimeweekwordworkyearchildgrouphouseissuelevelmoneymonthnightplacepointpowerrightstatestorystudythingwaterwomanworldfamilyfatherfriendmemberminutemothernumberothersparentpeopleschoolsystemcompanycountryproblemprogramservicestudent...

Atomic Structure & Periodic Properties 2024-11-25

20 Items: The energy required to remove an electron from an atom.The distribution of electrons among the orbitals of an atom.The energy change that occurs when an atom gains an electron.The outermost electrons of an atom, involved in chemical bonding.Energy levels surrounding the nucleus where electrons are located....

Anatomy & Physiology: B 2026-02-05

20 Items: Mass of chewed foodMid-portion of the stomachDaughter cell of a cleavageFluid-filled cavity of the blastocystPortion of the external nose that lies in the area of the nasal bonesGranulocytes that stain with a basic stain and store histamine/heparinShape of a neuron with two processes extending from the neuron cell body...

Memory 2025-09-09

17 Items: loss of memoryfirst step in memorytype of memory for skillsmemory that is relatively permanentretention of information or experiencethe retention of information over timethe memory of emotionally specific eventsconcentrating on more than one activity at the same timememory loss for a segment of the past but not for new events...

SCHOOL!! 2024-06-13

8 Items: learnstressenglishteachershomeworkeducationclassmatespersonallearningdevice

School 2025-04-10

8 Items: СВЕМИРКОМЕТАРАКЕТАОРБИТАМЕТЕОРСАТЕЛИТАСТЕРОИДАСТРОНАУТ

SCHOOL\ 2025-12-03

8 Items: MathTAPSlunchPreathscienceHistoryTheatorEnglishlanguagearts

School 2026-03-25

8 Items: KidsBookBallReadWriteSchoolPencilNotebook

Lesson 4: Reformation and Reaction Word Search Puzzle 2023-03-21

45 Items: sectromejewsbiblejesusspainparisfaithghettoLutherchurchThesesCalvinof GodjesuitsaintsXaviergermanypriestsconventmuslimscatholicof Wormsreformerof AvilaPaul IIIof Trentreligionsacramenttheocracyisolationchristiancalvinismof LoyolacarmeliteindulgencecorruptionprotestantgovernmentreformationtemperamentlutheranismcatholicismInquisitionpredestination

Federalism Word Search 2025-10-28

20 Items: CartaLockeSenseof LawBranchCollegeRepubliccontractof powersRebellionDemocracyFederalismCompromisecompromisesovereigntyand balancesAnti-Federalistof ConfederationAmerican revolutionEnglish bill of rights

Fantastic Fiction 2025-03-06

20 Items: This title character travels to the islands of Laputa & LilliputPeter Beagle wrote of 'The Last ___' who lived alone "in a lilac wood"Home of House Tyrell, Highgarden is a fertile wine-growing region on this continentThis sword-wielding barbarian from ancient Cimmeria was created by Robert E. Howard...

Food Vocabulary 2026-01-06

10 Items: To be presentTo bite food wellAnother word for tastyTo take food in a dishAnother word for crunchyA dish used to serve foodTo enjoy the food you are eatingA sweet eaten at the end of a mealWhen food passes through your throatA large amount of food eaten at one time

School Subjects 2022-04-25

13 Items: PEDTFLICTdramamathsdesignbiologyhistoryphysicssciencechemistrygeography

SCHOOL SUPPLIES 2022-10-28

13 Items: penbookdeskboardtablechairmarkerpencileraserteacherstudentpicturenotebook

school stuff 2023-09-25

13 Items: bandmathdeskpaperapplelunchbooksschoolpenciltrumpetsciencereadingstudies

School Supplies 2024-07-29

14 Items: mapgluepaperrulereraserfolderpencilsmarkerscrayonsnotebooknotebookbackpackscissorscalculator

School subjects 2025-07-25

13 Items: artmathmusicdancesportsenglishbiologyphysicshistorychemistrytechnologysocialstudiesphysicaleducation

School Objects 2026-04-17

13 Items: PENDESKBOOKGLUERULERCHAIRPENCILERASERCRAYONNOTEBOOKSCISSORSSHARPENERPENCILCASE

School Spirit 2026-04-21

13 Items: Who's number 1?They move 'As One'Our favourite mascot.Our two school colours.Our May running fundraiser.Plans all our school events.A shoe for traction on the ground.Teaches and stands by you every game.The senior girls are rocking this sport.How many senior teams are playing this term?There to support on the field to win the game....

Bethlehem's Significance 2023-10-18

21 Items: innholylandstarjudeaHerodfieldcensuslineageWisemenmessiahJourneyof Davidbiblicalof Breadnativityof JosephEphrathahbirthplacepropheciespilgrimage

Classroom 2024-11-03

11 Items: An instrument for writing with ink.Something you sit on in a classroom.A period of teaching or instruction.A person who attends school to learn.An exam to evaluate students' knowledge.Assignments students do outside of class.A small item used to remove pencil marks.A collection of pages with information or stories....

greek gods 2024-02-02

10 Items: messengergod of wargod of firegod of the seagoddess of lovegoddess of huntthe king of godsgod of underworldthe god of archerygoddess of harvest

Emily's Birthday Word Search 2025-05-27

25 Items: sunteagameemilypartyall y'allcroissantbirthstonehair colormini colorzodiac signplace of birthwhat today is!!!____, emily ____animal i despiseupcoming vacation#1 lady of my lifefavorite breed of dog32 of these on a cakethe month of my birthfavorite kind of cakeband seen the most timescountry visited the most#1 fella of my life (RIP)...

Jesus Word Search 2024-12-30

15 Items: LordRockJesusChristSaviorMessiahEmmanuelRedeemerThe WordTrue VineSon of GodLamb of GodGood ShepherdBread of LifePrince of Peace

6th Grade Earth Science 2026-05-29

16 Items: Small pieces of sand and rockOuter most layer of the earthThe breaking down of sedimentsA large,continuous mass of landEvaporation from the leaves of plantsA characteristic or quality of an itemLayer of the earth that is made of magmaSurface that allows water to pass throughThe movement of sediment by wind or water...

School 2013-08-14

8 Items: flourodourcoursehumourdetourflavourmournfulfavourite